F345867

General Info

Members Datasets Scaffolds Average Seq Length
233 170 466 169

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100869534|Ga0070684_1008695342
Length 183
Sequence MATRSPDERLTFRRADTPDAAAVLELRTATARDLTTRFGRGHWSIEGSERGVLNDLRISQVWLALRGRAAVATFRLSARKPWAIDASYFTRSTRPLYLTDMAVRPELQRQGIGRQCVEEIVAIARRWPADSIRLDAYDAPAGAGDFYARCGFREVGRVSYRGNPLVYFEMMLEGSTGNVADAR

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.15
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 24.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100869534 3300005535 Unclassified 844
2 Ga0070658_10221966 3300005327 Bacteria 1599
3 Ga0070658_10326800 3300005327 Bacteria 1310
4 Ga0070658_10327456 3300005327 Bacteria 1309
5 Ga0070676_10010209 3300005328 Bacteria 5092
6 Ga0070683_100364398 3300005329 Bacteria 1376
7 Ga0070670_100002088 3300005331 Bacteria 16375
8 Ga0068869_100156771 3300005334 Bacteria 1770
9 Ga0070680_100390139 3300005336 Unclassified 1186
10 Ga0070682_100558891 3300005337 Bacteria 897
11 Ga0070660_101176766 3300005339 Bacteria 650
12 Ga0070689_100226577 3300005340 Bacteria 1535
13 Ga0070661_100052956 3300005344 Bacteria 2970
14 Ga0070692_10195527 3300005345 Bacteria 1181
15 Ga0070668_100029670 3300005347 Unclassified 4155
16 Ga0070669_100019194 3300005353 Bacteria 4885
17 Ga0070669_100104600 3300005353 Unclassified 2140
18 Ga0070675_100009977 3300005354 Bacteria 7406
19 Ga0070675_100032229 3300005354 Unclassified 4240
20 Ga0070671_100486613 3300005355 Unclassified 1060
21 Ga0070671_100793196 3300005355 Bacteria 824
22 Ga0070674_100047538 3300005356 Bacteria 2941
23 Ga0070673_100183029 3300005364 Bacteria 1794
24 Ga0070673_100261455 3300005364 Bacteria 1512
25 Ga0070688_100010214 3300005365 Unclassified 5169
26 Ga0070659_100888202 3300005366 Unclassified 778
27 Ga0070659_101168789 3300005366 Bacteria 680
28 Ga0070705_100179026 3300005440 Bacteria 1434
29 Ga0070708_100678434 3300005445 Bacteria 970
30 Ga0070662_100363313 3300005457 Bacteria 1188
31 Ga0070662_100857337 3300005457 Bacteria 774
32 Ga0070662_101178380 3300005457 Unclassified 658
33 Ga0070681_10793129 3300005458 Unclassified 864
34 Ga0068867_100078514 3300005459 Bacteria 2483
35 Ga0068867_100166354 3300005459 Bacteria 1743
36 Ga0070685_10123610 3300005466 Bacteria 1610
37 Ga0070698_100090458 3300005471 Bacteria 3044
38 Ga0070698_100900027 3300005471 Unclassified 830
39 Ga0070699_100010264 3300005518 Bacteria 8099
40 Ga0070684_100019818 3300005535 Bacteria 5571
41 Ga0070684_100086853 3300005535 Bacteria 2777
42 Ga0068853_100132571 3300005539 Bacteria 2232
43 Ga0068853_100182837 3300005539 Bacteria 1902
44 Ga0070672_100055542 3300005543 Bacteria 3102
45 Ga0070672_100074137 3300005543 Unclassified 2714
46 Ga0070704_100122255 3300005549 Bacteria 2002
47 Ga0070664_100032023 3300005564 Bacteria 4397
48 Ga0070664_100092629 3300005564 Bacteria 2617
49 Ga0070664_100404449 3300005564 Bacteria 1249
50 Ga0070664_100751654 3300005564 Bacteria 910
51 Ga0068857_100302888 3300005577 Bacteria 1474
52 Ga0068857_100549148 3300005577 Unclassified 1088
53 Ga0068854_100060818 3300005578 Bacteria 2734
