F346244

General Info

Members Datasets Scaffolds Average Seq Length
233 163 233 170

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100749011|Ga0307409_1007490112
Length 197
Sequence MRAGMRVLIVSGTPPTFSRSTTLETTPLASPHVVDDLIRSRRTHKAYGPDPVPRETLLELFELARWAPNHHLTNPWRFRVIGPEALETLKAAAERHKPGSATKLDRAPTLVAVTAKQTGDPEQDHEDVLATAVAAYIVLLGAHARGLAAYWRTVPVLGALDLPADELPIGLLYLGTPRQEQRVPERASVEEIAFFLD

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 16.31
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10049124 3300003373 Bacteria 1071
2 Ga0070658_10052051 3300005327 Bacteria 3320
3 Ga0070683_100000628 3300005329 Bacteria 25410
4 Ga0070690_100244332 3300005330 Bacteria 1267
5 Ga0070690_100852666 3300005330 Bacteria 710
6 Ga0068869_100336834 3300005334 Bacteria 1227
7 Ga0070682_100785976 3300005337 Bacteria 772
8 Ga0068868_100275308 3300005338 Bacteria 1423
9 Ga0070661_100052406 3300005344 Bacteria 2987
10 Ga0070661_100264965 3300005344 Bacteria 1329
11 Ga0070669_100546795 3300005353 Bacteria 965
12 Ga0070673_101121505 3300005364 Bacteria 735
13 Ga0070688_100536928 3300005365 Bacteria 887
14 Ga0070714_100012541 3300005435 Bacteria 6772
15 Ga0070701_10114746 3300005438 Bacteria 1510
16 Ga0070711_100079714 3300005439 Bacteria 2329
17 Ga0070711_100108408 3300005439 Bacteria 2034
18 Ga0070711_100213169 3300005439 Bacteria 1497
19 Ga0070711_100301676 3300005439 Bacteria 1274
20 Ga0070663_100359956 3300005455 Bacteria 1180
21 Ga0070663_101150707 3300005455 Bacteria 680
22 Ga0070678_100043499 3300005456 Bacteria 3200
23 Ga0070678_100639694 3300005456 Bacteria 953
24 Ga0070678_100832176 3300005456 Bacteria 840
25 Ga0070662_100673372 3300005457 Bacteria 874
26 Ga0070679_100242271 3300005530 Unclassified 1760
27 Ga0070684_100030764 3300005535 Bacteria 4565
28 Ga0070686_100356775 3300005544 Bacteria 1100
29 Ga0070696_100806958 3300005546 Bacteria 773
30 Ga0070704_100157141 3300005549 Bacteria 1795
31 Ga0070664_100323871 3300005564 Bacteria 1397
32 Ga0070664_100502939 3300005564 Bacteria 1117
33 Ga0068857_100008539 3300005577 Bacteria 8857
34 Ga0068854_100278777 3300005578 Bacteria 1345
35 Ga0068856_100124076 3300005614 Bacteria 2585
36 Ga0068852_100728444 3300005616 Bacteria 1003
37 Ga0068859_100185893 3300005617 Bacteria 2162
38 Ga0068866_10217687 3300005718 Bacteria 1150
39 Ga0068866_10525580 3300005718 Bacteria 787
40 Ga0068860_100808272 3300005843 Bacteria 951
41 Ga0068862_100749095 3300005844 Bacteria 950
42 Ga0081538_10000696 3300005981 Bacteria 36915
43 Ga0081538_10020455 3300005981 Bacteria 4868
44 Ga0081540_1132295 3300005983 Bacteria 1016
45 Ga0075365_10401006 3300006038 Bacteria 968
46 Ga0070712_100005121 3300006175 Bacteria 8113
47 Ga0068865_100000034 3300006881 Bacteria 84043
48 Ga0068865_100190348 3300006881 Bacteria 1586
49 Ga0075436_100450504 3300006914 Bacteria 937
50 Ga0097620_100185893 3300006931 Bacteria 2162
51 Ga0111539_10091359 3300009094 Bacteria 3577
52 Ga0105245_10088170 3300009098 Bacteria 2849
53 Ga0105243_10208753 3300009148 Bacteria 1718
54 Ga0105242_10127781 3300009176 Bacteria 2190
55 Ga0105242_11214573 3300009176 Bacteria 774
56 Ga0105238_10000126 3300009551 Bacteria 83957
57 Ga0105249_10157443 3300009553 Bacteria 2192
58 Ga0105239_10341045 3300010375 Bacteria 1691
59 Ga0105239_10450693 3300010375 Bacteria 1460
60 Ga0105246_10078118 3300011119 Bacteria 2350
61 Ga0157374_10013379 3300013296 Bacteria 7162
62 Ga0157374_10151426 3300013296 Bacteria 2255
