F346829

General Info

Members Datasets Scaffolds Average Seq Length
234 138 468 223

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100611452|Ga0070713_1006114521
Length 243
Sequence VHLLSRRELPSDRRGKMKSIIVTALVLTPLLAMDKGSAKRLEESAAVFSEVMSAPDKGIPQEMLENAHCIVIVPGEKTAAFVFGAKYGKGYLSCRNKERGWSAPGTVRIEGGSFGFQIGGSQTDVIMLVMNERGADKLLSSKFTLGAEGSVAAGPVGRTATAQTDAQMHAEILSWSRSQGLFAGIALEGATLRQDLDDNATLYGRKIGNREIVTSNIHAPKAAFRLLGLLNKYSWHERVVSQR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.6
Metatranscriptomes 9.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 35.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100611452 3300005436 Unclassified 1036
2 Ga0058860_12133683 3300004801 Bacteria 1511
3 Ga0070658_10140843 3300005327 Unclassified 2015
4 Ga0070683_100078546 3300005329 Bacteria 3088
5 Ga0070690_100116219 3300005330 Unclassified 1791
6 Ga0068868_100021687 3300005338 Bacteria 4839
7 Ga0070689_100101778 3300005340 Unclassified 2274
8 Ga0070689_100591580 3300005340 Unclassified 960
9 Ga0070692_10185849 3300005345 Bacteria 1207
10 Ga0070669_100238969 3300005353 Bacteria 1442
11 Ga0070669_100820251 3300005353 Unclassified 791
12 Ga0070671_100026429 3300005355 Unclassified 4770
13 Ga0070671_100092781 3300005355 Unclassified 2530
14 Ga0070673_100011586 3300005364 Bacteria 6023
15 Ga0070659_100043006 3300005366 Unclassified 3532
16 Ga0070714_100026699 3300005435 Unclassified 4775
17 Ga0070713_100475032 3300005436 Unclassified 1177
18 Ga0070711_100055643 3300005439 Bacteria 2734
19 Ga0070708_100152498 3300005445 Unclassified 2150
20 Ga0070678_100048071 3300005456 Bacteria 3070
21 Ga0070662_100062235 3300005457 Bacteria 2726
22 Ga0070681_10014586 3300005458 Bacteria 7820
23 Ga0070706_100202888 3300005467 Bacteria 1852
24 Ga0070699_100059072 3300005518 Bacteria 3323
25 Ga0070679_100500711 3300005530 Unclassified 1159
26 Ga0070684_100032033 3300005535 Bacteria 4478
27 Ga0070684_100131568 3300005535 Bacteria 2257
28 Ga0068853_100173159 3300005539 Bacteria 1954
29 Ga0070695_100066107 3300005545 Unclassified 2356
30 Ga0070695_100077424 3300005545 Bacteria 2192
31 Ga0070695_100101960 3300005545 Bacteria 1934
32 Ga0070693_100084445 3300005547 Bacteria 1900
33 Ga0070693_100190090 3300005547 Bacteria 1327
34 Ga0070665_100523626 3300005548 Bacteria 1197
35 Ga0068855_100068591 3300005563 Unclassified 4128
36 Ga0068855_100079097 3300005563 Bacteria 3814
37 Ga0068855_100105208 3300005563 Unclassified 3245
38 Ga0068855_100273336 3300005563 Bacteria 1878
39 Ga0070664_100311471 3300005564 Unclassified 1425
40 Ga0068857_100008363 3300005577 Bacteria 8940
41 Ga0068857_100451554 3300005577 Unclassified 1202
42 Ga0068854_100427493 3300005578 Bacteria 1101
43 Ga0068856_100025795 3300005614 Bacteria 5731
44 Ga0068856_100097217 3300005614 Bacteria 2933
45 Ga0068856_100715815 3300005614 Unclassified 1021
46 Ga0070702_100471486 3300005615 Bacteria 915
47 Ga0068864_100138254 3300005618 Bacteria 2195
48 Ga0068866_10031677 3300005718 Bacteria 2549
49 Ga0068863_100123660 3300005841 Bacteria 2468
50 Ga0068858_100661292 3300005842 Unclassified 1015
51 Ga0068860_100422154 3300005843 Bacteria 1322
52 Ga0070717_10047690 3300006028 Bacteria 3511
53 Ga0070717_10090449 3300006028 Bacteria 2583
