F345847

General Info

Members Datasets Scaffolds Average Seq Length
233 157 466 158

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100798486|Ga0068867_1007984862
Length 180
Sequence MKQLPSSSGKQRFFSKIMTDILTGRRVQESISEYSEIALPNDANTLGNLLGGRVMHLVDLAGAIAASRHCRCVVVTASVDHMTFLHPVHIGELLTLKSSVNRVFRTSMEVGVKIFVENLREGVVRHTSSAYLTFVALDSKHNRIPIPPVIPETDEEKRRFEEAGVRREYRLAQKKRSLKP

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.43
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 33.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100798486 3300005459 Bacteria 841
2 Ga0065712_10082233 3300005290 Bacteria 2934
3 Ga0065715_10111001 3300005293 Bacteria 2593
4 Ga0070658_10040082 3300005327 Bacteria 3779
5 Ga0070683_100000013 3300005329 Bacteria 241235
6 Ga0070683_100064174 3300005329 Bacteria 3418
7 Ga0070683_100066794 3300005329 Unclassified 3349
8 Ga0070683_100866364 3300005329 Bacteria 866
9 Ga0070682_100035097 3300005337 Bacteria 3059
10 Ga0070682_100395994 3300005337 Bacteria 1043
11 Ga0070682_100457698 3300005337 Unclassified 979
12 Ga0070689_100105590 3300005340 Bacteria 2234
13 Ga0070669_100064435 3300005353 Bacteria 2699
14 Ga0070675_101255376 3300005354 Unclassified 682
15 Ga0070671_100868340 3300005355 Unclassified 787
16 Ga0070673_100033816 3300005364 Unclassified 3863
17 Ga0070688_100369895 3300005365 Bacteria 1054
18 Ga0070659_100023590 3300005366 Bacteria 4710
19 Ga0070659_101434822 3300005366 Bacteria 614
20 Ga0070709_10349387 3300005434 Unclassified 1092
21 Ga0070709_10357883 3300005434 Bacteria 1080
22 Ga0070713_100005758 3300005436 Bacteria 8511
23 Ga0070713_100073702 3300005436 Unclassified 2890
24 Ga0070711_100169223 3300005439 Unclassified 1664
25 Ga0070711_100716873 3300005439 Bacteria 843
26 Ga0070708_100027695 3300005445 Bacteria 4866
27 Ga0070708_101179876 3300005445 Bacteria 716
28 Ga0070678_101226453 3300005456 Unclassified 696
29 Ga0070681_10087435 3300005458 Bacteria 3070
30 Ga0070681_10236348 3300005458 Bacteria 1741
31 Ga0068867_100817850 3300005459 Bacteria 832
32 Ga0070706_100413586 3300005467 Bacteria 1255
33 Ga0070707_100148724 3300005468 Unclassified 2280
34 Ga0070698_100139568 3300005471 Bacteria 2376
35 Ga0070699_100342246 3300005518 Bacteria 1346
36 Ga0070684_100000015 3300005535 Bacteria 143515
37 Ga0070684_101011514 3300005535 Bacteria 780
38 Ga0070697_100231715 3300005536 Bacteria 1575
39 Ga0068853_100016551 3300005539 Bacteria 6072
40 Ga0070695_100335797 3300005545 Bacteria 1128
41 Ga0070665_100290691 3300005548 Unclassified 1637
42 Ga0068855_100132428 3300005563 Bacteria 2846
43 Ga0068855_100185936 3300005563 Bacteria 2346
44 Ga0070664_100960869 3300005564 Unclassified 802
45 Ga0068856_101589240 3300005614 Unclassified 667
46 Ga0068852_100046956 3300005616 Bacteria 3682
47 Ga0068859_100794542 3300005617 Unclassified 1034
48 Ga0068864_100050974 3300005618 Unclassified 3564
49 Ga0068861_100576188 3300005719 Bacteria 1029
50 Ga0068851_10237967 3300005834 Bacteria 1028
51 Ga0068863_100983649 3300005841 Unclassified 846
52 Ga0081540_1048265 3300005983 Bacteria 2133
53 Ga0081540_1158497 3300005983 Unclassified 882
54 Ga0070717_10172837 3300006028 Bacteria 1880
55 Ga0097621_100731452 3300006237 Bacteria 913
56 Ga0097621_101162057 3300006237 Bacteria 726
57 Ga0068871_100616679 3300006358 Bacteria 988
58 Ga0075430_100131914 3300006846 Bacteria 2082