54 Ga0070702_100198574 3300005615 Bacteria 1326
55 Ga0068852_101300178 3300005616 Bacteria 749
56 Ga0068859_100019516 3300005617 Bacteria 6810
57 Ga0068864_100087038 3300005618 Bacteria 2750
58 Ga0068864_100354535 3300005618 Bacteria 1385
59 Ga0068864_100598844 3300005618 Unclassified 1069
60 Ga0068861_100181424 3300005719 Unclassified 1753
61 Ga0068851_10260677 3300005834 Bacteria 986
62 Ga0068863_100376023 3300005841 Bacteria 1387
63 Ga0068863_100714142 3300005841 Bacteria 997
64 Ga0068858_100101532 3300005842 Unclassified 2683
65 Ga0068858_100650986 3300005842 Bacteria 1024
66 Ga0068860_100030487 3300005843 Bacteria 5187
67 Ga0068860_100437269 3300005843 Bacteria 1299
68 Ga0068862_100153600 3300005844 Bacteria 2050
69 Ga0068862_100313905 3300005844 Bacteria 1445
70 Ga0068862_100867921 3300005844 Bacteria 885
71 Ga0097621_100316434 3300006237 Bacteria 1382
72 Ga0068871_100512607 3300006358 Bacteria 1082
73 Ga0075428_100643918 3300006844 Bacteria 1130
74 Ga0075431_100212346 3300006847 Bacteria 1976
75 Ga0068865_100121047 3300006881 Bacteria 1946
76 Ga0068865_100201072 3300006881 Bacteria 1547
77 Ga0097620_100019516 3300006931 Bacteria 6810
78 Ga0075435_100949818 3300007076 Unclassified 750
79 Ga0105240_10079994 3300009093 Bacteria 4020
80 Ga0111539_10300173 3300009094 Bacteria 1869
81 Ga0111539_11053030 3300009094 Bacteria 946
82 Ga0105247_10489618 3300009101 Unclassified 894
83 Ga0114129_10011555 3300009147 Bacteria 12573
84 Ga0114129_10011954 3300009147 Bacteria 12348
85 Ga0105242_10703419 3300009176 Unclassified 989
86 Ga0105248_10039510 3300009177 Bacteria 5286
87 Ga0105248_10824604 3300009177 Bacteria 1047
88 Ga0105249_10131891 3300009553 Bacteria 2386
89 Ga0105246_10257709 3300011119 Bacteria 1388
90 Ga0157373_10218740 3300013100 Bacteria 1344
91 Ga0157370_10827535 3300013104 Unclassified 842
92 Ga0157369_10335279 3300013105 Bacteria 1571
93 Ga0157374_11578742 3300013296 Unclassified 680
94 Ga0163162_11305109 3300013306 Bacteria 825
95 Ga0157372_10133905 3300013307 Bacteria 2853
96 Ga0157372_10989246 3300013307 Bacteria 974
97 Ga0157375_10012513 3300013308 Bacteria 7530
98 Ga0157375_10182354 3300013308 Unclassified 2251
99 Ga0157375_10626711 3300013308 Bacteria 1233
100 Ga0157380_10042576 3300014326 Bacteria 3550
101 Ga0157379_10453440 3300014968 Bacteria 1184
102 Ga0207642_10095269 3300025899 Bacteria 1481
103 Ga0207705_10014545 3300025909 Bacteria 5661
104 Ga0207705_10362041 3300025909 Bacteria 1119
105 Ga0207707_11067095 3300025912 Unclassified 660
106 Ga0207695_10083374 3300025913 Bacteria 3229
107 Ga0207657_10095506 3300025919 Unclassified 2473
108 Ga0207649_10120343 3300025920 Bacteria 1769
109 Ga0207649_10325299 3300025920 Unclassified 1131
110 Ga0207681_10008858 3300025923 Bacteria 6148
111 Ga0207681_10019315 3300025923 Bacteria 4305
112 Ga0207650_10010398 3300025925 Bacteria 6380
113 Ga0207650_10461364 3300025925 Unclassified 1058
114 Ga0207659_10014166 3300025926 Bacteria 5134
115 Ga0207659_10042853 3300025926 Bacteria 3175
116 Ga0207690_10397460 3300025932 Bacteria 1098
117 Ga0207706_10121291 3300025933 Bacteria 2299