54 Ga0097621_100237139 3300006237 Bacteria 1594
55 Ga0075428_100067015 3300006844 Unclassified 3930
56 Ga0075428_100134043 3300006844 Bacteria 2693
57 Ga0075428_100404124 3300006844 Bacteria 1464
58 Ga0075428_100434434 3300006844 Unclassified 1406
59 Ga0075430_100010992 3300006846 Bacteria 7668
60 Ga0075430_100028198 3300006846 Bacteria 4770
61 Ga0075430_100038808 3300006846 Bacteria 4033
62 Ga0075430_100160614 3300006846 Bacteria 1870
63 Ga0075431_100000684 3300006847 Bacteria 29076
64 Ga0075431_100040000 3300006847 Unclassified 4831
65 Ga0075431_100092022 3300006847 Bacteria 3130
66 Ga0075431_100375733 3300006847 Unclassified 1426
67 Ga0075429_100167015 3300006880 Unclassified 1927
68 Ga0075429_100168617 3300006880 Bacteria 1918
69 Ga0075429_100363470 3300006880 Unclassified 1267
70 Ga0075435_100195073 3300007076 Bacteria 1715
71 Ga0105240_10000877 3300009093 Bacteria 54159
72 Ga0105240_10114711 3300009093 Unclassified 3254
73 Ga0105240_10215407 3300009093 Unclassified 2241
74 Ga0111539_10266306 3300009094 Unclassified 1995
75 Ga0105245_10025406 3300009098 Bacteria 5210
76 Ga0105247_10031008 3300009101 Bacteria 3243
77 Ga0114129_10033530 3300009147 Bacteria 7257
78 Ga0114129_10172158 3300009147 Bacteria 2951
79 Ga0114129_10427746 3300009147 Bacteria 1740
80 Ga0114129_10994443 3300009147 Bacteria 1057
81 Ga0105243_10451974 3300009148 Bacteria 1206
82 Ga0105241_10006448 3300009174 Bacteria 8648
83 Ga0105241_10018360 3300009174 Bacteria 5146
84 Ga0105241_10039678 3300009174 Bacteria 3552
85 Ga0105241_10046960 3300009174 Unclassified 3281
86 Ga0105241_10085791 3300009174 Bacteria 2475
87 Ga0105241_10226172 3300009174 Bacteria 1575
88 Ga0105242_10112098 3300009176 Bacteria 2327
89 Ga0105242_10216143 3300009176 Bacteria 1711
90 Ga0105242_10656252 3300009176 Bacteria 1021
91 Ga0105242_10763062 3300009176 Bacteria 953
92 Ga0105248_10005802 3300009177 Bacteria 13571
93 Ga0105248_10010273 3300009177 Bacteria 10305
94 Ga0105248_10038777 3300009177 Bacteria 5334
95 Ga0105248_10099239 3300009177 Bacteria 3281
96 Ga0105248_10189103 3300009177 Bacteria 2320
97 Ga0105248_10205697 3300009177 Bacteria 2218
98 Ga0105248_10283288 3300009177 Bacteria 1866
99 Ga0105237_10009786 3300009545 Bacteria 10250
100 Ga0105238_10010364 3300009551 Bacteria 9354
101 Ga0105238_10093998 3300009551 Bacteria 2986
102 Ga0105238_10106558 3300009551 Bacteria 2784
103 Ga0105238_10383623 3300009551 Unclassified 1397
104 Ga0105239_10004471 3300010375 Bacteria 16709
105 Ga0105239_10014517 3300010375 Bacteria 8739
106 Ga0105239_10019530 3300010375 Bacteria 7480
107 Ga0105239_10023501 3300010375 Bacteria 6789
108 Ga0105239_10323489 3300010375 Unclassified 1739
109 Ga0157371_10400219 3300013102 Bacteria 1005
110 Ga0157370_10010630 3300013104 Bacteria 9686
111 Ga0157374_10041517 3300013296 Unclassified 4240
112 Ga0157374_10439216 3300013296 Unclassified 1305
113 Ga0157374_10742328 3300013296 Unclassified 996
114 Ga0157378_10006900 3300013297 Bacteria 9912
115 Ga0157378_10605288 3300013297 Bacteria 1107
116 Ga0163162_10085709 3300013306 Bacteria 3227
117 Ga0163162_10124626 3300013306 Bacteria 2682
118 Ga0157372_10009202 3300013307 Bacteria 10501