59 Ga0075431_100338607 3300006847 Bacteria 1514
60 Ga0097620_100794629 3300006931 Unclassified 1034
61 Ga0105240_10001838 3300009093 Bacteria 35562
62 Ga0105240_10009832 3300009093 Bacteria 13501
63 Ga0105240_10013087 3300009093 Bacteria 11420
64 Ga0105240_10397350 3300009093 Bacteria 1553
65 Ga0105247_10506839 3300009101 Bacteria 880
66 Ga0105243_11567700 3300009148 Unclassified 684
67 Ga0105241_10186357 3300009174 Unclassified 1725
68 Ga0105241_10958851 3300009174 Unclassified 798
69 Ga0105248_10050658 3300009177 Bacteria 4658
70 Ga0105248_10142431 3300009177 Bacteria 2704
71 Ga0105248_10300340 3300009177 Unclassified 1808
72 Ga0105248_10611099 3300009177 Unclassified 1230
73 Ga0105248_11025733 3300009177 Bacteria 932
74 Ga0105237_10007230 3300009545 Bacteria 12182
75 Ga0105237_10010221 3300009545 Bacteria 9999
76 Ga0105237_10035894 3300009545 Bacteria 5015
77 Ga0105237_10273235 3300009545 Bacteria 1693
78 Ga0105238_10105269 3300009551 Bacteria 2803
79 Ga0105238_10270707 3300009551 Bacteria 1679
80 Ga0105239_10038014 3300010375 Bacteria 5275
81 Ga0105246_10937011 3300011119 Unclassified 779
82 Ga0157373_10108611 3300013100 Bacteria 1951
83 Ga0157371_10035841 3300013102 Bacteria 3554
84 Ga0157369_10096456 3300013105 Bacteria 3155
85 Ga0157369_10192700 3300013105 Bacteria 2141
86 Ga0157369_10546282 3300013105 Unclassified 1198
87 Ga0157374_10027928 3300013296 Bacteria 5094
88 Ga0157378_10099706 3300013297 Bacteria 2650
89 Ga0157378_10190405 3300013297 Bacteria 1934
90 Ga0157378_10738167 3300013297 Bacteria 1007
91 Ga0163162_10717217 3300013306 Unclassified 1121
92 Ga0157372_11747101 3300013307 Unclassified 716
93 Ga0163163_10007638 3300014325 Bacteria 9550
94 Ga0163163_11007496 3300014325 Unclassified 896
95 Ga0157379_10800994 3300014968 Unclassified 889
96 Ga0157376_10251154 3300014969 Unclassified 1652
97 Ga0157376_10947884 3300014969 Unclassified 881
98 Ga0157376_11886394 3300014969 Bacteria 634
99 Ga0182006_1017855 3300015261 Bacteria 3007
100 Ga0182007_10010243 3300015262 Bacteria 3717
101 Ga0182005_1019104 3300015265 Unclassified 1891
102 Ga0197907_10672398 3300020069 Bacteria 913
103 Ga0213875_10002009 3300021388 Bacteria 12558
104 Ga0213875_10009966 3300021388 Bacteria 4783
105 Ga0207680_10274118 3300025903 Unclassified 1171
106 Ga0207699_10645645 3300025906 Unclassified 773
107 Ga0207684_10049732 3300025910 Unclassified 3556
108 Ga0207707_10254410 3300025912 Bacteria 1525
109 Ga0207695_10008092 3300025913 Bacteria 13224
110 Ga0207695_10010645 3300025913 Bacteria 11237
111 Ga0207695_10019011 3300025913 Bacteria 7923
112 Ga0207671_10012182 3300025914 Bacteria 6936
113 Ga0207671_10021258 3300025914 Bacteria 4926
114 Ga0207693_10061738 3300025915 Bacteria 2935
115 Ga0207663_10006110 3300025916 Bacteria 6129
116 Ga0207663_10459507 3300025916 Unclassified 983
117 Ga0207646_10661869 3300025922 Bacteria 935
118 Ga0207650_10599289 3300025925 Unclassified 926
119 Ga0207659_10751179 3300025926 Unclassified 837
120 Ga0207700_10002422 3300025928 Bacteria 10716
121 Ga0207700_10184747 3300025928 Unclassified 1748
122 Ga0207664_10003489 3300025929 Bacteria 10492
123 Ga0207670_10080263 3300025936 Bacteria 2280
124 Ga0207670_11087358 3300025936 Unclassified 675
125 Ga0207691_10849824 3300025940 Bacteria 765
126 Ga0207711_10201130 3300025941 Bacteria 1818
