F346175

General Info

Members Datasets Scaffolds Average Seq Length
233 155 466 329

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10052900|Ga0207689_100529003
Length 339
Sequence MNSYASAVRVGIAGATGYTGVELLRLLSRHPSVHVTAAMGAPGAAPRHVPALKRLWDEPVNGLDLDALADATDAVFLALPEHAAAEIAPSLVERGKRVFDLSGAFRLRDASLRRRWYPKTPDAPQSVVYGLTERNRDLLRDSTLVACAGCYPTAAILALQPLLHAGLLDLSGSPIIIDAKSGVSGAGKTPTERTHFSECHGSLSAYGVFDHRHAAEIEQELGTTVTFVPHLLPIDRGILETIYAMLSPGVDEPAVAAALQAAYADSPFVRLTGGDLPEIKHVAHTNFCDIGWRVNPATRQLVLISCIDNLVKGAAGQAVQNFNVAFGFDERLGLNLSHS

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
108 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0
Rhizoplane 7.3
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10052900 3300025942 Bacteria 3345
2 JGI24751J29686_10006477 3300002459 Bacteria 2387
3 Ga0065712_10076363 3300005290 Bacteria 3675
4 Ga0070683_100009004 3300005329 Bacteria 8514
5 Ga0070690_100086062 3300005330 Bacteria 2063
6 Ga0070670_100019705 3300005331 Bacteria 5792
7 Ga0068869_100005400 3300005334 Bacteria 8034
8 Ga0068868_100269606 3300005338 Bacteria 1438
9 Ga0070689_100026994 3300005340 Bacteria 4327
10 Ga0070689_100039878 3300005340 Bacteria 3597
11 Ga0070689_100227828 3300005340 Bacteria 1531
12 Ga0070687_100006059 3300005343 Bacteria 4932
13 Ga0070668_100280655 3300005347 Bacteria 1391
14 Ga0070669_100032589 3300005353 Bacteria 3764
15 Ga0070675_100065605 3300005354 Bacteria 3002
16 Ga0070675_100188095 3300005354 Bacteria 1788
17 Ga0070674_100038917 3300005356 Bacteria 3208
18 Ga0070674_100086312 3300005356 Bacteria 2254
19 Ga0070688_100053628 3300005365 Bacteria 2523
20 Ga0070667_100049595 3300005367 Bacteria 3536
21 Ga0070667_100077116 3300005367 Bacteria 2846
22 Ga0070713_100004053 3300005436 Bacteria 9759
23 Ga0070700_100151938 3300005441 Bacteria 1584
24 Ga0070694_100213206 3300005444 Bacteria 1445
25 Ga0070681_10513974 3300005458 Bacteria 1111
26 Ga0068867_100004346 3300005459 Bacteria 9975
27 Ga0068867_100039468 3300005459 Bacteria 3442
28 Ga0070684_100104413 3300005535 Bacteria 2535
29 Ga0070672_100138796 3300005543 Bacteria 2003
30 Ga0070704_100010022 3300005549 Bacteria 5756
31 Ga0070664_100383864 3300005564 Bacteria 1283
32 Ga0068854_100030384 3300005578 Bacteria 3747
33 Ga0068854_100396515 3300005578 Archaea 1141
34 Ga0068852_100086006 3300005616 Bacteria 2802
35 Ga0068852_100253338 3300005616 Bacteria 1687
36 Ga0068859_100026532 3300005617 Bacteria 5810
37 Ga0068859_100168213 3300005617 Bacteria 2272
38 Ga0068859_100343523 3300005617 Bacteria 1587
39 Ga0068864_100048219 3300005618 Bacteria 3661
40 Ga0068861_100222277 3300005719 Bacteria 1597
41 Ga0068863_100491909 3300005841 Bacteria 1207
42 Ga0068863_100493501 3300005841 Bacteria 1205
43 Ga0068858_100003046 3300005842 Bacteria 16797
44 Ga0068858_100069622 3300005842 Bacteria 3261
45 Ga0068858_100191271 3300005842 Bacteria 1934
46 Ga0068860_100220462 3300005843 Unclassified 1842
47 Ga0068860_100279373 3300005843 Bacteria 1631
48 Ga0068862_100183001 3300005844 Bacteria 1882
49 Ga0075364_10008747 3300006051 Bacteria 6057
50 Ga0075364_10023807 3300006051 Bacteria 3880
51 Ga0075362_10011012 3300006177 Bacteria 3551