63 Ga0157378_10723207 3300013297 Unclassified 1016
64 Ga0157377_10032446 3300014745 Bacteria 2843
65 Ga0157377_10691923 3300014745 Bacteria 739
66 Ga0207692_10165594 3300025898 Bacteria 1277
67 Ga0207643_10367015 3300025908 Bacteria 906
68 Ga0207693_10211810 3300025915 Bacteria 1523
69 Ga0207693_10378299 3300025915 Unclassified 1107
70 Ga0207663_10096026 3300025916 Bacteria 1979
71 Ga0207663_10206247 3300025916 Bacteria 1421
72 Ga0207663_10364164 3300025916 Bacteria 1098
73 Ga0207649_10186549 3300025920 Bacteria 1455
74 Ga0207694_10000004 3300025924 Bacteria 967075
75 Ga0207687_10020177 3300025927 Bacteria 4420
76 Ga0207664_10660000 3300025929 Bacteria 940
77 Ga0207670_10248943 3300025936 Bacteria 1372
78 Ga0207704_10134485 3300025938 Bacteria 1718
79 Ga0207665_10052620 3300025939 Bacteria 2744
80 Ga0207691_10686876 3300025940 Bacteria 864
81 Ga0207661_10393073 3300025944 Bacteria 1256
82 Ga0207679_10140825 3300025945 Bacteria 1949
83 Ga0207679_10157349 3300025945 Bacteria 1857
84 Ga0207640_10357434 3300025981 Bacteria 1176
85 Ga0207702_10174328 3300026078 Bacteria 1975
86 Ga0207675_100735027 3300026118 Bacteria 997
87 Ga0207683_10619231 3300026121 Bacteria 1002
88 Ga0207698_10527535 3300026142 Bacteria 1153
89 Ga0268266_10878563 3300028379 Bacteria 867
90 Ga0265334_10150923 3300028573 Bacteria 820
91 Ga0265338_10154753 3300028800 Bacteria 1777
92 Ga0265338_10196560 3300028800 Bacteria 1524
93 Ga0265324_10023176 3300029957 Bacteria 2213
94 Ga0307408_100385229 3300031548 Bacteria 1200
95 Ga0307408_100557264 3300031548 Bacteria 1012
96 Ga0307413_10086968 3300031824 Bacteria 2023
97 Ga0307410_10624339 3300031852 Bacteria 901
98 Ga0307409_100347338 3300031995 Unclassified 1398
99 Ga0307409_100749011 3300031995 Bacteria 980
100 Ga0307409_101145446 3300031995 Bacteria 800
101 Ga0307416_100109743 3300032002 Bacteria 2427
102 Ga0307416_100173443 3300032002 Bacteria 2011
103 Ga0307416_102289654 3300032002 Bacteria 641
104 Ga0307411_10328386 3300032005 Bacteria 1238
105 Ga0307415_100363021 3300032126 Bacteria 1223
106 Ga0373926_0018466 3300035083 Bacteria 2399
107 Ga0373944_0008391 3300035089 Bacteria 2791
108 Ga0373936_0057984 3300035113 Bacteria 1576
109 Ga0373945_0005475 3300035116 Bacteria 4064
110 Ga0373943_0002911 3300035170 Bacteria 7770
111 Ga0373943_0655843 3300035170 Bacteria 620
112 Ga0373946_0011323 3300035171 Bacteria 3325
113 Ga0373961_0158119 3300035241 Bacteria 777
114 Ga0373935_0150758 3300035692 Bacteria 1577
115 Ga0373935_0553648 3300035692 Bacteria 838
116 Ga0373947_0003662 3300035725 Bacteria 9066
117 Ga0373947_0319839 3300035725 Bacteria 1037
118 Ga0373925_0021493 3300037068 Bacteria 4701
119 Ga0373925_0069929 3300037068 Bacteria 2652
120 Ga0395898_0690122 3300037466 Bacteria 963
121 Ga0436365_0823988 3300039437 Bacteria 1148
122 Ga0451789_0737843 3300041443 Bacteria 961
123 Ga0451853_3018741 3300041512 Bacteria 1694
124 Ga0466965_0059422 3300044683 Bacteria 1908
125 Ga0466971_0003922 3300044719 Bacteria 6383
126 Ga0466957_0005852 3300044842 Bacteria 6924
127 Ga0466957_0021342 3300044842 Bacteria 3815
128 Ga0466960_0071765 3300044901 Bacteria 1725
129 Ga0466958_0390679 3300045836 Bacteria 898
130 Ga0466967_0023185 3300045976 Bacteria 5083
131 Ga0495629_0133797 3300046459 Bacteria 1726
132 Ga0495629_0268603 3300046459 Bacteria 1172
133 Ga0495641_0055213 3300046461 Bacteria 1803
134 Ga0495653_0050785 3300046463 Bacteria 3187
