F346482

General Info

Members Datasets Scaffolds Average Seq Length
233 129 209 415

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0086757|Ga0496126_0086757_1197_2618
Length 473
Sequence MKFAIAVHGTRGDIEPCAAVALELIRRGHDVSMAVPPNLIPFAQACGITPVLPYGVDSQQQLEASIFRKSWGVRNPRKEWRELEDYLSQGWAEMSTALVNLAEDADLILTGTTYQEVAANVAEHLETPLASLHYFPFRANSVMFPSVPRWLAHTIWPVAESLYWRLMKRAEIAQRYALGLPRTRKRAIRRIIDVSSVEIQAYDPLLFDGLAQEWAGRRPLIGSLTLELDTDSDAQTEAWISEGTPPIYFGFGSMPVECPSAAVAMITKVCAELGERALICSGVWDIPDTSSPNVRIVRNISHARVFPKCRAVVHHGGAGTTAAGLRAGMPTFILWISAEQPLWAKRVTKLGVGTSERFSIATPESIRAGLQTVLRPQYRRRAVTIAGEMTTPQDSVSAAADLLEAAAHNSRSVATPPRAAHVPRHEPIHHHEHEMFPAAFDIGPRDVLTDRTHQQVIRFNAVHPSDRRIHIAE

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2626541554 Frankia sp. AvcI.1 Isolate Nodule
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
8 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
9 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
10 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
11 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
12 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
15 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
16 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
124 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
128 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
129 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.13
Metatranscriptomes 0
Isolates 9.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.33
Nodule 3
Rhizoplane 10.73
Rhizosphere 33.91
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000484 3300001977 Bacteria 5951
2 JGI25153J46596_10000094 3300003215 Bacteria 103036
3 JGI25153J46596_10000151 3300003215 Bacteria 70139
4 rootH1_10083868 3300003323 Bacteria 4912
5 rootH1_10304748 3300003323 Bacteria 2468
6 Ga0055540_1000036 3300003792 Bacteria 164285
7 Ga0055540_1000987 3300003792 Bacteria 18356
8 Ga0055531_10015476 3300003794 Bacteria 3357
9 Ga0070668_100178500 3300005347 Bacteria 1733
10 Ga0070671_100028076 3300005355 Bacteria 4634
11 Ga0070671_100057935 3300005355 Bacteria 3224
12 Ga0070674_100009968 3300005356 Bacteria 5719
13 Ga0070673_100100694 3300005364 Bacteria 2379
14 Ga0070688_100204865 3300005365 Bacteria 1382
15 Ga0070667_100002535 3300005367 Bacteria 15908
16 Ga0070667_100095510 3300005367 Bacteria 2563
17 Ga0070667_100186171 3300005367 Bacteria 1837
18 Ga0070667_100193601 3300005367 Bacteria 1802
19 Ga0070700_100073892 3300005441 Bacteria 2183
20 Ga0070662_100132262 3300005457 Bacteria 1925
21 Ga0070665_100025290 3300005548 Bacteria 5981
22 Ga0068870_10044863 3300005840 Unclassified 2311
23 Ga0068863_100040111 3300005841 Bacteria 4452
24 Ga0068863_100185574 3300005841 Unclassified 1998
25 Ga0068862_100156293 3300005844 Bacteria 2033
26 Ga0081455_10019578 3300005937 Bacteria 6398
27 Ga0075365_10000639 3300006038 Bacteria 13886
28 Ga0075365_10001883 3300006038 Bacteria 9880
29 Ga0075365_10004835 3300006038 Bacteria 7190
30 Ga0075365_10007298 3300006038 Bacteria 6179
31 Ga0075365_10021201 3300006038 Bacteria 4049
32 Ga0075365_10025177 3300006038 Bacteria 3765
33 Ga0075365_10034301 3300006038 Bacteria 3277
34 Ga0075365_10101353 3300006038 Bacteria 1971
35 Ga0075363_100000346 3300006048 Bacteria 13913
36 Ga0075363_100001435 3300006048 Bacteria 9032
37 Ga0075363_100001501 3300006048 Bacteria 8902
38 Ga0075363_100009274 3300006048 Bacteria 4622
39 Ga0075364_10001769 3300006051 Bacteria 11935
40 Ga0075364_10006597 3300006051 Bacteria 6833
41 Ga0075364_10009441 3300006051 Bacteria 5854
42 Ga0075364_10014634 3300006051 Bacteria 4851
43 Ga0075364_10071027 3300006051 Bacteria 2293
44 Ga0075367_10004734 3300006178 Bacteria 6694
45 Ga0075367_10004994 3300006178 Bacteria 6543