52 Ga0075367_10026438 3300006178 Bacteria 3292
53 Ga0075370_10003635 3300006353 Bacteria 7380
54 Ga0068871_100095264 3300006358 Bacteria 2486
55 Ga0075428_100364921 3300006844 Bacteria 1549
56 Ga0075431_100315206 3300006847 Bacteria 1578
57 Ga0075434_100068752 3300006871 Bacteria 3529
58 Ga0075434_100070768 3300006871 Bacteria 3479
59 Ga0068865_100130256 3300006881 Bacteria 1884
60 Ga0075436_100205072 3300006914 Bacteria 1397
61 Ga0097620_100026532 3300006931 Bacteria 5810
62 Ga0097620_100048921 3300006931 Bacteria 4246
63 Ga0097620_100168216 3300006931 Bacteria 2272
64 Ga0097620_100343528 3300006931 Bacteria 1587
65 Ga0075435_100053068 3300007076 Bacteria 3268
66 Ga0075435_100066473 3300007076 Bacteria 2933
67 Ga0105240_10057185 3300009093 Bacteria 4875
68 Ga0105240_10653900 3300009093 Bacteria 1152
69 Ga0111539_10000907 3300009094 Bacteria 38710
70 Ga0111539_10024079 3300009094 Bacteria 7477
71 Ga0111539_10055890 3300009094 Bacteria 4692
72 Ga0111539_10083853 3300009094 Bacteria 3747
73 Ga0111539_10109773 3300009094 Bacteria 3237
74 Ga0111539_10110248 3300009094 Bacteria 3230
75 Ga0105245_10033278 3300009098 Bacteria 4567
76 Ga0105247_10045758 3300009101 Bacteria 2686
77 Ga0114129_10003295 3300009147 Bacteria 22672
78 Ga0114129_10845264 3300009147 Bacteria 1164
79 Ga0105242_10040588 3300009176 Bacteria 3750
80 Ga0105248_10074996 3300009177 Bacteria 3802
81 Ga0105248_10084308 3300009177 Bacteria 3574
82 Ga0105248_10135227 3300009177 Bacteria 2781
83 Ga0105248_10381176 3300009177 Bacteria 1588
84 Ga0105249_10037749 3300009553 Bacteria 4383
85 Ga0105249_10043447 3300009553 Bacteria 4086
86 Ga0105239_10407976 3300010375 Bacteria 1538
87 Ga0105239_10599983 3300010375 Bacteria 1256
88 Ga0157372_10117063 3300013307 Bacteria 3056
89 Ga0157372_10198922 3300013307 Bacteria 2321
90 Ga0157372_10958038 3300013307 Bacteria 992
91 Ga0157375_10193580 3300013308 Bacteria 2188
92 Ga0163163_10060649 3300014325 Bacteria 3747
93 Ga0157380_10076858 3300014326 Bacteria 2719
94 Ga0157380_10154777 3300014326 Bacteria 1986
95 Ga0157380_10215343 3300014326 Bacteria 1715
96 Ga0157379_10047203 3300014968 Bacteria 3841
97 Ga0157379_10157185 3300014968 Bacteria 2051
98 Ga0207697_10014486 3300025315 Bacteria 3269
99 Ga0207710_10009783 3300025900 Bacteria 4029
100 Ga0207710_10108602 3300025900 Bacteria 1315
101 Ga0207688_10124474 3300025901 Bacteria 1507
102 Ga0207699_10095787 3300025906 Bacteria 1872
103 Ga0207695_10140898 3300025913 Bacteria 2360
104 Ga0207662_10003460 3300025918 Bacteria 8130
105 Ga0207652_10130265 3300025921 Bacteria 2243
106 Ga0207681_10092024 3300025923 Bacteria 2167
107 Ga0207659_10062147 3300025926 Bacteria 2695
108 Ga0207659_10077881 3300025926 Bacteria 2441
109 Ga0207659_10154847 3300025926 Bacteria 1793
110 Ga0207700_10087628 3300025928 Bacteria 2449
111 Ga0207644_10134284 3300025931 Bacteria 1898
112 Ga0207709_10297991 3300025935 Bacteria 1198
113 Ga0207704_10037960 3300025938 Bacteria 2788
114 Ga0207691_10002157 3300025940 Bacteria 19248
115 Ga0207691_10247810 3300025940 Bacteria 1538
116 Ga0207711_10046938 3300025941 Bacteria 3691
117 Ga0207711_10152148 3300025941 Bacteria 2088