135 Ga0495650_0000049 3300046471 Bacteria 325092
136 Ga0495580_0318514 3300046472 Bacteria 1057
137 Ga0495582_0000004 3300046473 Bacteria 168322
138 Ga0495582_0052925 3300046473 Bacteria 2238
139 Ga0495639_0000678 3300046475 Bacteria 15664
140 Ga0495662_0054847 3300046476 Bacteria 1925
141 Ga0495664_0130615 3300046477 Bacteria 1521
142 Ga0495584_0308505 3300046491 Unclassified 804
143 Ga0495608_0049244 3300046511 Bacteria 2797
144 Ga0495618_0046822 3300046514 Bacteria 2729
145 Ga0495618_0177489 3300046514 Bacteria 1354
146 Ga0495628_0466570 3300046516 Bacteria 915
147 Ga0495630_0070315 3300046517 Bacteria 2633
148 Ga0495666_0004420 3300046526 Bacteria 7105
149 Ga0495652_0548147 3300046529 Bacteria 795
150 Ga0495652_0574505 3300046529 Bacteria 772
151 Ga0495640_0060097 3300046533 Bacteria 2586
152 Ga0495586_0069786 3300046535 Bacteria 1918
153 Ga0495587_0090727 3300046536 Bacteria 1765
154 Ga0495645_0345852 3300046543 Bacteria 959
155 Ga0495667_0038906 3300046559 Bacteria 3166
156 Ga0495634_0004636 3300046642 Bacteria 10716
157 Ga0495635_0163299 3300046663 Bacteria 1515
158 Ga0495588_0000244 3300046674 Bacteria 45880
159 Ga0495657_0050120 3300046675 Bacteria 2808
160 Ga0495599_0105555 3300046678 Bacteria 1755
161 Ga0495623_0110569 3300046679 Bacteria 1665
162 Ga0495646_0217353 3300046680 Unclassified 1035
163 Ga0495647_0009644 3300046681 Bacteria 3275
164 Ga0495647_0030357 3300046681 Bacteria 2005
165 Ga0495658_0000004 3300046683 Bacteria 173598
166 Ga0495658_0004064 3300046683 Bacteria 7206
167 Ga0495658_0017930 3300046683 Bacteria 3670
168 Ga0495658_0685382 3300046683 Bacteria 656
169 Ga0495669_0000030 3300046684 Bacteria 102988
170 Ga0495613_0438494 3300046689 Bacteria 886
171 Ga0495624_0025276 3300046690 Bacteria 3900
172 Ga0495600_0027865 3300046809 Bacteria 3653
173 Ga0495600_0046351 3300046809 Bacteria 2836
174 Ga0495581_0006834 3300047315 Bacteria 6617
175 Ga0495581_0022833 3300047315 Bacteria 3624
176 Ga0495604_0000126 3300047317 Bacteria 63992
177 Ga0495604_0067605 3300047317 Bacteria 2714
178 Ga0495674_0047129 3300047319 Bacteria 3823
179 Ga0495674_0100658 3300047319 Bacteria 2459
180 Ga0495676_0037031 3300047321 Bacteria 4066
181 Ga0495676_0039156 3300047321 Bacteria 3929
182 Ga0495676_0178889 3300047321 Bacteria 1488
183 Ga0495676_0982414 3300047321 Bacteria 539
184 Ga0495680_0307664 3300047322 Bacteria 1111
185 Ga0495675_0061693 3300047444 Bacteria 2375
186 Ga0495684_0051830 3300047471 Bacteria 3131
187 Ga0495686_0074887 3300047472 Unclassified 2076
188 Ga0495602_0205469 3300048088 Bacteria 1499
189 Ga0495614_0004529 3300048089 Bacteria 6267
190 Ga0496100_0008989 3300048903 Bacteria 5593
191 Ga0496100_0259170 3300048903 Bacteria 1289
192 Ga0496101_0012691 3300048904 Bacteria 5630
193 Ga0496101_0112001 3300048904 Bacteria 2055
194 Ga0496101_0603935 3300048904 Bacteria 867
195 Ga0496102_0061142 3300048905 Bacteria 3446
196 Ga0496102_0908052 3300048905 Unclassified 802
197 Ga0496104_0025703 3300048907 Bacteria 5431
198 Ga0496104_0279314 3300048907 Bacteria 1583
199 Ga0496105_0231174 3300048908 Bacteria 1503
200 Ga0496105_0289225 3300048908 Bacteria 1320
201 Ga0496106_0030297 3300048909 Bacteria 4035
202 Ga0496107_0512441 3300048910 Bacteria 889
203 Ga0496108_0245508 3300048911 Bacteria 1557
204 Ga0496108_0402507 3300048911 Bacteria 1195
205 Ga0496108_1128313 3300048911 Unclassified 665
206 Ga0496109_0008817 3300048912 Bacteria 8589