119 Ga0157372_10323790 3300013307 Unclassified 1795
120 Ga0157372_10955138 3300013307 Bacteria 993
121 Ga0157375_10237923 3300013308 Unclassified 1980
122 Ga0157375_10746095 3300013308 Unclassified 1130
123 Ga0157375_11106813 3300013308 Bacteria 927
124 Ga0163163_10026025 3300014325 Bacteria 5587
125 Ga0163163_10356303 3300014325 Bacteria 1519
126 Ga0157380_10404802 3300014326 Bacteria 1296
127 Ga0157379_10032839 3300014968 Bacteria 4628
128 Ga0157379_10067498 3300014968 Bacteria 3196
129 Ga0157379_10600672 3300014968 Unclassified 1027
130 Ga0157376_10445452 3300014969 Bacteria 1262
131 Ga0197907_10703389 3300020069 Unclassified 1530
132 Ga0206351_10792989 3300020077 Unclassified 813
133 Ga0206352_10330346 3300020078 Bacteria 1401
134 Ga0206352_10629356 3300020078 Unclassified 706
135 Ga0206352_10898465 3300020078 Unclassified 1482
136 Ga0206350_10001703 3300020080 Unclassified 769
137 Ga0206350_10352363 3300020080 Bacteria 1186
138 Ga0206350_10700840 3300020080 Unclassified 1638
139 Ga0206353_11469297 3300020082 Unclassified 1672
140 Ga0154015_1351996 3300020610 Unclassified 875
141 Ga0154015_1485768 3300020610 Bacteria 914
142 Ga0207699_10023151 3300025906 Unclassified 3377
143 Ga0207699_10479234 3300025906 Unclassified 896
144 Ga0207705_10271353 3300025909 Unclassified 1297
145 Ga0207654_10096846 3300025911 Bacteria 1810
146 Ga0207707_10024835 3300025912 Bacteria 5242
147 Ga0207695_10056310 3300025913 Bacteria 4092
148 Ga0207695_10082555 3300025913 Unclassified 3248
149 Ga0207695_10404730 3300025913 Unclassified 1249
150 Ga0207663_10334015 3300025916 Unclassified 1143
151 Ga0207652_10018402 3300025921 Bacteria 5729
152 Ga0207681_10228859 3300025923 Bacteria 1442
153 Ga0207694_10022627 3300025924 Unclassified 4769
154 Ga0207694_10102659 3300025924 Unclassified 2267
155 Ga0207694_10257216 3300025924 Bacteria 1430
156 Ga0207694_10292420 3300025924 Bacteria 1340
157 Ga0207700_10113707 3300025928 Bacteria 2183
158 Ga0207664_10014041 3300025929 Bacteria 5775
159 Ga0207644_10069370 3300025931 Bacteria 2574
160 Ga0207644_10261686 3300025931 Bacteria 1383
161 Ga0207706_10058286 3300025933 Bacteria 3401
162 Ga0207686_10144175 3300025934 Bacteria 1650
163 Ga0207686_10159411 3300025934 Bacteria 1580
164 Ga0207665_10455112 3300025939 Bacteria 983
165 Ga0207711_10013236 3300025941 Bacteria 6854
166 Ga0207711_10099966 3300025941 Bacteria 2565
167 Ga0207711_10124895 3300025941 Bacteria 2301
168 Ga0207711_10641409 3300025941 Bacteria 991
169 Ga0207661_10061734 3300025944 Bacteria 3029
170 Ga0207667_10055830 3300025949 Unclassified 4150
171 Ga0207667_10085756 3300025949 Unclassified 3260
172 Ga0207667_10311955 3300025949 Bacteria 1606
173 Ga0207651_10026064 3300025960 Unclassified 3645
174 Ga0207651_10189447 3300025960 Bacteria 1639
175 Ga0207703_10270404 3300026035 Bacteria 1539
176 Ga0207639_10028159 3300026041 Bacteria 4100
177 Ga0207702_10018094 3300026078 Bacteria 5831
178 Ga0207641_10153327 3300026088 Bacteria 2088
179 Ga0207676_10012364 3300026095 Bacteria 6114
180 Ga0207674_10006370 3300026116 Bacteria 13891
181 Ga0207683_10216716 3300026121 Bacteria 1744
182 Ga0265338_10021575 3300028800 Bacteria 6710
183 Ga0265338_10090629 3300028800 Bacteria 2530