127 Ga0207711_10207969 3300025941 Unclassified 1787
128 Ga0207711_10533421 3300025941 Unclassified 1095
129 Ga0207689_10477797 3300025942 Unclassified 1043
130 Ga0207661_10000018 3300025944 Bacteria 242506
131 Ga0207661_10270775 3300025944 Bacteria 1515
132 Ga0207667_10185024 3300025949 Bacteria 2139
133 Ga0207667_10197818 3300025949 Bacteria 2062
134 Ga0207667_10585316 3300025949 Bacteria 1126
135 Ga0207651_10133928 3300025960 Bacteria 1902
136 Ga0207677_10152873 3300026023 Bacteria 1783
137 Ga0207641_10340617 3300026088 Unclassified 1427
138 Ga0207676_10153392 3300026095 Unclassified 1987
139 Ga0207683_11207378 3300026121 Unclassified 701
140 Ga0207683_11513598 3300026121 Unclassified 619
141 Ga0268266_10302015 3300028379 Bacteria 1494
142 Ga0265318_10084672 3300028577 Bacteria 1169
143 Ga0265338_10832744 3300028800 Bacteria 631
144 Ga0265770_1097706 3300030878 Unclassified 594
145 Ga0265330_10067374 3300031235 Unclassified 1551
146 Ga0265320_10013523 3300031240 Bacteria 4690
147 Ga0265325_10030271 3300031241 Bacteria 2904
148 Ga0265325_10121895 3300031241 Bacteria 1256
149 Ga0265329_10064394 3300031242 Bacteria 1160
150 Ga0265339_10120002 3300031249 Bacteria 1352
151 Ga0265316_10005424 3300031344 Bacteria 12393
152 Ga0265316_10120191 3300031344 Bacteria 1984
153 Ga0265316_10279419 3300031344 Bacteria 1220
154 Ga0265316_10368764 3300031344 Bacteria 1037
155 Ga0265342_10025355 3300031712 Bacteria 3730
156 Ga0265342_10325976 3300031712 Bacteria 804
157 Ga0373930_0214050 3300034816 Unclassified 506
158 Ga0373938_0238617 3300034957 Unclassified 516
159 Ga0373923_0038831 3300035111 Unclassified 1953
160 Ga0373953_0088818 3300035117 Unclassified 1291
161 Ga0373954_0069844 3300035118 Bacteria 1668
162 Ga0373954_0190174 3300035118 Bacteria 1008
163 Ga0373954_0349055 3300035118 Bacteria 731
164 Ga0373960_0326635 3300035121 Unclassified 576
165 Ga0373943_0068747 3300035170 Bacteria 1789
166 Ga0373946_0265900 3300035171 Unclassified 840
167 Ga0373955_0453600 3300035172 Unclassified 782
168 Ga0373935_0052598 3300035692 Unclassified 2589
169 Ga0373935_0376358 3300035692 Unclassified 1016
170 Ga0373927_0003188 3300035695 Bacteria 11821
171 Ga0373927_0171733 3300035695 Bacteria 1421
172 Ga0373947_0065538 3300035725 Bacteria 2216
173 Ga0373947_0285570 3300035725 Bacteria 1098
174 Ga0373947_0606412 3300035725 Bacteria 746
175 Ga0373937_0017838 3300036401 Bacteria 6334
176 Ga0373925_0048871 3300037068 Bacteria 3153
177 Ga0373925_0101803 3300037068 Bacteria 2209
178 Ga0373925_0181998 3300037068 Unclassified 1664
179 Ga0373925_0317081 3300037068 Unclassified 1261
180 Ga0395905_0228369 3300037471 Bacteria 1741
181 Ga0436364_0961638 3300037853 Bacteria 4472
182 Ga0436364_1155207 3300037853 Bacteria 1819
183 Ga0451577_1592094 3300042876 Unclassified 576
184 Ga0453683_0001499 3300044673 Bacteria 19964
185 Ga0453683_0111196 3300044673 Bacteria 1723
186 Ga0453684_0259850 3300044712 Unclassified 1990
187 Ga0453684_0426004 3300044712 Bacteria 1481
188 Ga0453684_0548718 3300044712 Bacteria 1273
189 Ga0453684_0665303 3300044712 Unclassified 1135
190 Ga0451576_0440935 3300045051 Unclassified 1367
191 Ga0451576_1870147 3300045051 Unclassified 620
192 Ga0495580_0008109 3300046472 Bacteria 8377
193 Ga0495580_0050525 3300046472 Bacteria 2940
194 Ga0495580_0126869 3300046472 Bacteria 1771