207 Ga0496109_0111836 3300048912 Bacteria 2539
208 Ga0496109_0126504 3300048912 Bacteria 2383
209 Ga0496109_0380895 3300048912 Bacteria 1333
210 Ga0496109_0414029 3300048912 Bacteria 1273
211 Ga0496109_0603244 3300048912 Unclassified 1034
212 Ga0496110_0006898 3300048913 Bacteria 9029
213 Ga0496110_0356976 3300048913 Bacteria 1332
214 Ga0496111_0004191 3300048914 Bacteria 9073
215 Ga0496112_0040216 3300048915 Bacteria 4571
216 Ga0496112_0291863 3300048915 Bacteria 1577
217 Ga0496112_0873708 3300048915 Unclassified 822
218 Ga0496112_1606992 3300048915 Bacteria 563
219 Ga0496113_0122351 3300048916 Bacteria 2035
220 Ga0496114_0014926 3300048917 Bacteria 6244
221 Ga0496114_0065567 3300048917 Bacteria 3043
222 Ga0496114_0143986 3300048917 Bacteria 2065
223 Ga0496114_0388770 3300048917 Bacteria 1235
224 Ga0496114_0597055 3300048917 Bacteria 974
225 Ga0496115_0109593 3300048918 Bacteria 2267
226 Ga0496115_0493526 3300048918 Bacteria 985
227 Ga0496119_0262212 3300048922 Bacteria 866
228 Ga0496121_0432727 3300048924 Unclassified 853
229 Ga0495601_0005948 3300053077 Bacteria 7116
230 Ga0495601_0178986 3300053077 Bacteria 1386
231 Ga0495619_0012173 3300053085 Bacteria 5415
232 Ga0495619_0390563 3300053085 Bacteria 961
233 Ga0500616_0165420 3300053153 Bacteria 1010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0982414 Ga0495676_0982414_79_525 148
2 3300045836 Ga0466958_0390679 Ga0466958_0390679_24_473 149
3 3300046477 Ga0495664_0130615 Ga0495664_0130615_17_481 154
4 3300046517 Ga0495630_0070315 Ga0495630_0070315_13_477 154
5 3300046683 Ga0495658_0685382 Ga0495658_0685382_170_634 154
6 3300037466 Ga0395898_0690122 Ga0395898_0690122_426_935 158
7 3300005455 Ga0070663_100359956 Ga0070663_1003599562 162
8 3300031824 Ga0307413_10086968 Ga0307413_100869682 162
9 3300031995 Ga0307409_101145446 Ga0307409_1011454462 162
10 3300032002 Ga0307416_100173443 Ga0307416_1001734432 162
11 3300032002 Ga0307416_102289654 Ga0307416_1022896541 162
12 3300041443 Ga0451789_0737843 Ga0451789_0737843_169_666 162
13 3300041512 Ga0451853_3018741 Ga0451853_3018741_168_665 162
14 3300044683 Ga0466965_0059422 Ga0466965_0059422_1164_1661 162
15 3300005530 Ga0070679_100242271 Ga0070679_1002422712 164
16 3300046491 Ga0495584_0308505 Ga0495584_0308505_107_649 164
17 3300028573 Ga0265334_10150923 Ga0265334_101509232 166
18 3300028800 Ga0265338_10154753 Ga0265338_101547532 166
19 3300025924 Ga0207694_10000004 Ga0207694_10000004305 167
20 3300005329 Ga0070683_100000628 Ga0070683_1000006282 168
21 3300005330 Ga0070690_100852666 Ga0070690_1008526661 168
22 3300005344 Ga0070661_100264965 Ga0070661_1002649652 168
23 3300005353 Ga0070669_100546795 Ga0070669_1005467951 168
24 3300005364 Ga0070673_101121505 Ga0070673_1011215051 168
25 3300005365 Ga0070688_100536928 Ga0070688_1005369282 168
26 3300005435 Ga0070714_100012541 Ga0070714_1000125417 168
27 3300005438 Ga0070701_10114746 Ga0070701_101147462 168
28 3300005439 Ga0070711_100079714 Ga0070711_1000797142 168
29 3300005439 Ga0070711_100108408 Ga0070711_1001084082 168
30 3300005456 Ga0070678_100639694 Ga0070678_1006396942 168
31 3300005456 Ga0070678_100832176 Ga0070678_1008321761 168
32 3300005457 Ga0070662_100673372 Ga0070662_1006733722 168
33 3300005535 Ga0070684_100030764 Ga0070684_1000307644 168
34 3300005544 Ga0070686_100356775 Ga0070686_1003567752 168
35 3300005549 Ga0070704_100157141 Ga0070704_1001571412 168