184 Ga0265775_100459 3300030762 Bacteria 1649
185 Ga0265777_107791 3300030877 Unclassified 751
186 Ga0265776_100803 3300030880 Unclassified 1207
187 Ga0265779_104330 3300031043 Unclassified 753
188 Ga0265332_10031672 3300031238 Bacteria 2306
189 Ga0265316_10006268 3300031344 Bacteria 11399
190 Ga0265316_10131738 3300031344 Bacteria 1883
191 Ga0265342_10088165 3300031712 Unclassified 1782
192 Ga0373943_0196635 3300035170 Unclassified 1114
193 Ga0373955_0546406 3300035172 Unclassified 709
194 Ga0373931_0072453 3300035691 Bacteria 1884
195 Ga0373931_0134888 3300035691 Bacteria 1425
196 Ga0373937_0238838 3300036401 Unclassified 1712
197 Ga0265778_000375 3300036457 Bacteria 3441
198 Ga0265778_008499 3300036457 Unclassified 1141
199 Ga0265778_023304 3300036457 Unclassified 774
200 Ga0373925_0007765 3300037068 Bacteria 7806
201 Ga0439444_0005331 3300042437 Bacteria 1904
202 Ga0451576_1285365 3300045051 Unclassified 763
203 Ga0495603_0498579 3300046455 Unclassified 697
204 Ga0495629_0010516 3300046459 Bacteria 6731
205 Ga0495629_0792737 3300046459 Unclassified 625
206 Ga0495580_0123244 3300046472 Unclassified 1799
207 Ga0495580_0140138 3300046472 Bacteria 1676
208 Ga0495639_0158902 3300046475 Unclassified 1093
209 Ga0495594_0079056 3300046499 Bacteria 1836
210 Ga0495640_0528484 3300046533 Unclassified 716
211 Ga0495658_0107813 3300046683 Bacteria 1671
212 Ga0495658_0585813 3300046683 Unclassified 714
213 Ga0495624_0409272 3300046690 Unclassified 814
214 Ga0495674_0346732 3300047319 Bacteria 1206
215 Ga0495674_0488896 3300047319 Bacteria 986
216 Ga0495676_0069323 3300047321 Unclassified 2721
217 Ga0496115_0155237 3300048918 Unclassified 1891
218 Ga0501075_0612089 3300049591 Unclassified 831
219 nmdc:mga05p37_579924_c1 3300050507 Unclassified 1270
220 nmdc:mga05p37_8007_c1 3300050507 Bacteria 12475
221 nmdc:mga09592_473719_c1 3300050508 Bacteria 1079
222 nmdc:mga0qj67_15833_c1 3300050509 Bacteria 5710
223 nmdc:mga0qj67_287076_c1 3300050509 Bacteria 1334
224 nmdc:mga0qj67_36550_c1 3300050509 Unclassified 3843
225 nmdc:mga06r32_118050_c1 3300050510 Bacteria 2615
226 nmdc:mga06r32_568420_c1 3300050510 Bacteria 1107
227 nmdc:mga06r32_82537_c1 3300050510 Bacteria 3131
228 nmdc:mga0rr50_47898_c1 3300050513 Bacteria 3156
229 nmdc:mga08x19_220182_c1 3300050514 Unclassified 1304
230 Ga0495601_0585247 3300053077 Bacteria 717
231 Ga0495612_0206316 3300053078 Unclassified 868
232 Ga0587066_039380 3300059490 Bacteria 884
233 Ga0587094_008054 3300059513 Unclassified 1308
234 Ga0587075_007608 3300059644 Unclassified 1363
235 Ga0070713_100611452
236 Ga0058860_12133683
237 Ga0070658_10140843
238 Ga0070683_100078546
239 Ga0070690_100116219
240 Ga0068868_100021687
241 Ga0070689_100101778
242 Ga0070689_100591580
243 Ga0070692_10185849
244 Ga0070669_100238969
245 Ga0070669_100820251
246 Ga0070671_100026429
247 Ga0070671_100092781
248 Ga0070673_100011586
249 Ga0070659_100043006
250 Ga0070714_100026699
251 Ga0070713_100475032
252 Ga0070711_100055643
253 Ga0070708_100152498
254 Ga0070678_100048071
255 Ga0070662_100062235
256 Ga0070681_10014586
257 Ga0070706_100202888
258 Ga0070699_100059072
259 Ga0070679_100500711
260 Ga0070684_100032033
261 Ga0070684_100131568