46 Ga0075367_10020708 3300006178 Bacteria 3667
47 Ga0075367_10038189 3300006178 Bacteria 2794
48 Ga0075369_10002573 3300006186 Bacteria 6490
49 Ga0075369_10005976 3300006186 Bacteria 4581
50 Ga0075369_10071933 3300006186 Bacteria 1523
51 Ga0075370_10054213 3300006353 Bacteria 2276
52 Ga0075370_10115407 3300006353 Bacteria 1561
53 Ga0068871_100209824 3300006358 Unclassified 1684
54 Ga0075430_100158542 3300006846 Bacteria 1884
55 Ga0105245_10012077 3300009098 Bacteria 7510
56 Ga0105237_10007309 3300009545 Bacteria 12110
57 Ga0105249_10015539 3300009553 Bacteria 6738
58 Ga0105249_10048306 3300009553 Bacteria 3880
59 Ga0105249_10364797 3300009553 Bacteria 1467
60 Ga0105239_10004827 3300010375 Bacteria 15969
61 Ga0105239_10371325 3300010375 Bacteria 1616
62 Ga0105246_10006303 3300011119 Bacteria 7240
63 Ga0157374_10017355 3300013296 Bacteria 6336
64 Ga0157375_10154018 3300013308 Bacteria 2436
65 Ga0163163_10120930 3300014325 Bacteria 2652
66 Ga0157380_10033460 3300014326 Bacteria 3958
67 Ga0157377_10035145 3300014745 Bacteria 2747
68 Ga0213876_10016000 3300021384 Bacteria 3968
69 Ga0209673_1014616 3300025273 Bacteria 3029
70 Ga0209758_1000120 3300025297 Bacteria 192212
71 Ga0209256_1001501 3300025299 Bacteria 23665
72 Ga0209051_1000021 3300025303 Bacteria 507633
73 Ga0209051_1000990 3300025303 Bacteria 27441
74 Ga0209051_1012072 3300025303 Bacteria 4205
75 Ga0209051_1016762 3300025303 Bacteria 3297
76 Ga0209257_1006987 3300025304 Bacteria 7021
77 Ga0207688_10027446 3300025901 Bacteria 3132
78 Ga0207671_10027984 3300025914 Bacteria 4213
79 Ga0207687_10021830 3300025927 Bacteria 4256
80 Ga0207706_10124933 3300025933 Bacteria 2263
81 Ga0207712_10060195 3300025961 Bacteria 2691
82 Ga0207678_10079075 3300026067 Bacteria 2816
83 Ga0207708_10034809 3300026075 Bacteria 3832
84 Ga0207641_10029401 3300026088 Bacteria 4544
85 Ga0268266_10068406 3300028379 Bacteria 3075
86 Ga0265327_10000069 3300031251 Bacteria 217784
87 Ga0265327_10000358 3300031251 Bacteria 86964
88 Ga0265327_10007244 3300031251 Bacteria 8610
89 Ga0265327_10008212 3300031251 Bacteria 7828
90 Ga0265327_10026227 3300031251 Bacteria 3380
91 Ga0436365_1497757 3300039437 Bacteria 17888
92 Ga0436363_0844623 3300039450 Bacteria 2377
93 Ga0439461_0010383 3300041410 Bacteria 1708
94 Ga0439466_0012406 3300041411 Bacteria 3141
95 Ga0439465_0005976 3300041413 Bacteria 3869
96 Ga0451793_0111712 3300041452 Bacteria 2506
97 Ga0466972_0009500 3300044658 Bacteria 4885
98 Ga0466972_0023990 3300044658 Bacteria 3029
99 Ga0466965_0002195 3300044683 Bacteria 8207
100 Ga0466965_0002650 3300044683 Bacteria 7666
101 Ga0466965_0004113 3300044683 Bacteria 6464
102 Ga0466968_0004103 3300044735 Bacteria 5424
103 Ga0466970_0006262 3300044765 Bacteria 5939
104 Ga0466970_0015538 3300044765 Bacteria 3918
105 Ga0466957_0066735 3300044842 Bacteria 2219
106 Ga0466957_0074301 3300044842 Bacteria 2107
107 Ga0466960_0000299 3300044901 Bacteria 17246
108 Ga0466960_0007129 3300044901 Bacteria 4522
109 Ga0466959_0027488 3300045049 Bacteria 4219
110 Ga0466967_0023699 3300045976 Bacteria 5034
111 Ga0466967_0048400 3300045976 Bacteria 3712
112 Ga0466967_0082352 3300045976 Bacteria 2908
113 Ga0466967_0127051 3300045976 Bacteria 2363
114 Ga0495648_0001331 3300046524 Bacteria 24466
115 Ga0495674_0233847 3300047319 Bacteria 1516
116 Ga0495672_0000688 3300047320 Bacteria 37591
117 Ga0495680_0108011 3300047322 Bacteria 2065
118 Ga0495673_0015723 3300047469 Bacteria 3891
119 Ga0495686_0001950 3300047472 Bacteria 20524
120 Ga0496100_0000011 3300048903 Bacteria 190969
121 Ga0496100_0008545 3300048903 Bacteria 5715
122 Ga0496101_0000017 3300048904 Bacteria 239153
123 Ga0496101_0000330 3300048904 Bacteria 32371
124 Ga0496102_0000012 3300048905 Bacteria 315470