36 3300005564 Ga0070664_100502939 Ga0070664_1005029392 168
37 3300005577 Ga0068857_100008539 Ga0068857_1000085399 168
38 3300005578 Ga0068854_100278777 Ga0068854_1002787772 168
39 3300005718 Ga0068866_10525580 Ga0068866_105255802 168
40 3300006881 Ga0068865_100190348 Ga0068865_1001903482 168
41 3300009094 Ga0111539_10091359 Ga0111539_100913595 168
42 3300009098 Ga0105245_10088170 Ga0105245_100881702 168
43 3300009176 Ga0105242_11214573 Ga0105242_112145732 168
44 3300009553 Ga0105249_10157443 Ga0105249_101574432 168
45 3300010375 Ga0105239_10341045 Ga0105239_103410452 168
46 3300010375 Ga0105239_10450693 Ga0105239_104506932 168
47 3300011119 Ga0105246_10078118 Ga0105246_100781183 168
48 3300013296 Ga0157374_10013379 Ga0157374_100133798 168
49 3300013296 Ga0157374_10151426 Ga0157374_101514262 168
50 3300014745 Ga0157377_10032446 Ga0157377_100324464 168
51 3300025898 Ga0207692_10165594 Ga0207692_101655942 168
52 3300025908 Ga0207643_10367015 Ga0207643_103670152 168
53 3300025915 Ga0207693_10211810 Ga0207693_102118102 168
54 3300025916 Ga0207663_10096026 Ga0207663_100960262 168
55 3300025916 Ga0207663_10206247 Ga0207663_102062472 168
56 3300025927 Ga0207687_10020177 Ga0207687_100201777 168
57 3300025936 Ga0207670_10248943 Ga0207670_102489432 168
58 3300025938 Ga0207704_10134485 Ga0207704_101344852 168
59 3300025939 Ga0207665_10052620 Ga0207665_100526202 168
60 3300025940 Ga0207691_10686876 Ga0207691_106868761 168
61 3300025944 Ga0207661_10393073 Ga0207661_103930732 168
62 3300025945 Ga0207679_10157349 Ga0207679_101573492 168
63 3300026118 Ga0207675_100735027 Ga0207675_1007350272 168
64 3300026121 Ga0207683_10619231 Ga0207683_106192312 168
65 3300035083 Ga0373926_0018466 Ga0373926_0018466_1222_1728 168
66 3300035089 Ga0373944_0008391 Ga0373944_0008391_1265_1771 168
67 3300035113 Ga0373936_0057984 Ga0373936_0057984_832_1338 168
68 3300035116 Ga0373945_0005475 Ga0373945_0005475_1599_2105 168
69 3300035170 Ga0373943_0002911 Ga0373943_0002911_69_575 168
70 3300035170 Ga0373943_0655843 Ga0373943_0655843_67_573 168
71 3300035171 Ga0373946_0011323 Ga0373946_0011323_553_1059 168
72 3300035692 Ga0373935_0150758 Ga0373935_0150758_768_1274 168
73 3300035692 Ga0373935_0553648 Ga0373935_0553648_254_760 168
74 3300035725 Ga0373947_0003662 Ga0373947_0003662_655_1161 168
75 3300035725 Ga0373947_0319839 Ga0373947_0319839_475_981 168
76 3300037068 Ga0373925_0021493 Ga0373925_0021493_1709_2215 168
77 3300037068 Ga0373925_0069929 Ga0373925_0069929_1095_1601 168
78 3300044901 Ga0466960_0071765 Ga0466960_0071765_247_762 168
79 3300045976 Ga0466967_0023185 Ga0466967_0023185_2456_2962 168
80 3300046459 Ga0495629_0133797 Ga0495629_0133797_211_717 168
81 3300046461 Ga0495641_0055213 Ga0495641_0055213_641_1147 168
82 3300046463 Ga0495653_0050785 Ga0495653_0050785_74_580 168
83 3300046472 Ga0495580_0318514 Ga0495580_0318514_104_610 168
84 3300046473 Ga0495582_0052925 Ga0495582_0052925_211_717 168
85 3300046475 Ga0495639_0000678 Ga0495639_0000678_15036_15542 168
86 3300046476 Ga0495662_0054847 Ga0495662_0054847_422_928 168
87 3300046511 Ga0495608_0049244 Ga0495608_0049244_422_928 168
88 3300046514 Ga0495618_0046822 Ga0495618_0046822_970_1476 168
89 3300046514 Ga0495618_0177489 Ga0495618_0177489_472_978 168
90 3300046516 Ga0495628_0466570 Ga0495628_0466570_344_850 168
91 3300046526 Ga0495666_0004420 Ga0495666_0004420_1358_1864 168
92 3300046529 Ga0495652_0548147 Ga0495652_0548147_49_555 168