118 Ga0207711_10183373 3300025941 Bacteria 1904
119 Ga0207711_10434244 3300025941 Bacteria 1222
120 Ga0207689_10300258 3300025942 Bacteria 1331
121 Ga0207661_10002519 3300025944 Bacteria 12605
122 Ga0207679_10126629 3300025945 Bacteria 2042
123 Ga0207712_10012266 3300025961 Bacteria 5474
124 Ga0207658_10084124 3300025986 Bacteria 2447
125 Ga0207703_10023920 3300026035 Bacteria 4804
126 Ga0207703_10120136 3300026035 Bacteria 2255
127 Ga0207703_10395637 3300026035 Bacteria 1281
128 Ga0207678_10299117 3300026067 Bacteria 1383
129 Ga0207708_10016959 3300026075 Bacteria 5483
130 Ga0207641_10153256 3300026088 Bacteria 2089
131 Ga0207648_10001437 3300026089 Bacteria 26214
132 Ga0207648_10008433 3300026089 Bacteria 9984
133 Ga0207648_10112891 3300026089 Bacteria 2386
134 Ga0207676_10047708 3300026095 Bacteria 3321
135 Ga0207683_10328995 3300026121 Bacteria 1400
136 Ga0209971_1028130 3300027682 Bacteria 1345
137 Ga0207428_10004528 3300027907 Bacteria 13184
138 Ga0207428_10040412 3300027907 Bacteria 3783
139 Ga0207428_10289058 3300027907 Bacteria 1215
140 Ga0268265_10087014 3300028380 Bacteria 2485
141 Ga0268265_10306545 3300028380 Unclassified 1432
142 Ga0268264_10192664 3300028381 Bacteria 1859
143 Ga0307405_10215197 3300031731 Bacteria 1406
144 Ga0307413_10049217 3300031824 Bacteria 2525
145 Ga0307410_10041134 3300031852 Unclassified 3046
146 Ga0307416_100197318 3300032002 Bacteria 1905
147 Ga0307414_10402481 3300032004 Bacteria 1189
148 Ga0307411_10162877 3300032005 Bacteria 1673
149 Ga0307415_100007778 3300032126 Bacteria 5889
150 Ga0307415_100168657 3300032126 Bacteria 1705
151 Ga0373934_0000589 3300035086 Bacteria 12814
152 Ga0373953_0027921 3300035117 Bacteria 2172
153 Ga0373954_0038986 3300035118 Bacteria 2211
154 Ga0373943_0025163 3300035170 Bacteria 2781
155 Ga0373955_0116999 3300035172 Bacteria 1546
156 Ga0373933_0002262 3300035724 Bacteria 10977
157 Ga0373933_0037728 3300035724 Bacteria 2836
158 Ga0373947_0058438 3300035725 Bacteria 2337
159 Ga0373937_0000302 3300036401 Bacteria 46842
160 Ga0373937_0002273 3300036401 Bacteria 16039
161 Ga0373925_0000407 3300037068 Bacteria 43887
162 Ga0439453_0022644 3300041408 Bacteria 1141
163 Ga0450896_002125 3300042133 Bacteria 2531
164 Ga0439446_0052140 3300042156 Bacteria 1224
165 Ga0439435_0037375 3300042436 Bacteria 1345
166 Ga0439444_0016560 3300042437 Bacteria 1257
167 Ga0439460_0039343 3300042461 Bacteria 1382
168 Ga0450918_031504 3300042531 Bacteria 937
169 Ga0451577_0008084 3300042876 Bacteria 10265
170 Ga0451576_0011161 3300045051 Bacteria 10242
171 Ga0451576_0171619 3300045051 Bacteria 2264
172 Ga0495651_0106148 3300046462 Bacteria 2082
173 Ga0495634_0022869 3300046642 Bacteria 4401
174 Ga0495635_0185140 3300046663 Bacteria 1415
175 Ga0495657_0324535 3300046675 Bacteria 914
176 Ga0495674_0075622 3300047319 Bacteria 2898
177 Ga0495680_0206133 3300047322 Bacteria 1409
178 Ga0496101_0125312 3300048904 Bacteria 1946
179 Ga0496102_0332166 3300048905 Bacteria 1432
180 Ga0496102_0445709 3300048905 Bacteria 1215
181 Ga0496104_0001648 3300048907 Bacteria 19263
182 Ga0496105_0006629 3300048908 Bacteria 8914
183 Ga0496107_0133782 3300048910 Bacteria 1832