262 Ga0068853_100173159
263 Ga0070695_100066107
264 Ga0070695_100077424
265 Ga0070695_100101960
266 Ga0070693_100084445
267 Ga0070693_100190090
268 Ga0070665_100523626
269 Ga0068855_100068591
270 Ga0068855_100079097
271 Ga0068855_100105208
272 Ga0068855_100273336
273 Ga0070664_100311471
274 Ga0068857_100008363
275 Ga0068857_100451554
276 Ga0068854_100427493
277 Ga0068856_100025795
278 Ga0068856_100097217
279 Ga0068856_100715815
280 Ga0070702_100471486
281 Ga0068864_100138254
282 Ga0068866_10031677
283 Ga0068863_100123660
284 Ga0068858_100661292
285 Ga0068860_100422154
286 Ga0070717_10047690
287 Ga0070717_10090449
288 Ga0097621_100237139
289 Ga0075428_100067015
290 Ga0075428_100134043
291 Ga0075428_100404124
292 Ga0075428_100434434
293 Ga0075430_100010992
294 Ga0075430_100028198
295 Ga0075430_100038808
296 Ga0075430_100160614
297 Ga0075431_100000684
298 Ga0075431_100040000
299 Ga0075431_100092022
300 Ga0075431_100375733
301 Ga0075429_100167015
302 Ga0075429_100168617
303 Ga0075429_100363470
304 Ga0075435_100195073
305 Ga0105240_10000877
306 Ga0105240_10114711
307 Ga0105240_10215407
308 Ga0111539_10266306
309 Ga0105245_10025406
310 Ga0105247_10031008
311 Ga0114129_10033530
312 Ga0114129_10172158
313 Ga0114129_10427746
314 Ga0114129_10994443
315 Ga0105243_10451974
316 Ga0105241_10006448
317 Ga0105241_10018360
318 Ga0105241_10039678
319 Ga0105241_10046960
320 Ga0105241_10085791
321 Ga0105241_10226172
322 Ga0105242_10112098
323 Ga0105242_10216143
324 Ga0105242_10656252
325 Ga0105242_10763062
326 Ga0105248_10005802
327 Ga0105248_10010273
328 Ga0105248_10038777
329 Ga0105248_10099239
330 Ga0105248_10189103
331 Ga0105248_10205697
332 Ga0105248_10283288
333 Ga0105237_10009786
334 Ga0105238_10010364
335 Ga0105238_10093998
336 Ga0105238_10106558
337 Ga0105238_10383623
338 Ga0105239_10004471
339 Ga0105239_10014517
340 Ga0105239_10019530
341 Ga0105239_10023501
342 Ga0105239_10323489
343 Ga0157371_10400219
344 Ga0157370_10010630
345 Ga0157374_10041517
346 Ga0157374_10439216
347 Ga0157374_10742328
348 Ga0157378_10006900
349 Ga0157378_10605288
350 Ga0163162_10085709
351 Ga0163162_10124626
352 Ga0157372_10009202
353 Ga0157372_10323790
354 Ga0157372_10955138
355 Ga0157375_10237923
356 Ga0157375_10746095
357 Ga0157375_11106813
358 Ga0163163_10026025
359 Ga0163163_10356303
360 Ga0157380_10404802
361 Ga0157379_10032839
362 Ga0157379_10067498
363 Ga0157379_10600672
364 Ga0157376_10445452
365 Ga0197907_10703389
366 Ga0206351_10792989
367 Ga0206352_10330346
368 Ga0206352_10629356
369 Ga0206352_10898465
370 Ga0206350_10001703
371 Ga0206350_10352363
372 Ga0206350_10700840
373 Ga0206353_11469297
374 Ga0154015_1351996
375 Ga0154015_1485768
376 Ga0207699_10023151
377 Ga0207699_10479234
378 Ga0207705_10271353
379 Ga0207654_10096846
380 Ga0207707_10024835
381 Ga0207695_10056310
382 Ga0207695_10082555
383 Ga0207695_10404730
384 Ga0207663_10334015
385 Ga0207652_10018402
386 Ga0207681_10228859
387 Ga0207694_10022627
388 Ga0207694_10102659
389 Ga0207694_10257216
390 Ga0207694_10292420
391 Ga0207700_10113707
392 Ga0207664_10014041
393 Ga0207644_10069370
394 Ga0207644_10261686
395 Ga0207706_10058286
396 Ga0207686_10144175
397 Ga0207686_10159411
398 Ga0207665_10455112