195 Ga0495580_0394899 3300046472 Unclassified 933
196 Ga0495580_0735307 3300046472 Bacteria 644
197 Ga0495582_0294379 3300046473 Bacteria 933
198 Ga0495639_0241314 3300046475 Bacteria 892
199 Ga0495662_0158699 3300046476 Bacteria 1114
200 Ga0495594_0565138 3300046499 Unclassified 645
201 Ga0495630_0173381 3300046517 Bacteria 1644
202 Ga0495666_0304138 3300046526 Unclassified 721
203 Ga0495652_0530389 3300046529 Bacteria 812
204 Ga0495665_0107220 3300046531 Bacteria 1465
205 Ga0495665_0154215 3300046531 Bacteria 1198
206 Ga0495640_0344886 3300046533 Unclassified 920
207 Ga0495587_0201356 3300046536 Unclassified 1126
208 Ga0495645_0037312 3300046543 Unclassified 3542
209 Ga0495667_0048938 3300046559 Unclassified 2791
210 Ga0495599_0251361 3300046678 Unclassified 1076
211 Ga0495623_0027717 3300046679 Bacteria 3647
212 Ga0495581_0130440 3300047315 Bacteria 1465
213 Ga0495604_0049752 3300047317 Bacteria 3255
214 Ga0495674_0257239 3300047319 Bacteria 1435
215 Ga0495674_0727499 3300047319 Unclassified 777
216 Ga0495674_0891299 3300047319 Bacteria 687
217 Ga0495680_0558235 3300047322 Unclassified 771
218 Ga0495684_0107339 3300047471 Bacteria 2109
219 Ga0495684_0149076 3300047471 Bacteria 1750
220 Ga0495602_0241503 3300048088 Bacteria 1351
221 Ga0496100_0065763 3300048903 Bacteria 2404
222 Ga0496102_0601729 3300048905 Bacteria 1022
223 Ga0496103_0725999 3300048906 Bacteria 629
224 Ga0496104_0749663 3300048907 Bacteria 883
225 Ga0496106_0132676 3300048909 Unclassified 1954
226 Ga0496109_0080756 3300048912 Bacteria 2996
227 Ga0496110_1370748 3300048913 Unclassified 617
228 Ga0496115_0523668 3300048918 Bacteria 950
229 Ga0501034_0746709 3300049571 Bacteria 874
230 Ga0501076_0697853 3300049592 Unclassified 838
231 nmdc:mga0qj67_46369_c2 3300050509 Bacteria 2124
232 Ga0495595_0313926 3300053084 Bacteria 789
233 Ga0501082_0002361 3300060353 Bacteria 16522
234 Ga0068867_100798486
235 Ga0065712_10082233
236 Ga0065715_10111001
237 Ga0070658_10040082
238 Ga0070683_100000013
239 Ga0070683_100064174
240 Ga0070683_100066794
241 Ga0070683_100866364
242 Ga0070682_100035097
243 Ga0070682_100395994
244 Ga0070682_100457698
245 Ga0070689_100105590
246 Ga0070669_100064435
247 Ga0070675_101255376
248 Ga0070671_100868340
249 Ga0070673_100033816
250 Ga0070688_100369895
251 Ga0070659_100023590
252 Ga0070659_101434822
253 Ga0070709_10349387
254 Ga0070709_10357883
255 Ga0070713_100005758
256 Ga0070713_100073702
257 Ga0070711_100169223
258 Ga0070711_100716873
259 Ga0070708_100027695
260 Ga0070708_101179876
261 Ga0070678_101226453
262 Ga0070681_10087435
263 Ga0070681_10236348
264 Ga0068867_100817850
265 Ga0070706_100413586
266 Ga0070707_100148724
267 Ga0070698_100139568
268 Ga0070699_100342246
269 Ga0070684_100000015
270 Ga0070684_101011514
271 Ga0070697_100231715
272 Ga0068853_100016551
273 Ga0070695_100335797
274 Ga0070665_100290691
275 Ga0068855_100132428
276 Ga0068855_100185936
277 Ga0070664_100960869
278 Ga0068856_101589240
279 Ga0068852_100046956
280 Ga0068859_100794542
281 Ga0068864_100050974
282 Ga0068861_100576188
283 Ga0068851_10237967
284 Ga0068863_100983649
285 Ga0081540_1048265
286 Ga0081540_1158497
287 Ga0070717_10172837
288 Ga0097621_100731452
289 Ga0097621_101162057
290 Ga0068871_100616679
291 Ga0075430_100131914
292 Ga0075431_100338607
293 Ga0097620_100794629
294 Ga0105240_10001838
295 Ga0105240_10009832