184 Ga0496108_0044541 3300048911 Bacteria 3703
185 Ga0496109_0340720 3300048912 Bacteria 1416
186 Ga0496110_0484748 3300048913 Bacteria 1126
187 Ga0496112_0157362 3300048915 Bacteria 2239
188 Ga0496112_0176876 3300048915 Bacteria 2099
189 Ga0496112_0250754 3300048915 Bacteria 1721
190 Ga0496112_0345958 3300048915 Bacteria 1430
191 Ga0496112_0427985 3300048915 Bacteria 1262
192 Ga0496114_0009672 3300048917 Bacteria 7659
193 Ga0496114_0180857 3300048917 Unclassified 1842
194 Ga0496115_0393926 3300048918 Bacteria 1124
195 Ga0501034_0015159 3300049571 Bacteria 7922
196 Ga0501046_0193990 3300049580 Bacteria 1514
197 Ga0501048_0104317 3300049582 Bacteria 2001
198 Ga0501071_0187107 3300049587 Bacteria 1552
199 Ga0501072_0180101 3300049588 Bacteria 1686
200 Ga0501075_0067443 3300049591 Bacteria 2702
201 Ga0501075_0081822 3300049591 Unclassified 2445
202 Ga0501075_0280619 3300049591 Unclassified 1269
203 Ga0501076_0023183 3300049592 Bacteria 4782
204 Ga0501076_0116189 3300049592 Bacteria 2165
205 Ga0501076_0147406 3300049592 Bacteria 1914
206 Ga0501079_0129308 3300049741 Bacteria 1965
207 Ga0501079_0312173 3300049741 Bacteria 1230
208 Ga0501080_0379457 3300049742 Bacteria 1274
209 Ga0501045_0097023 3300049824 Unclassified 2181
210 nmdc:mga00v17_39736_c1 3300050491 Bacteria 2819
211 nmdc:mga00v17_50320_c1 3300050491 Bacteria 2531
212 nmdc:mga0yw44_27842_c1 3300050492 Bacteria 3243
213 nmdc:mga0k408_8747_c1 3300050493 Bacteria 5447
214 nmdc:mga05p37_240773_c1 3300050507 Bacteria 2175
215 nmdc:mga05p37_2625_c1 3300050507 Bacteria 20924
216 nmdc:mga05p37_92175_c1 3300050507 Bacteria 3733
217 nmdc:mga0qj67_67544_c1 3300050509 Bacteria 2848
218 nmdc:mga08y16_190022_c1 3300050511 Bacteria 2130
219 nmdc:mga08y16_270461_c1 3300050511 Bacteria 1754
220 nmdc:mga08y16_39254_c1 3300050511 Bacteria 4968
221 nmdc:mga08y16_73553_c1 3300050511 Bacteria 3562
222 nmdc:mga0n895_102162_c1 3300050512 Bacteria 2877
223 nmdc:mga0n895_365900_c1 3300050512 Unclassified 1460
224 nmdc:mga0rr50_18062_c1 3300050513 Bacteria 4728
225 nmdc:mga0rr50_342454_c1 3300050513 Unclassified 1256
226 Ga0495601_0007459 3300053077 Bacteria 6416
227 Ga0495601_0106766 3300053077 Bacteria 1811
228 Ga0495601_0167120 3300053077 Bacteria 1438
229 Ga0495595_0008423 3300053084 Bacteria 4231
230 Ga0495619_0005976 3300053085 Bacteria 7707
231 Ga0501082_0018973 3300060353 Bacteria 5926
232 Ga0501082_0436735 3300060353 Unclassified 1143
233 Ga0530510_0406068 3300061734 Bacteria 1027
234 Ga0207689_10052900
235 JGI24751J29686_10006477
236 Ga0065712_10076363
237 Ga0070683_100009004
238 Ga0070690_100086062
239 Ga0070670_100019705
240 Ga0068869_100005400
241 Ga0068868_100269606
242 Ga0070689_100026994
243 Ga0070689_100039878
244 Ga0070689_100227828
245 Ga0070687_100006059
246 Ga0070668_100280655
247 Ga0070669_100032589
248 Ga0070675_100065605
249 Ga0070675_100188095
250 Ga0070674_100038917
251 Ga0070674_100086312
252 Ga0070688_100053628
253 Ga0070667_100049595
254 Ga0070667_100077116
255 Ga0070713_100004053
256 Ga0070700_100151938
257 Ga0070694_100213206
258 Ga0070681_10513974
259 Ga0068867_100004346
260 Ga0068867_100039468