118 Ga0207706_10477068 3300025933 Bacteria 1078
119 Ga0207706_10607528 3300025933 Bacteria 939
120 Ga0207686_10338778 3300025934 Unclassified 1129
121 Ga0207670_10072147 3300025936 Bacteria 2389
122 Ga0207704_10205674 3300025938 Bacteria 1444
123 Ga0207704_10245811 3300025938 Bacteria 1340
124 Ga0207704_10393281 3300025938 Bacteria 1092
125 Ga0207691_10027178 3300025940 Bacteria 5367
126 Ga0207691_10053099 3300025940 Unclassified 3701
127 Ga0207711_10063729 3300025941 Bacteria 3183
128 Ga0207711_10226575 3300025941 Bacteria 1711
129 Ga0207689_10057256 3300025942 Bacteria 3207
130 Ga0207661_10259518 3300025944 Bacteria 1547
131 Ga0207679_10009941 3300025945 Bacteria 6110
132 Ga0207679_10020672 3300025945 Bacteria 4447
133 Ga0207679_10581762 3300025945 Bacteria 1007
134 Ga0207651_10104360 3300025960 Bacteria 2112
135 Ga0207712_10084670 3300025961 Bacteria 2317
136 Ga0207668_10072949 3300025972 Unclassified 2458
137 Ga0207640_10153662 3300025981 Bacteria 1694
138 Ga0207658_10139165 3300025986 Bacteria 1962
139 Ga0207677_10099967 3300026023 Unclassified 2132
140 Ga0207703_10313574 3300026035 Bacteria 1434
141 Ga0207639_10506970 3300026041 Bacteria 1103
142 Ga0207678_10185560 3300026067 Bacteria 1776
143 Ga0207641_10818726 3300026088 Bacteria 922
144 Ga0207648_10037684 3300026089 Unclassified 4259
145 Ga0207648_10353251 3300026089 Bacteria 1325
146 Ga0207676_10159254 3300026095 Bacteria 1954
147 Ga0207674_10264810 3300026116 Bacteria 1666
148 Ga0207674_10295854 3300026116 Bacteria 1567
149 Ga0207675_100173097 3300026118 Unclassified 2064
150 Ga0207698_10129159 3300026142 Bacteria 2156
151 Ga0207698_11916703 3300026142 Bacteria 607
152 Ga0207428_10008718 3300027907 Bacteria 9152
153 Ga0268265_10383221 3300028380 Bacteria 1294
154 Ga0268264_10102640 3300028381 Bacteria 2489
155 Ga0265337_1010473 3300028556 Bacteria 3246
156 Ga0265337_1013132 3300028556 Unclassified 2793
157 Ga0265318_10151677 3300028577 Bacteria 850
158 Ga0265336_10006328 3300028666 Bacteria 4277
159 Ga0265338_10050536 3300028800 Bacteria 3757
160 Ga0265338_10188645 3300028800 Bacteria 1565
161 Ga0265320_10000316 3300031240 Bacteria 39398
162 Ga0265320_10015037 3300031240 Unclassified 4383
163 Ga0265331_10455144 3300031250 Bacteria 575
164 Ga0265316_10004290 3300031344 Bacteria 14239
165 Ga0307408_100265084 3300031548 Unclassified 1424
166 Ga0265314_10012620 3300031711 Bacteria 6879
167 Ga0307410_10627627 3300031852 Unclassified 899
168 Ga0307416_100958416 3300032002 Unclassified 958
169 Ga0373943_0052011 3300035170 Unclassified 2019
170 Ga0373943_0458461 3300035170 Unclassified 741
171 Ga0373955_0216832 3300035172 Unclassified 1142
172 Ga0373931_0130576 3300035691 Bacteria 1446
173 Ga0373935_0152090 3300035692 Unclassified 1571
174 Ga0373935_0544271 3300035692 Unclassified 846
175 Ga0373937_0151917 3300036401 Bacteria 2169
176 Ga0373937_0374855 3300036401 Unclassified 1349
177 Ga0395905_0209986 3300037471 Bacteria 1824
178 Ga0439461_0127077 3300041410 Bacteria 642
179 Ga0439435_0000969 3300042436 Bacteria 5006
180 Ga0451577_0672727 3300042876 Bacteria 938
181 Ga0451576_0064445 3300045051 Bacteria 3817