93 3300046529 Ga0495652_0574505 Ga0495652_0574505_61_567 168
94 3300046533 Ga0495640_0060097 Ga0495640_0060097_964_1470 168
95 3300046535 Ga0495586_0069786 Ga0495586_0069786_1380_1886 168
96 3300046536 Ga0495587_0090727 Ga0495587_0090727_848_1354 168
97 3300046559 Ga0495667_0038906 Ga0495667_0038906_1502_2008 168
98 3300046642 Ga0495634_0004636 Ga0495634_0004636_4579_5085 168
99 3300046663 Ga0495635_0163299 Ga0495635_0163299_423_929 168
100 3300046675 Ga0495657_0050120 Ga0495657_0050120_2092_2598 168
101 3300046678 Ga0495599_0105555 Ga0495599_0105555_455_961 168
102 3300046679 Ga0495623_0110569 Ga0495623_0110569_131_637 168
103 3300046680 Ga0495646_0217353 Ga0495646_0217353_105_611 168
104 3300046681 Ga0495647_0009644 Ga0495647_0009644_1526_2032 168
105 3300046681 Ga0495647_0030357 Ga0495647_0030357_101_607 168
106 3300046683 Ga0495658_0017930 Ga0495658_0017930_1506_2012 168
107 3300046690 Ga0495624_0025276 Ga0495624_0025276_1456_1962 168
108 3300046809 Ga0495600_0046351 Ga0495600_0046351_1994_2500 168
109 3300047315 Ga0495581_0006834 Ga0495581_0006834_5901_6407 168
110 3300047315 Ga0495581_0022833 Ga0495581_0022833_1702_2208 168
111 3300047317 Ga0495604_0067605 Ga0495604_0067605_1142_1648 168
112 3300047319 Ga0495674_0047129 Ga0495674_0047129_1867_2373 168
113 3300047319 Ga0495674_0100658 Ga0495674_0100658_558_1064 168
114 3300047321 Ga0495676_0037031 Ga0495676_0037031_1276_1782 168
115 3300047321 Ga0495676_0039156 Ga0495676_0039156_2717_3223 168
116 3300047322 Ga0495680_0307664 Ga0495680_0307664_211_717 168
117 3300047444 Ga0495675_0061693 Ga0495675_0061693_1636_2142 168
118 3300047471 Ga0495684_0051830 Ga0495684_0051830_1509_2015 168
119 3300048088 Ga0495602_0205469 Ga0495602_0205469_404_910 168
120 3300048089 Ga0495614_0004529 Ga0495614_0004529_4776_5282 168
121 3300048904 Ga0496101_0112001 Ga0496101_0112001_993_1499 168
122 3300048907 Ga0496104_0279314 Ga0496104_0279314_224_730 168
123 3300048908 Ga0496105_0289225 Ga0496105_0289225_497_1003 168
124 3300048911 Ga0496108_0402507 Ga0496108_0402507_199_705 168
125 3300048912 Ga0496109_0414029 Ga0496109_0414029_102_608 168
126 3300048917 Ga0496114_0065567 Ga0496114_0065567_1567_2073 168
127 3300048917 Ga0496114_0143986 Ga0496114_0143986_945_1451 168
128 3300048918 Ga0496115_0109593 Ga0496115_0109593_938_1444 168
129 3300053077 Ga0495601_0005948 Ga0495601_0005948_2847_3353 168
130 3300053077 Ga0495601_0178986 Ga0495601_0178986_725_1231 168
131 3300053085 Ga0495619_0012173 Ga0495619_0012173_1604_2110 168
132 3300005327 Ga0070658_10052051 Ga0070658_100520512 169
133 3300005330 Ga0070690_100244332 Ga0070690_1002443322 169
134 3300005334 Ga0068869_100336834 Ga0068869_1003368342 169
135 3300005455 Ga0070663_101150707 Ga0070663_1011507071 169
136 3300005456 Ga0070678_100043499 Ga0070678_1000434992 169
137 3300005718 Ga0068866_10217687 Ga0068866_102176872 169
138 3300005981 Ga0081538_10020455 Ga0081538_100204553 169
139 3300005983 Ga0081540_1132295 Ga0081540_11322952 169
140 3300006038 Ga0075365_10401006 Ga0075365_104010061 169
141 3300006881 Ga0068865_100000034 Ga0068865_10000003444 169
142 3300009176 Ga0105242_10127781 Ga0105242_101277812 169
143 3300009551 Ga0105238_10000126 Ga0105238_1000012612 169
144 3300013297 Ga0157378_10723207 Ga0157378_107232071 169
145 3300025915 Ga0207693_10378299 Ga0207693_103782992 169
146 3300028800 Ga0265338_10196560 Ga0265338_101965602 169