261 Ga0070684_100104413
262 Ga0070672_100138796
263 Ga0070704_100010022
264 Ga0070664_100383864
265 Ga0068854_100030384
266 Ga0068854_100396515
267 Ga0068852_100086006
268 Ga0068852_100253338
269 Ga0068859_100026532
270 Ga0068859_100168213
271 Ga0068859_100343523
272 Ga0068864_100048219
273 Ga0068861_100222277
274 Ga0068863_100491909
275 Ga0068863_100493501
276 Ga0068858_100003046
277 Ga0068858_100069622
278 Ga0068858_100191271
279 Ga0068860_100220462
280 Ga0068860_100279373
281 Ga0068862_100183001
282 Ga0075364_10008747
283 Ga0075364_10023807
284 Ga0075362_10011012
285 Ga0075367_10026438
286 Ga0075370_10003635
287 Ga0068871_100095264
288 Ga0075428_100364921
289 Ga0075431_100315206
290 Ga0075434_100068752
291 Ga0075434_100070768
292 Ga0068865_100130256
293 Ga0075436_100205072
294 Ga0097620_100026532
295 Ga0097620_100048921
296 Ga0097620_100168216
297 Ga0097620_100343528
298 Ga0075435_100053068
299 Ga0075435_100066473
300 Ga0105240_10057185
301 Ga0105240_10653900
302 Ga0111539_10000907
303 Ga0111539_10024079
304 Ga0111539_10055890
305 Ga0111539_10083853
306 Ga0111539_10109773
307 Ga0111539_10110248
308 Ga0105245_10033278
309 Ga0105247_10045758
310 Ga0114129_10003295
311 Ga0114129_10845264
312 Ga0105242_10040588
313 Ga0105248_10074996
314 Ga0105248_10084308
315 Ga0105248_10135227
316 Ga0105248_10381176
317 Ga0105249_10037749
318 Ga0105249_10043447
319 Ga0105239_10407976
320 Ga0105239_10599983
321 Ga0157372_10117063
322 Ga0157372_10198922
323 Ga0157372_10958038
324 Ga0157375_10193580
325 Ga0163163_10060649
326 Ga0157380_10076858
327 Ga0157380_10154777
328 Ga0157380_10215343
329 Ga0157379_10047203
330 Ga0157379_10157185
331 Ga0207697_10014486
332 Ga0207710_10009783
333 Ga0207710_10108602
334 Ga0207688_10124474
335 Ga0207699_10095787
336 Ga0207695_10140898
337 Ga0207662_10003460
338 Ga0207652_10130265
339 Ga0207681_10092024
340 Ga0207659_10062147
341 Ga0207659_10077881
342 Ga0207659_10154847
343 Ga0207700_10087628
344 Ga0207644_10134284
345 Ga0207709_10297991
346 Ga0207704_10037960
347 Ga0207691_10002157
348 Ga0207691_10247810
349 Ga0207711_10046938
350 Ga0207711_10152148
351 Ga0207711_10183373
352 Ga0207711_10434244
353 Ga0207689_10300258
354 Ga0207661_10002519
355 Ga0207679_10126629
356 Ga0207712_10012266
357 Ga0207658_10084124
358 Ga0207703_10023920
359 Ga0207703_10120136
360 Ga0207703_10395637
361 Ga0207678_10299117
362 Ga0207708_10016959
363 Ga0207641_10153256
364 Ga0207648_10001437
365 Ga0207648_10008433
366 Ga0207648_10112891
367 Ga0207676_10047708
368 Ga0207683_10328995
369 Ga0209971_1028130
370 Ga0207428_10004528
371 Ga0207428_10040412
372 Ga0207428_10289058
373 Ga0268265_10087014
374 Ga0268265_10306545
375 Ga0268264_10192664
376 Ga0307405_10215197
377 Ga0307413_10049217
378 Ga0307410_10041134
379 Ga0307416_100197318
380 Ga0307414_10402481
381 Ga0307411_10162877
382 Ga0307415_100007778
383 Ga0307415_100168657
384 Ga0373934_0000589
385 Ga0373953_0027921
386 Ga0373954_0038986
387 Ga0373943_0025163
388 Ga0373955_0116999
389 Ga0373933_0002262
390 Ga0373933_0037728
391 Ga0373947_0058438
392 Ga0373937_0000302
393 Ga0373937_0002273
394 Ga0373925_0000407
395 Ga0439453_0022644
396 Ga0450896_002125