182 Ga0451576_0720804 3300045051 Bacteria 1048
183 Ga0495592_0146188 3300046454 Unclassified 1639
184 Ga0495629_0166665 3300046459 Bacteria 1530
185 Ga0495641_0036699 3300046461 Bacteria 2302
186 Ga0495580_0072476 3300046472 Bacteria 2405
187 Ga0495580_0181525 3300046472 Unclassified 1453
188 Ga0495582_0027757 3300046473 Bacteria 3104
189 Ga0495582_0028908 3300046473 Bacteria 3043
190 Ga0495639_0010423 3300046475 Bacteria 4004
191 Ga0495639_0016632 3300046475 Bacteria 3194
192 Ga0495639_0265421 3300046475 Unclassified 851
193 Ga0495662_0013210 3300046476 Bacteria 4021
194 Ga0495664_0026536 3300046477 Bacteria 3373
195 Ga0495594_0022443 3300046499 Bacteria 3376
196 Ga0495618_0003814 3300046514 Bacteria 9329
197 Ga0495628_0101372 3300046516 Bacteria 2221
198 Ga0495630_0004028 3300046517 Bacteria 10283
199 Ga0495666_0019776 3300046526 Bacteria 3338
200 Ga0495652_0340433 3300046529 Bacteria 1078
201 Ga0495665_0179518 3300046531 Unclassified 1100
202 Ga0495665_0246994 3300046531 Unclassified 919
203 Ga0495640_0014646 3300046533 Bacteria 5924
204 Ga0495586_0045351 3300046535 Bacteria 2369
205 Ga0495645_0315983 3300046543 Unclassified 1016
206 Ga0495667_0090497 3300046559 Bacteria 1982
207 Ga0495634_0050023 3300046642 Bacteria 2808
208 Ga0495634_0214638 3300046642 Bacteria 1190
209 Ga0495588_0184667 3300046674 Unclassified 1102
210 Ga0495647_0008296 3300046681 Bacteria 3491
211 Ga0495658_0001544 3300046683 Bacteria 12048
212 Ga0495613_0084175 3300046689 Bacteria 2309
213 Ga0495600_0531185 3300046809 Unclassified 720
214 Ga0495674_0020444 3300047319 Bacteria 6127
215 Ga0495676_0278806 3300047321 Unclassified 1132
216 Ga0495680_0035305 3300047322 Bacteria 4028
217 Ga0495614_0019713 3300048089 Unclassified 2918
218 Ga0496104_0295272 3300048907 Unclassified 1533
219 Ga0496108_0696988 3300048911 Bacteria 881
220 Ga0496112_0928773 3300048915 Bacteria 791
221 Ga0496113_0425732 3300048916 Bacteria 1066
222 Ga0496115_0725749 3300048918 Unclassified 779
223 Ga0501040_0483856 3300049576 Unclassified 892
224 Ga0501071_0698651 3300049587 Bacteria 781
225 Ga0501072_0139648 3300049588 Bacteria 1931
226 Ga0501079_0144452 3300049741 Bacteria 1854
227 Ga0501081_0344125 3300049743 Bacteria 1098
228 nmdc:mga05p37_22830_c2 3300050507 Unclassified 2706
229 nmdc:mga05p37_35595_c1 3300050507 Bacteria 5635
230 nmdc:mga0rr50_321526_c1 3300050513 Bacteria 1297
231 Ga0495619_0011705 3300053085 Bacteria 5527
232 Ga0501084_0119767 3300054114 Bacteria 2213
233 Ga0501082_1235967 3300060353 Unclassified 653
234 Ga0070684_100869534
235 Ga0070658_10221966
236 Ga0070658_10326800
237 Ga0070658_10327456
238 Ga0070676_10010209
239 Ga0070683_100364398
240 Ga0070670_100002088
241 Ga0068869_100156771
242 Ga0070680_100390139
243 Ga0070682_100558891
244 Ga0070660_101176766
245 Ga0070689_100226577
246 Ga0070661_100052956
247 Ga0070692_10195527
248 Ga0070668_100029670
249 Ga0070669_100019194
250 Ga0070669_100104600
251 Ga0070675_100009977
252 Ga0070675_100032229
253 Ga0070671_100486613
254 Ga0070671_100793196
255 Ga0070674_100047538
256 Ga0070673_100183029
257 Ga0070673_100261455