125 Ga0496102_0005728 3300048905 Bacteria 10558
126 Ga0496102_0242251 3300048905 Bacteria 1700
127 Ga0496103_0000005 3300048906 Bacteria 505416
128 Ga0496103_0000621 3300048906 Bacteria 27334
129 Ga0496104_0092673 3300048907 Bacteria 2889
130 Ga0496106_0013505 3300048909 Bacteria 6030
131 Ga0496107_0000409 3300048910 Bacteria 23226
132 Ga0496108_0019691 3300048911 Bacteria 5542
133 Ga0496108_0044799 3300048911 Bacteria 3694
134 Ga0496109_0000041 3300048912 Bacteria 141346
135 Ga0496109_0008978 3300048912 Bacteria 8514
136 Ga0496109_0021433 3300048912 Bacteria 5713
137 Ga0496110_0000413 3300048913 Bacteria 29068
138 Ga0496112_0027084 3300048915 Bacteria 5525
139 Ga0496112_0079322 3300048915 Bacteria 3248
140 Ga0496113_0023585 3300048916 Bacteria 4363
141 Ga0496113_0059463 3300048916 Bacteria 2879
142 Ga0496114_0000089 3300048917 Bacteria 65037
143 Ga0496114_0139148 3300048917 Bacteria 2100
144 Ga0496116_0000050 3300048919 Bacteria 311670
145 Ga0496116_0001469 3300048919 Bacteria 26380
146 Ga0496117_0000042 3300048920 Bacteria 315470
147 Ga0496117_0007116 3300048920 Bacteria 11053
148 Ga0496118_0000037 3300048921 Bacteria 315470
149 Ga0496118_0008304 3300048921 Bacteria 10756
150 Ga0496119_0000755 3300048922 Bacteria 43406
151 Ga0496119_0012953 3300048922 Bacteria 6706
152 Ga0496120_0000449 3300048923 Bacteria 65290
153 Ga0496121_0000014 3300048924 Bacteria 609379
154 Ga0496121_0000039 3300048924 Bacteria 351444
155 Ga0496122_0000084 3300048925 Bacteria 208740
156 Ga0496122_0039396 3300048925 Bacteria 3768
157 Ga0496123_0003673 3300048926 Bacteria 16927
158 Ga0496123_0009008 3300048926 Bacteria 9054
159 Ga0496124_0000019 3300048927 Bacteria 436995
160 Ga0496125_0000014 3300048928 Bacteria 610124
161 Ga0496125_0150339 3300048928 Bacteria 1601
162 Ga0496126_0000017 3300048929 Bacteria 610676
163 Ga0496126_0002365 3300048929 Bacteria 25726
164 Ga0496126_0004411 3300048929 Bacteria 16854
165 Ga0496126_0054550 3300048929 Bacteria 3619
166 Ga0496126_0086757 3300048929 Bacteria 2758
167 Ga0501070_0039701 3300049586 Bacteria 3924
168 Ga0501035_0186546 3300049822 Bacteria 1785
169 nmdc:mga03683_28063_c1 3300050489 Bacteria 2235
170 nmdc:mga03n38_1237_c1 3300050490 Bacteria 7177
171 nmdc:mga03n38_1442_c1 3300050490 Bacteria 6810
172 nmdc:mga03n38_5521_c1 3300050490 Bacteria 4312
173 nmdc:mga03n38_66553_c1 3300050490 Bacteria 1655
174 nmdc:mga00v17_11402_c1 3300050491 Bacteria 4886
175 nmdc:mga00v17_12059_c1 3300050491 Bacteria 4759
176 nmdc:mga00v17_146877_c1 3300050491 Bacteria 1514
177 nmdc:mga00v17_19833_c1 3300050491 Bacteria 3845
178 nmdc:mga00v17_56478_c1 3300050491 Bacteria 2400
179 nmdc:mga00v17_62660_c1 3300050491 Bacteria 2288
180 nmdc:mga00v17_8460_c1 3300050491 Bacteria 5538
181 nmdc:mga0yw44_1219_c1 3300050492 Bacteria 10080
182 nmdc:mga0yw44_138888_c1 3300050492 Bacteria 1578
183 nmdc:mga0yw44_20311_c1 3300050492 Bacteria 3684
184 nmdc:mga0yw44_23298_c1 3300050492 Bacteria 3486
185 nmdc:mga0yw44_4227_c1 3300050492 Bacteria 6540
186 nmdc:mga0yw44_46089_c1 3300050492 Bacteria 2616
187 nmdc:mga0yw44_6628_c1 3300050492 Bacteria 5613
188 nmdc:mga06z11_22025_c1 3300050494 Bacteria 2970
189 nmdc:mga06z11_25693_c1 3300050494 Bacteria 2794
190 nmdc:mga06z11_39480_c1 3300050494 Bacteria 1512
191 nmdc:mga06z11_7346_c1 3300050494 Bacteria 4527
192 nmdc:mga07m45_5263_c1 3300050496 Bacteria 6428
193 nmdc:mga07m45_5885_c1 3300050496 Bacteria 6155
194 nmdc:mga07m45_6076_c1 3300050496 Bacteria 6080
195 nmdc:mga0sz30_2730_c1 3300050516 Bacteria 6302
196 nmdc:mga0sz30_68650_c1 3300050516 Bacteria 1523
197 nmdc:mga0sz30_74271_c1 3300050516 Bacteria 1466
198 nmdc:mga0sz30_893_c2 3300050516 Bacteria 1960
199 Ga0495601_0000380 3300053077 Bacteria 23464