147 3300029957 Ga0265324_10023176 Ga0265324_100231763 169
148 3300031548 Ga0307408_100385229 Ga0307408_1003852292 169
149 3300031548 Ga0307408_100557264 Ga0307408_1005572642 169
150 3300031852 Ga0307410_10624339 Ga0307410_106243392 169
151 3300031995 Ga0307409_100347338 Ga0307409_1003473382 169
152 3300032002 Ga0307416_100109743 Ga0307416_1001097432 169
153 3300032005 Ga0307411_10328386 Ga0307411_103283862 169
154 3300032126 Ga0307415_100363021 Ga0307415_1003630212 169
155 3300035241 Ga0373961_0158119 Ga0373961_0158119_97_615 169
156 3300039437 Ga0436365_0823988 Ga0436365_0823988_209_718 169
157 3300044719 Ga0466971_0003922 Ga0466971_0003922_3704_4213 169
158 3300044842 Ga0466957_0005852 Ga0466957_0005852_2099_2608 169
159 3300044842 Ga0466957_0021342 Ga0466957_0021342_111_620 169
160 3300046471 Ga0495650_0000049 Ga0495650_0000049_831_1346 169
161 3300046473 Ga0495582_0000004 Ga0495582_0000004_34806_35315 169
162 3300046543 Ga0495645_0345852 Ga0495645_0345852_118_654 169
163 3300046674 Ga0495588_0000244 Ga0495588_0000244_42536_43045 169
164 3300046683 Ga0495658_0000004 Ga0495658_0000004_104241_104750 169
165 3300046683 Ga0495658_0004064 Ga0495658_0004064_4088_4597 169
166 3300046809 Ga0495600_0027865 Ga0495600_0027865_1422_1958 169
167 3300047472 Ga0495686_0074887 Ga0495686_0074887_1323_1886 169
168 3300048905 Ga0496102_0908052 Ga0496102_0908052_94_654 169
169 3300048911 Ga0496108_1128313 Ga0496108_1128313_73_633 169
170 3300048912 Ga0496109_0111836 Ga0496109_0111836_1212_1721 169
171 3300048912 Ga0496109_0603244 Ga0496109_0603244_295_855 169
172 3300048915 Ga0496112_0291863 Ga0496112_0291863_311_820 169
173 3300048915 Ga0496112_0873708 Ga0496112_0873708_237_797 169
174 3300048917 Ga0496114_0597055 Ga0496114_0597055_62_571 169
175 3300053085 Ga0495619_0390563 Ga0495619_0390563_136_645 169
176 3300006914 Ga0075436_100450504 Ga0075436_1004505042 170
177 3300005439 Ga0070711_100301676 Ga0070711_1003016762 171
178 3300005981 Ga0081538_10000696 Ga0081538_1000069612 171
179 3300009148 Ga0105243_10208753 Ga0105243_102087531 171
180 3300005337 Ga0070682_100785976 Ga0070682_1007859762 172
181 3300005338 Ga0068868_100275308 Ga0068868_1002753081 172
182 3300005344 Ga0070661_100052406 Ga0070661_1000524064 172
183 3300005546 Ga0070696_100806958 Ga0070696_1008069582 172
184 3300005564 Ga0070664_100323871 Ga0070664_1003238712 172
185 3300005616 Ga0068852_100728444 Ga0068852_1007284441 172
186 3300005617 Ga0068859_100185893 Ga0068859_1001858933 172
187 3300005843 Ga0068860_100808272 Ga0068860_1008082722 172
188 3300005844 Ga0068862_100749095 Ga0068862_1007490952 172
189 3300006931 Ga0097620_100185893 Ga0097620_1001858932 172
190 3300014745 Ga0157377_10691923 Ga0157377_106919231 172
191 3300025920 Ga0207649_10186549 Ga0207649_101865492 172
192 3300025945 Ga0207679_10140825 Ga0207679_101408252 172
193 3300025981 Ga0207640_10357434 Ga0207640_103574342 172
194 3300026142 Ga0207698_10527535 Ga0207698_105275352 172
195 3300028379 Ga0268266_10878563 Ga0268266_108785632 172
196 3300046459 Ga0495629_0268603 Ga0495629_0268603_567_1085 172
197 3300046689 Ga0495613_0438494 Ga0495613_0438494_120_638 172
198 3300047321 Ga0495676_0178889 Ga0495676_0178889_89_607 172
199 3300048912 Ga0496109_0126504 Ga0496109_0126504_1299_1826 172
200 3300048913 Ga0496110_0356976 Ga0496110_0356976_709_1236 172
201 3300048915 Ga0496112_1606992 Ga0496112_1606992_26_544 172
202 3300048922 Ga0496119_0262212 Ga0496119_0262212_32_559 172