397 Ga0439446_0052140
398 Ga0439435_0037375
399 Ga0439444_0016560
400 Ga0439460_0039343
401 Ga0450918_031504
402 Ga0451577_0008084
403 Ga0451576_0011161
404 Ga0451576_0171619
405 Ga0495651_0106148
406 Ga0495634_0022869
407 Ga0495635_0185140
408 Ga0495657_0324535
409 Ga0495674_0075622
410 Ga0495680_0206133
411 Ga0496101_0125312
412 Ga0496102_0332166
413 Ga0496102_0445709
414 Ga0496104_0001648
415 Ga0496105_0006629
416 Ga0496107_0133782
417 Ga0496108_0044541
418 Ga0496109_0340720
419 Ga0496110_0484748
420 Ga0496112_0157362
421 Ga0496112_0176876
422 Ga0496112_0250754
423 Ga0496112_0345958
424 Ga0496112_0427985
425 Ga0496114_0009672
426 Ga0496114_0180857
427 Ga0496115_0393926
428 Ga0501034_0015159
429 Ga0501046_0193990
430 Ga0501048_0104317
431 Ga0501071_0187107
432 Ga0501072_0180101
433 Ga0501075_0067443
434 Ga0501075_0081822
435 Ga0501075_0280619
436 Ga0501076_0023183
437 Ga0501076_0116189
438 Ga0501076_0147406
439 Ga0501079_0129308
440 Ga0501079_0312173
441 Ga0501080_0379457
442 Ga0501045_0097023
443 nmdc:mga00v17_39736_c1
444 nmdc:mga00v17_50320_c1
445 nmdc:mga0yw44_27842_c1
446 nmdc:mga0k408_8747_c1
447 nmdc:mga05p37_240773_c1
448 nmdc:mga05p37_2625_c1
449 nmdc:mga05p37_92175_c1
450 nmdc:mga0qj67_67544_c1
451 nmdc:mga08y16_190022_c1
452 nmdc:mga08y16_270461_c1
453 nmdc:mga08y16_39254_c1
454 nmdc:mga08y16_73553_c1
455 nmdc:mga0n895_102162_c1
456 nmdc:mga0n895_365900_c1
457 nmdc:mga0rr50_18062_c1
458 nmdc:mga0rr50_342454_c1
459 Ga0495601_0007459
460 Ga0495601_0106766
461 Ga0495601_0167120
462 Ga0495595_0008423
463 Ga0495619_0005976
464 Ga0501082_0018973
465 Ga0501082_0436735
466 Ga0530510_0406068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

150

309

0.99

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

159

312

0.94

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

9

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.916 6 334
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.9137 7 334
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9 6 334
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.8953 7 334
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.885 4 334
ID Description Score Start End Superfamily
af_P11446_1_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9034 7 103 3.40.50.720
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8976 148 312 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8922 148 312 3.30.360.10
2g17A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8624 6 146 3.40.50.720
1vknA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8586 8 146 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523UZZ3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9543 226 334 GO:0003942
AF-A0A1V5K7L4-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9492 231 334 GO:0003942
AF-A0A383F017-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9381 6 152 GO:0006526
GO:0016620
GO:0051287
AF-A0A523UZZ3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9376 226 334 GO:0003942
AF-A0A7W0HFX4-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9362 6 334 GO:0003942
GO:0005737
GO:0006526
GO:0051287
GO:0070401

Map