200 Ga0500643_000973 3300053087 Bacteria 17722
201 Ga0500643_006151 3300053087 Bacteria 5063
202 Ga0500642_0033781 3300053130 Bacteria 2158
203 Ga0500652_004790 3300053131 Bacteria 4216
204 Ga0500616_0009138 3300053153 Bacteria 6056
205 Ga0500627_0000315 3300053158 Bacteria 13311
206 Ga0500645_000023 3300053730 Bacteria 128995
207 Ga0500645_000031 3300053730 Bacteria 119643
208 Ga0500645_000263 3300053730 Bacteria 37917
209 Ga0500645_011623 3300053730 Bacteria 2869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_66553_c1 nmdc:mga03n38_66553_c1_569_1573 331
2 3300050516 nmdc:mga0sz30_74271_c1 nmdc:mga0sz30_74271_c1_371_1450 333
3 3300006038 Ga0075365_10004835 Ga0075365_100048357 338
4 3300050492 nmdc:mga0yw44_6628_c1 nmdc:mga0yw44_6628_c1_2008_3033 338
5 3300048916 Ga0496113_0059463 Ga0496113_0059463_1781_2854 349
6 iso_pu_bacteria 2885366525 2885370242 374
7 3300003323 rootH1_10083868 rootH1_100838683 376
8 iso_pu_bacteria 2849076700 2849081317 376
9 3300003215 JGI25153J46596_10000094 JGI25153J46596_1000009435 378
10 3300003215 JGI25153J46596_10000151 JGI25153J46596_1000015151 378
11 3300003794 Ga0055531_10015476 Ga0055531_100154762 378
12 3300025297 Ga0209758_1000120 Ga0209758_100012098 378
13 3300047319 Ga0495674_0233847 Ga0495674_0233847_104_1249 378
14 3300047322 Ga0495680_0108011 Ga0495680_0108011_378_1523 378
15 iso_pu_bacteria 2939582691 2939585822 379
16 3300047472 Ga0495686_0001950 Ga0495686_0001950_16061_17221 380
17 3300005937 Ga0081455_10019578 Ga0081455_100195782 381
18 3300005367 Ga0070667_100095510 Ga0070667_1000955102 382
19 3300006038 Ga0075365_10001883 Ga0075365_100018835 382
20 3300006048 Ga0075363_100001501 Ga0075363_1000015014 382
21 3300006178 Ga0075367_10038189 Ga0075367_100381892 382
22 3300050490 nmdc:mga03n38_1237_c1 nmdc:mga03n38_1237_c1_4157_5437 382
23 3300050494 nmdc:mga06z11_25693_c1 nmdc:mga06z11_25693_c1_194_1474 382
24 3300050496 nmdc:mga07m45_6076_c1 nmdc:mga07m45_6076_c1_2805_4085 382
25 3300031251 Ga0265327_10008212 Ga0265327_100082124 383
26 iso_pu_bacteria 2935777560 2935783675 385
27 iso_pu_bacteria 8016603502 8016609922 385
28 iso_pu_bacteria 8019538911 8019545448 385
29 3300039450 Ga0436363_0844623 Ga0436363_0844623_79_1269 390
30 3300003792 Ga0055540_1000987 Ga0055540_100098711 391
31 3300025273 Ga0209673_1014616 Ga0209673_10146163 391
32 3300025303 Ga0209051_1000990 Ga0209051_10009909 391
33 3300044683 Ga0466965_0004113 Ga0466965_0004113_3660_4898 393
34 3300048917 Ga0496114_0139148 Ga0496114_0139148_203_1555 393
35 3300005840 Ga0068870_10044863 Ga0068870_100448632 397
36 3300005841 Ga0068863_100185574 Ga0068863_1001855742 397
37 3300006358 Ga0068871_100209824 Ga0068871_1002098242 398
38 3300005355 Ga0070671_100028076 Ga0070671_1000280763 399
39 3300005367 Ga0070667_100193601 Ga0070667_1001936012 399
40 3300009553 Ga0105249_10015539 Ga0105249_100155393 399
41 3300010375 Ga0105239_10004827 Ga0105239_100048273 399
42 3300014325 Ga0163163_10120930 Ga0163163_101209303 399
43 3300025961 Ga0207712_10060195 Ga0207712_100601953 399
44 3300044842 Ga0466957_0066735 Ga0466957_0066735_129_1430 399
45 3300045976 Ga0466967_0023699 Ga0466967_0023699_420_1676 399
46 3300048911 Ga0496108_0044799 Ga0496108_0044799_743_2029 399
47 3300048912 Ga0496109_0021433 Ga0496109_0021433_3513_4799 399
48 3300048915 Ga0496112_0027084 Ga0496112_0027084_4105_5391 399
49 iso_pu_bacteria 2643221715 2644638961 399
50 iso_pu_bacteria 2738541274 2738702639 399
51 iso_pu_bacteria 2738543028 2739329549 399
52 3300005841 Ga0068863_100040111 Ga0068863_1000401112 400
53 3300026088 Ga0207641_10029401 Ga0207641_100294012 400
54 iso_pu_bacteria 2508501009 2508543098 400
55 3300053077 Ga0495601_0000380 Ga0495601_0000380_6289_7611 401