399 Ga0207711_10013236
400 Ga0207711_10099966
401 Ga0207711_10124895
402 Ga0207711_10641409
403 Ga0207661_10061734
404 Ga0207667_10055830
405 Ga0207667_10085756
406 Ga0207667_10311955
407 Ga0207651_10026064
408 Ga0207651_10189447
409 Ga0207703_10270404
410 Ga0207639_10028159
411 Ga0207702_10018094
412 Ga0207641_10153327
413 Ga0207676_10012364
414 Ga0207674_10006370
415 Ga0207683_10216716
416 Ga0265338_10021575
417 Ga0265338_10090629
418 Ga0265775_100459
419 Ga0265777_107791
420 Ga0265776_100803
421 Ga0265779_104330
422 Ga0265332_10031672
423 Ga0265316_10006268
424 Ga0265316_10131738
425 Ga0265342_10088165
426 Ga0373943_0196635
427 Ga0373955_0546406
428 Ga0373931_0072453
429 Ga0373931_0134888
430 Ga0373937_0238838
431 Ga0265778_000375
432 Ga0265778_008499
433 Ga0265778_023304
434 Ga0373925_0007765
435 Ga0439444_0005331
436 Ga0451576_1285365
437 Ga0495603_0498579
438 Ga0495629_0010516
439 Ga0495629_0792737
440 Ga0495580_0123244
441 Ga0495580_0140138
442 Ga0495639_0158902
443 Ga0495594_0079056
444 Ga0495640_0528484
445 Ga0495658_0107813
446 Ga0495658_0585813
447 Ga0495624_0409272
448 Ga0495674_0346732
449 Ga0495674_0488896
450 Ga0495676_0069323
451 Ga0496115_0155237
452 Ga0501075_0612089
453 nmdc:mga05p37_579924_c1
454 nmdc:mga05p37_8007_c1
455 nmdc:mga09592_473719_c1
456 nmdc:mga0qj67_15833_c1
457 nmdc:mga0qj67_287076_c1
458 nmdc:mga0qj67_36550_c1
459 nmdc:mga06r32_118050_c1
460 nmdc:mga06r32_568420_c1
461 nmdc:mga06r32_82537_c1
462 nmdc:mga0rr50_47898_c1
463 nmdc:mga08x19_220182_c1
464 Ga0495601_0585247
465 Ga0495612_0206316
466 Ga0587066_039380
467 Ga0587094_008054
468 Ga0587075_007608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

110

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7778 26 188
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7435 26 188
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.5501 20 190
2w56-assembly1.cif.gz_A structure of the hypothetical protein vc0508 from vibrio cholerae vsp- ii pathogenicity island 0.4821 31 117
7r6q-assembly1.cif.gz_K state e2 nucleolar 60s ribosome biogenesis intermediate - foot region model 0.4776 30 70
ID Description Score Start End Superfamily
af_A0A1D8PGZ5_384_533_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.5726 21 70 3.30.1490.100
2c4iA02 Mainly Beta;Beta Barrel;Lipocalin;Avidin-like 0.3852 61 127 2.40.128.30
af_Q4D3B8_1_430_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.3618 17 71 3.90.1720.10
af_P55157_29_273_2.30.230.10 Mainly Beta;Roll;Lipovitellin-phosvitin complex; beta-sheet shell regions;Lipovitellin; beta-sheet shell regions, chain A 0.3203 59 125 2.30.230.10
af_F1R7N1_23_249_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.3112 24 86 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A3B9MKS6-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9254 25 227 GO:0035091
AF-A0A2V9ZAB9-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9146 20 226 GO:0035091
AF-A0A1Q6XHR1-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9093 18 228 GO:0035091
AF-A0A2V9V1W6-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9086 19 226 GO:0035091
AF-A0A2V9PRI4-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.908 16 226 GO:0035091

Map