258 Ga0070688_100010214
259 Ga0070659_100888202
260 Ga0070659_101168789
261 Ga0070705_100179026
262 Ga0070708_100678434
263 Ga0070662_100363313
264 Ga0070662_100857337
265 Ga0070662_101178380
266 Ga0070681_10793129
267 Ga0068867_100078514
268 Ga0068867_100166354
269 Ga0070685_10123610
270 Ga0070698_100090458
271 Ga0070698_100900027
272 Ga0070699_100010264
273 Ga0070684_100019818
274 Ga0070684_100086853
275 Ga0068853_100132571
276 Ga0068853_100182837
277 Ga0070672_100055542
278 Ga0070672_100074137
279 Ga0070704_100122255
280 Ga0070664_100032023
281 Ga0070664_100092629
282 Ga0070664_100404449
283 Ga0070664_100751654
284 Ga0068857_100302888
285 Ga0068857_100549148
286 Ga0068854_100060818
287 Ga0070702_100198574
288 Ga0068852_101300178
289 Ga0068859_100019516
290 Ga0068864_100087038
291 Ga0068864_100354535
292 Ga0068864_100598844
293 Ga0068861_100181424
294 Ga0068851_10260677
295 Ga0068863_100376023
296 Ga0068863_100714142
297 Ga0068858_100101532
298 Ga0068858_100650986
299 Ga0068860_100030487
300 Ga0068860_100437269
301 Ga0068862_100153600
302 Ga0068862_100313905
303 Ga0068862_100867921
304 Ga0097621_100316434
305 Ga0068871_100512607
306 Ga0075428_100643918
307 Ga0075431_100212346
308 Ga0068865_100121047
309 Ga0068865_100201072
310 Ga0097620_100019516
311 Ga0075435_100949818
312 Ga0105240_10079994
313 Ga0111539_10300173
314 Ga0111539_11053030
315 Ga0105247_10489618
316 Ga0114129_10011555
317 Ga0114129_10011954
318 Ga0105242_10703419
319 Ga0105248_10039510
320 Ga0105248_10824604
321 Ga0105249_10131891
322 Ga0105246_10257709
323 Ga0157373_10218740
324 Ga0157370_10827535
325 Ga0157369_10335279
326 Ga0157374_11578742
327 Ga0163162_11305109
328 Ga0157372_10133905
329 Ga0157372_10989246
330 Ga0157375_10012513
331 Ga0157375_10182354
332 Ga0157375_10626711
333 Ga0157380_10042576
334 Ga0157379_10453440
335 Ga0207642_10095269
336 Ga0207705_10014545
337 Ga0207705_10362041
338 Ga0207707_11067095
339 Ga0207695_10083374
340 Ga0207657_10095506
341 Ga0207649_10120343
342 Ga0207649_10325299
343 Ga0207681_10008858
344 Ga0207681_10019315
345 Ga0207650_10010398
346 Ga0207650_10461364
347 Ga0207659_10014166
348 Ga0207659_10042853
349 Ga0207690_10397460
350 Ga0207706_10121291
351 Ga0207706_10477068
352 Ga0207706_10607528
353 Ga0207686_10338778
354 Ga0207670_10072147
355 Ga0207704_10205674
356 Ga0207704_10245811
357 Ga0207704_10393281
358 Ga0207691_10027178
359 Ga0207691_10053099
360 Ga0207711_10063729
361 Ga0207711_10226575
362 Ga0207689_10057256
363 Ga0207661_10259518
364 Ga0207679_10009941
365 Ga0207679_10020672
366 Ga0207679_10581762
367 Ga0207651_10104360
368 Ga0207712_10084670
369 Ga0207668_10072949
370 Ga0207640_10153662
371 Ga0207658_10139165
372 Ga0207677_10099967
373 Ga0207703_10313574
374 Ga0207639_10506970
375 Ga0207678_10185560
376 Ga0207641_10818726
377 Ga0207648_10037684
378 Ga0207648_10353251
379 Ga0207676_10159254
380 Ga0207674_10264810
381 Ga0207674_10295854
382 Ga0207675_100173097
383 Ga0207698_10129159
384 Ga0207698_11916703
385 Ga0207428_10008718
386 Ga0268265_10383221
387 Ga0268264_10102640
388 Ga0265337_1010473
389 Ga0265337_1013132
390 Ga0265318_10151677