56 3300003323 rootH1_10304748 rootH1_103047481 403
57 3300003792 Ga0055540_1000036 Ga0055540_100003672 403
58 3300005367 Ga0070667_100002535 Ga0070667_1000025352 403
59 3300006038 Ga0075365_10000639 Ga0075365_100006392 403
60 3300006178 Ga0075367_10020708 Ga0075367_100207082 403
61 3300025303 Ga0209051_1000021 Ga0209051_1000021422 403
62 3300025303 Ga0209051_1016762 Ga0209051_10167621 403
63 3300044658 Ga0466972_0009500 Ga0466972_0009500_364_1647 403
64 3300044658 Ga0466972_0023990 Ga0466972_0023990_527_1810 403
65 3300044683 Ga0466965_0002195 Ga0466965_0002195_4670_5953 403
66 3300044683 Ga0466965_0002650 Ga0466965_0002650_4909_6192 403
67 3300044735 Ga0466968_0004103 Ga0466968_0004103_2921_4204 403
68 3300044765 Ga0466970_0006262 Ga0466970_0006262_4553_5836 403
69 3300044842 Ga0466957_0074301 Ga0466957_0074301_757_2040 403
70 3300044901 Ga0466960_0000299 Ga0466960_0000299_4850_6133 403
71 3300044901 Ga0466960_0007129 Ga0466960_0007129_1559_2842 403
72 3300045049 Ga0466959_0027488 Ga0466959_0027488_750_2033 403
73 3300045976 Ga0466967_0082352 Ga0466967_0082352_1580_2863 403
74 3300048903 Ga0496100_0000011 Ga0496100_0000011_102752_103990 403
75 3300048904 Ga0496101_0000017 Ga0496101_0000017_204881_206119 403
76 3300048905 Ga0496102_0005728 Ga0496102_0005728_8847_10085 403
77 3300048906 Ga0496103_0000621 Ga0496103_0000621_13865_15103 403
78 3300048909 Ga0496106_0013505 Ga0496106_0013505_2101_3339 403
79 3300048910 Ga0496107_0000409 Ga0496107_0000409_11650_12888 403
80 3300048912 Ga0496109_0000041 Ga0496109_0000041_124570_125808 403
81 3300048913 Ga0496110_0000413 Ga0496110_0000413_9990_11228 403
82 3300048916 Ga0496113_0023585 Ga0496113_0023585_256_1536 403
83 3300048917 Ga0496114_0000089 Ga0496114_0000089_13666_14904 403
84 3300048919 Ga0496116_0001469 Ga0496116_0001469_1971_3209 403
85 3300048920 Ga0496117_0007116 Ga0496117_0007116_4020_5258 403
86 3300048921 Ga0496118_0008304 Ga0496118_0008304_3440_4678 403
87 3300048922 Ga0496119_0012953 Ga0496119_0012953_5312_6550 403
88 3300048924 Ga0496121_0000014 Ga0496121_0000014_357362_358600 403
89 3300048925 Ga0496122_0000084 Ga0496122_0000084_158113_159351 403
90 3300048925 Ga0496122_0039396 Ga0496122_0039396_2360_3640 403
91 3300048926 Ga0496123_0003673 Ga0496123_0003673_8239_9477 403
92 3300048926 Ga0496123_0009008 Ga0496123_0009008_2038_3318 403
93 3300048927 Ga0496124_0000019 Ga0496124_0000019_357362_358600 403
94 3300048928 Ga0496125_0000014 Ga0496125_0000014_357362_358600 403
95 3300048929 Ga0496126_0000017 Ga0496126_0000017_252077_253315 403
96 3300048929 Ga0496126_0004411 Ga0496126_0004411_405_1685 403
97 3300048929 Ga0496126_0054550 Ga0496126_0054550_1988_3271 403
98 3300050491 nmdc:mga00v17_19833_c1 nmdc:mga00v17_19833_c1_1795_3072 403
99 3300050494 nmdc:mga06z11_7346_c1 nmdc:mga06z11_7346_c1_2878_4155 403
100 3300053730 Ga0500645_000031 Ga0500645_000031_84623_85906 403
101 3300025299 Ga0209256_1001501 Ga0209256_100150115 404
102 3300025304 Ga0209257_1006987 Ga0209257_10069875 404
103 3300049586 Ga0501070_0039701 Ga0501070_0039701_2303_3568 404
104 iso_pu_bacteria 2751185725 2753039084 404
105 iso_pu_bacteria 2751185792 2753327595 404
106 iso_pu_bacteria 2939582691 2939584509 405
107 3300050491 nmdc:mga00v17_11402_c1 nmdc:mga00v17_11402_c1_431_1696 406
108 iso_pu_bacteria 2902799365 2902801078 407
109 3300006051 Ga0075364_10071027 Ga0075364_100710271 408
110 3300021384 Ga0213876_10016000 Ga0213876_100160002 408
111 3300039437 Ga0436365_1497757 Ga0436365_1497757_13994_15247 408
112 iso_pu_bacteria 2643221715 2644633727 408
113 iso_pu_bacteria 2738541274 2738707665 408
114 3300009553 Ga0105249_10048306 Ga0105249_100483064 409
115 3300050492 nmdc:mga0yw44_46089_c1 nmdc:mga0yw44_46089_c1_330_1607 409