203 3300048924 Ga0496121_0432727 Ga0496121_0432727_100_627 172
204 3300053153 Ga0500616_0165420 Ga0500616_0165420_394_921 172
205 3300005439 Ga0070711_100213169 Ga0070711_1002131692 174
206 3300005614 Ga0068856_100124076 Ga0068856_1001240764 174
207 3300006175 Ga0070712_100005121 Ga0070712_1000051216 174
208 3300025916 Ga0207663_10364164 Ga0207663_103641642 174
209 3300025929 Ga0207664_10660000 Ga0207664_106600002 174
210 3300026078 Ga0207702_10174328 Ga0207702_101743283 174
211 3300048903 Ga0496100_0008989 Ga0496100_0008989_1761_2285 174
212 3300048903 Ga0496100_0259170 Ga0496100_0259170_251_775 174
213 3300048904 Ga0496101_0012691 Ga0496101_0012691_1328_1852 174
214 3300048904 Ga0496101_0603935 Ga0496101_0603935_63_587 174
215 3300048905 Ga0496102_0061142 Ga0496102_0061142_2880_3404 174
216 3300048907 Ga0496104_0025703 Ga0496104_0025703_2184_2708 174
217 3300048908 Ga0496105_0231174 Ga0496105_0231174_239_763 174
218 3300048909 Ga0496106_0030297 Ga0496106_0030297_3039_3563 174
219 3300048910 Ga0496107_0512441 Ga0496107_0512441_123_647 174
220 3300048911 Ga0496108_0245508 Ga0496108_0245508_448_972 174
221 3300048912 Ga0496109_0008817 Ga0496109_0008817_4158_4682 174
222 3300048913 Ga0496110_0006898 Ga0496110_0006898_8460_8984 174
223 3300048914 Ga0496111_0004191 Ga0496111_0004191_7375_7899 174
224 3300048915 Ga0496112_0040216 Ga0496112_0040216_1769_2293 174
225 3300048916 Ga0496113_0122351 Ga0496113_0122351_354_878 174
226 3300048917 Ga0496114_0014926 Ga0496114_0014926_3241_3765 174
227 3300048917 Ga0496114_0388770 Ga0496114_0388770_617_1141 174
228 3300048918 Ga0496115_0493526 Ga0496115_0493526_299_823 174
229 3300048912 Ga0496109_0380895 Ga0496109_0380895_510_1037 175
230 3300031995 Ga0307409_100749011 Ga0307409_1007490112 180
231 3300046684 Ga0495669_0000030 Ga0495669_0000030_65000_65554 182
232 3300047317 Ga0495604_0000126 Ga0495604_0000126_19513_20070 183
233 3300003373 JGI25407J50210_10049124 JGI25407J50210_100491241 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

38

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eof-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_213212.1) from bacteroides fragilis nctc 9343 at 1.99 a resolution 0.8727 22 186
3k6h-assembly1.cif.gz_B crystal structure of a nitroreductase family protein from agrobacterium tumefaciens str. c58 0.8609 22 186
7z0w-assembly4.cif.gz_G e. coli nfsa bound to nadp+ 0.8598 19 186
5hei-assembly3.cif.gz_E structure of b. megaterium nfra2 0.8567 20 186
7z0w-assembly3.cif.gz_F e. coli nfsa bound to nadp+ 0.856 19 186
ID Description Score Start End Superfamily
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8663 17 185 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.857 22 166 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8518 20 186 3.40.109.10
5heiD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8491 20 186 3.40.109.10
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8432 21 185 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A6I3BTA6-F1-model_v4 Nitroreductase 0.9807 19 186 GO:0016491
AF-A0A7W1N8R8-F1-model_v4 Nitroreductase 0.9752 19 162 GO:0016491
AF-A0A6I3BTA6-F1-model_v4 Nitroreductase 0.9693 19 186 GO:0016491
AF-A0A7W1N8R8-F1-model_v4 Nitroreductase 0.9557 19 162 GO:0016491
AF-A0A538IB46-F1-model_v4 Nitroreductase domain-containing protein 0.942 1 186 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map