391 Ga0265336_10006328
392 Ga0265338_10050536
393 Ga0265338_10188645
394 Ga0265320_10000316
395 Ga0265320_10015037
396 Ga0265331_10455144
397 Ga0265316_10004290
398 Ga0307408_100265084
399 Ga0265314_10012620
400 Ga0307410_10627627
401 Ga0307416_100958416
402 Ga0373943_0052011
403 Ga0373943_0458461
404 Ga0373955_0216832
405 Ga0373931_0130576
406 Ga0373935_0152090
407 Ga0373935_0544271
408 Ga0373937_0151917
409 Ga0373937_0374855
410 Ga0395905_0209986
411 Ga0439461_0127077
412 Ga0439435_0000969
413 Ga0451577_0672727
414 Ga0451576_0064445
415 Ga0451576_0720804
416 Ga0495592_0146188
417 Ga0495629_0166665
418 Ga0495641_0036699
419 Ga0495580_0072476
420 Ga0495580_0181525
421 Ga0495582_0027757
422 Ga0495582_0028908
423 Ga0495639_0010423
424 Ga0495639_0016632
425 Ga0495639_0265421
426 Ga0495662_0013210
427 Ga0495664_0026536
428 Ga0495594_0022443
429 Ga0495618_0003814
430 Ga0495628_0101372
431 Ga0495630_0004028
432 Ga0495666_0019776
433 Ga0495652_0340433
434 Ga0495665_0179518
435 Ga0495665_0246994
436 Ga0495640_0014646
437 Ga0495586_0045351
438 Ga0495645_0315983
439 Ga0495667_0090497
440 Ga0495634_0050023
441 Ga0495634_0214638
442 Ga0495588_0184667
443 Ga0495647_0008296
444 Ga0495658_0001544
445 Ga0495613_0084175
446 Ga0495600_0531185
447 Ga0495674_0020444
448 Ga0495676_0278806
449 Ga0495680_0035305
450 Ga0495614_0019713
451 Ga0496104_0295272
452 Ga0496108_0696988
453 Ga0496112_0928773
454 Ga0496113_0425732
455 Ga0496115_0725749
456 Ga0501040_0483856
457 Ga0501071_0698651
458 Ga0501072_0139648
459 Ga0501079_0144452
460 Ga0501081_0344125
461 nmdc:mga05p37_22830_c2
462 nmdc:mga05p37_35595_c1
463 nmdc:mga0rr50_321526_c1
464 Ga0495619_0011705
465 Ga0501084_0119767
466 Ga0501082_1235967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

152

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

84

173

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

57

154

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8805 124 165
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.8802 124 165
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.8774 124 165
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.871 124 165
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.8426 54 165
ID Description Score Start End Superfamily
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8802 124 165 3.30.572.10
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8694 106 166 3.40.630.30
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8651 51 154 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.855 51 153 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8522 86 165 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1Q7HBN4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9882 1 165 GO:0016747
AF-A0A1Q7HBN4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9823 1 165 GO:0016747
AF-A0A1V9EL79-F1-model_v4 N-acetyltransferase domain-containing protein 0.9809 3 166 GO:0016747
AF-A0A4Q3V6J3-F1-model_v4 GNAT family N-acetyltransferase 0.9791 1 166 GO:0016747
AF-A0A4Q3V6J3-F1-model_v4 GNAT family N-acetyltransferase 0.9733 1 166 GO:0016747

Map