116 3300006038 Ga0075365_10021201 Ga0075365_100212015 410
117 3300006048 Ga0075363_100001435 Ga0075363_1000014352 410
118 3300006051 Ga0075364_10006597 Ga0075364_100065972 410
119 3300006846 Ga0075430_100158542 Ga0075430_1001585422 410
120 3300050491 nmdc:mga00v17_8460_c1 nmdc:mga00v17_8460_c1_982_2250 410
121 3300050492 nmdc:mga0yw44_20311_c1 nmdc:mga0yw44_20311_c1_1973_3247 410
122 3300006038 Ga0075365_10101353 Ga0075365_101013532 411
123 3300006048 Ga0075363_100000346 Ga0075363_1000003463 411
124 3300006048 Ga0075363_100009274 Ga0075363_1000092743 411
125 3300006051 Ga0075364_10009441 Ga0075364_100094417 411
126 3300006051 Ga0075364_10014634 Ga0075364_100146343 411
127 3300006178 Ga0075367_10004994 Ga0075367_100049943 411
128 3300006186 Ga0075369_10071933 Ga0075369_100719332 411
129 3300006353 Ga0075370_10115407 Ga0075370_101154071 411
130 3300031251 Ga0265327_10007244 Ga0265327_100072445 411
131 3300044765 Ga0466970_0015538 Ga0466970_0015538_1179_2444 411
132 3300045976 Ga0466967_0048400 Ga0466967_0048400_428_1684 411
133 3300050489 nmdc:mga03683_28063_c1 nmdc:mga03683_28063_c1_924_2189 411
134 3300050490 nmdc:mga03n38_1442_c1 nmdc:mga03n38_1442_c1_523_1788 411
135 3300050490 nmdc:mga03n38_5521_c1 nmdc:mga03n38_5521_c1_2160_3425 411
136 3300050491 nmdc:mga00v17_146877_c1 nmdc:mga00v17_146877_c1_49_1314 411
137 3300050491 nmdc:mga00v17_56478_c1 nmdc:mga00v17_56478_c1_1031_2296 411
138 3300050492 nmdc:mga0yw44_23298_c1 nmdc:mga0yw44_23298_c1_1226_2491 411
139 3300050494 nmdc:mga06z11_22025_c1 nmdc:mga06z11_22025_c1_297_1562 411
140 3300050494 nmdc:mga06z11_39480_c1 nmdc:mga06z11_39480_c1_66_1331 411
141 3300050496 nmdc:mga07m45_5263_c1 nmdc:mga07m45_5263_c1_2940_4205 411
142 3300050516 nmdc:mga0sz30_68650_c1 nmdc:mga0sz30_68650_c1_168_1433 411
143 iso_pu_bacteria 2842134933 2842137650 411
144 3300005355 Ga0070671_100057935 Ga0070671_1000579352 412
145 3300005367 Ga0070667_100186171 Ga0070667_1001861712 412
146 3300005844 Ga0068862_100156293 Ga0068862_1001562932 412
147 3300006038 Ga0075365_10000639 Ga0075365_100006395 412
148 3300006051 Ga0075364_10001769 Ga0075364_100017692 412
149 3300006186 Ga0075369_10002573 Ga0075369_100025734 412
150 3300009545 Ga0105237_10007309 Ga0105237_100073095 412
151 3300010375 Ga0105239_10371325 Ga0105239_103713251 412
152 3300025303 Ga0209051_1012072 Ga0209051_10120722 412
153 3300025914 Ga0207671_10027984 Ga0207671_100279843 412
154 3300026067 Ga0207678_10079075 Ga0207678_100790752 412
155 3300031251 Ga0265327_10000358 Ga0265327_1000035840 412
156 3300031251 Ga0265327_10026227 Ga0265327_100262272 412
157 3300041452 Ga0451793_0111712 Ga0451793_0111712_1015_2292 412
158 3300046524 Ga0495648_0001331 Ga0495648_0001331_21279_22547 412
159 3300047320 Ga0495672_0000688 Ga0495672_0000688_8385_9653 412
160 3300047469 Ga0495673_0015723 Ga0495673_0015723_740_2008 412
161 3300048903 Ga0496100_0008545 Ga0496100_0008545_2443_3711 412
162 3300048904 Ga0496101_0000330 Ga0496101_0000330_6752_8020 412
163 3300048905 Ga0496102_0000012 Ga0496102_0000012_5663_6931 412
164 3300048906 Ga0496103_0000005 Ga0496103_0000005_308532_309800 412
165 3300048919 Ga0496116_0000050 Ga0496116_0000050_1884_3152 412
166 3300048920 Ga0496117_0000042 Ga0496117_0000042_308540_309808 412
167 3300048921 Ga0496118_0000037 Ga0496118_0000037_308540_309808 412
168 3300048922 Ga0496119_0000755 Ga0496119_0000755_1166_2434 412
169 3300048923 Ga0496120_0000449 Ga0496120_0000449_62857_64125 412
170 3300048924 Ga0496121_0000039 Ga0496121_0000039_259283_260551 412
171 3300048928 Ga0496125_0150339 Ga0496125_0150339_173_1453 412
172 3300048929 Ga0496126_0002365 Ga0496126_0002365_22752_24020 412
173 3300049822 Ga0501035_0186546 Ga0501035_0186546_394_1662 412
174 3300050491 nmdc:mga00v17_12059_c1 nmdc:mga00v17_12059_c1_2935_4179 412
175 3300050492 nmdc:mga0yw44_1219_c1 nmdc:mga0yw44_1219_c1_938_2182 412
176 3300050516 nmdc:mga0sz30_2730_c1 nmdc:mga0sz30_2730_c1_3919_5163 412
177 3300053087 Ga0500643_000973 Ga0500643_000973_14397_15665 412
178 3300053130 Ga0500642_0033781 Ga0500642_0033781_444_1724 412
179 3300053153 Ga0500616_0009138 Ga0500616_0009138_4778_6025 412
180 3300053158 Ga0500627_0000315 Ga0500627_0000315_7608_8888 412
181 3300053730 Ga0500645_000263 Ga0500645_000263_31538_32818 412
182 iso_pu_bacteria 2643221687 2644485977 412
183 iso_pu_bacteria 2738543028 2739332677 412
184 iso_pu_bacteria 2902792274 2902795939 412
185 3300045976 Ga0466967_0127051 Ga0466967_0127051_237_1511 413
186 3300050491 nmdc:mga00v17_62660_c1 nmdc:mga00v17_62660_c1_118_1368 413
187 iso_pu_bacteria 2626541554 2626636895 413
188 3300006186 Ga0075369_10005976 Ga0075369_100059763 414
189 3300031251 Ga0265327_10000069 Ga0265327_100000694 415
190 3300041411 Ga0439466_0012406 Ga0439466_0012406_1503_2750 415
191 3300041413 Ga0439465_0005976 Ga0439465_0005976_1393_2640 415
192 3300053131 Ga0500652_004790 Ga0500652_004790_1065_2354 415
193 iso_pu_bacteria 2738541274 2738702350 416
194 iso_pu_bacteria 2738543028 2739331605 416
195 3300050516 nmdc:mga0sz30_893_c2 nmdc:mga0sz30_893_c2_178_1443 417
196 3300006038 Ga0075365_10034301 Ga0075365_100343012 418
197 3300053087 Ga0500643_006151 Ga0500643_006151_2181_3599 419
198 3300005457 Ga0070662_100132262 Ga0070662_1001322621 420
199 3300006038 Ga0075365_10007298 Ga0075365_100072986 420
200 3300006038 Ga0075365_10025177 Ga0075365_100251773 420
201 3300006178 Ga0075367_10004734 Ga0075367_100047345 420
202 3300006353 Ga0075370_10054213 Ga0075370_100542132 420
203 3300009098 Ga0105245_10012077 Ga0105245_100120779 420
204 3300025933 Ga0207706_10124933 Ga0207706_101249332 420
205 3300048929 Ga0496126_0086757 Ga0496126_0086757_1197_2618 420
206 3300050492 nmdc:mga0yw44_138888_c1 nmdc:mga0yw44_138888_c1_123_1385 420
207 3300050492 nmdc:mga0yw44_4227_c1 nmdc:mga0yw44_4227_c1_1252_2634 420
208 3300050496 nmdc:mga07m45_5885_c1 nmdc:mga07m45_5885_c1_2429_3691 420
209 3300053730 Ga0500645_000023 Ga0500645_000023_60232_61653 420
210 3300053730 Ga0500645_011623 Ga0500645_011623_997_2418 420
211 3300001977 JGI24746J21847_1000484 JGI24746J21847_10004846 421
212 3300005347 Ga0070668_100178500 Ga0070668_1001785002 421
213 3300005356 Ga0070674_100009968 Ga0070674_1000099683 421
214 3300005364 Ga0070673_100100694 Ga0070673_1001006942 421
215 3300005365 Ga0070688_100204865 Ga0070688_1002048651 421
216 3300005441 Ga0070700_100073892 Ga0070700_1000738922 421
217 3300005548 Ga0070665_100025290 Ga0070665_1000252905 421
218 3300009553 Ga0105249_10364797 Ga0105249_103647971 421
219 3300011119 Ga0105246_10006303 Ga0105246_100063033 421
220 3300013296 Ga0157374_10017355 Ga0157374_100173553 421
221 3300013308 Ga0157375_10154018 Ga0157375_101540182 421
222 3300014326 Ga0157380_10033460 Ga0157380_100334602 421
223 3300014745 Ga0157377_10035145 Ga0157377_100351454 421
224 3300025901 Ga0207688_10027446 Ga0207688_100274463 421
225 3300025927 Ga0207687_10021830 Ga0207687_100218304 421
226 3300026075 Ga0207708_10034809 Ga0207708_100348093 421
227 3300028379 Ga0268266_10068406 Ga0268266_100684062 421
228 3300041410 Ga0439461_0010383 Ga0439461_0010383_218_1483 421
229 3300048905 Ga0496102_0242251 Ga0496102_0242251_413_1678 421
230 3300048907 Ga0496104_0092673 Ga0496104_0092673_1005_2270 421
231 3300048911 Ga0496108_0019691 Ga0496108_0019691_3261_4526 421
232 3300048912 Ga0496109_0008978 Ga0496109_0008978_1856_3121 421
233 3300048915 Ga0496112_0079322 Ga0496112_0079322_860_2125 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00201

UDPGT

UDP-glucoronosyl and UDP-glucosyl transferase

221

388

0.9

PF06722

EryCIII-like_C

Erythromycin biosynthesis protein CIII-like, C-terminal domain

263

404

0.9

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

3

142

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iir-assembly1.cif.gz_A crystal structure of udp-glucosyltransferase gtfb 0.8497 1 406
2o6l-assembly1.cif.gz_A crystal structure of the udp-glucuronic acid binding domain of the human drug metabolizing udp-glucuronosyltransferase 2b7 0.8471 231 383
1iir-assembly1.cif.gz_A crystal structure of udp-glucosyltransferase gtfb 0.8436 1 406
1rrv-assembly2.cif.gz_B x-ray crystal structure of tdp-vancosaminyltransferase gtfd as a complex with tdp and the natural substrate, desvancosaminyl vancomycin. 0.8305 1 405
1rrv-assembly2.cif.gz_B x-ray crystal structure of tdp-vancosaminyltransferase gtfd as a complex with tdp and the natural substrate, desvancosaminyl vancomycin. 0.8266 1 405
ID Description Score Start End Superfamily
af_P9WLV1_233_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9695 230 383 3.40.50.2000
af_P9WN07_3_195_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9545 3 189 3.40.50.2000
af_A0A1D6EKY0_373_532_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9495 231 384 3.40.50.2000
af_P9WLV1_1_243_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9367 1 236 3.40.50.2000
af_P9WLV1_233_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9339 230 383 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1A3IFM8-F1-model_v4 Glycosyl transferase 0.9634 1 325 GO:0005975
GO:0008194
GO:0016758
GO:0030259
GO:0033072
AF-A0A7V3MYR9-F1-model_v4 Glycosyltransferase 0.9577 1 347 GO:0005975
GO:0008194
GO:0016758
GO:0030259
GO:0033072
AF-A0A1A3IFM8-F1-model_v4 Glycosyl transferase 0.9408 1 325 GO:0005975
GO:0008194
GO:0016758
GO:0030259
GO:0033072
AF-A0A2V2L228-F1-model_v4 deleted 0.9393 225 310
AF-A0A857M8X7-F1-model_v4 deleted 0.9344 1 406

Feature Viewer

pLDDT pTM Quality
88.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map