296 Ga0105240_10013087
297 Ga0105240_10397350
298 Ga0105247_10506839
299 Ga0105243_11567700
300 Ga0105241_10186357
301 Ga0105241_10958851
302 Ga0105248_10050658
303 Ga0105248_10142431
304 Ga0105248_10300340
305 Ga0105248_10611099
306 Ga0105248_11025733
307 Ga0105237_10007230
308 Ga0105237_10010221
309 Ga0105237_10035894
310 Ga0105237_10273235
311 Ga0105238_10105269
312 Ga0105238_10270707
313 Ga0105239_10038014
314 Ga0105246_10937011
315 Ga0157373_10108611
316 Ga0157371_10035841
317 Ga0157369_10096456
318 Ga0157369_10192700
319 Ga0157369_10546282
320 Ga0157374_10027928
321 Ga0157378_10099706
322 Ga0157378_10190405
323 Ga0157378_10738167
324 Ga0163162_10717217
325 Ga0157372_11747101
326 Ga0163163_10007638
327 Ga0163163_11007496
328 Ga0157379_10800994
329 Ga0157376_10251154
330 Ga0157376_10947884
331 Ga0157376_11886394
332 Ga0182006_1017855
333 Ga0182007_10010243
334 Ga0182005_1019104
335 Ga0197907_10672398
336 Ga0213875_10002009
337 Ga0213875_10009966
338 Ga0207680_10274118
339 Ga0207699_10645645
340 Ga0207684_10049732
341 Ga0207707_10254410
342 Ga0207695_10008092
343 Ga0207695_10010645
344 Ga0207695_10019011
345 Ga0207671_10012182
346 Ga0207671_10021258
347 Ga0207693_10061738
348 Ga0207663_10006110
349 Ga0207663_10459507
350 Ga0207646_10661869
351 Ga0207650_10599289
352 Ga0207659_10751179
353 Ga0207700_10002422
354 Ga0207700_10184747
355 Ga0207664_10003489
356 Ga0207670_10080263
357 Ga0207670_11087358
358 Ga0207691_10849824
359 Ga0207711_10201130
360 Ga0207711_10207969
361 Ga0207711_10533421
362 Ga0207689_10477797
363 Ga0207661_10000018
364 Ga0207661_10270775
365 Ga0207667_10185024
366 Ga0207667_10197818
367 Ga0207667_10585316
368 Ga0207651_10133928
369 Ga0207677_10152873
370 Ga0207641_10340617
371 Ga0207676_10153392
372 Ga0207683_11207378
373 Ga0207683_11513598
374 Ga0268266_10302015
375 Ga0265318_10084672
376 Ga0265338_10832744
377 Ga0265770_1097706
378 Ga0265330_10067374
379 Ga0265320_10013523
380 Ga0265325_10030271
381 Ga0265325_10121895
382 Ga0265329_10064394
383 Ga0265339_10120002
384 Ga0265316_10005424
385 Ga0265316_10120191
386 Ga0265316_10279419
387 Ga0265316_10368764
388 Ga0265342_10025355
389 Ga0265342_10325976
390 Ga0373930_0214050
391 Ga0373938_0238617
392 Ga0373923_0038831
393 Ga0373953_0088818
394 Ga0373954_0069844
395 Ga0373954_0190174
396 Ga0373954_0349055
397 Ga0373960_0326635
398 Ga0373943_0068747
399 Ga0373946_0265900
400 Ga0373955_0453600
401 Ga0373935_0052598
402 Ga0373935_0376358
403 Ga0373927_0003188
404 Ga0373927_0171733
405 Ga0373947_0065538
406 Ga0373947_0285570
407 Ga0373947_0606412
408 Ga0373937_0017838
409 Ga0373925_0048871
410 Ga0373925_0101803
411 Ga0373925_0181998
412 Ga0373925_0317081
413 Ga0395905_0228369
414 Ga0436364_0961638
415 Ga0436364_1155207
416 Ga0451577_1592094
417 Ga0453683_0001499
418 Ga0453683_0111196
419 Ga0453684_0259850
420 Ga0453684_0426004
421 Ga0453684_0548718
422 Ga0453684_0665303
423 Ga0451576_0440935
424 Ga0451576_1870147
425 Ga0495580_0008109
426 Ga0495580_0050525
427 Ga0495580_0126869
428 Ga0495580_0394899
429 Ga0495580_0735307
430 Ga0495582_0294379
431 Ga0495639_0241314
432 Ga0495662_0158699
433 Ga0495594_0565138
434 Ga0495630_0173381
435 Ga0495666_0304138
436 Ga0495652_0530389
437 Ga0495665_0107220
438 Ga0495665_0154215
439 Ga0495640_0344886
440 Ga0495587_0201356
441 Ga0495645_0037312
442 Ga0495667_0048938
443 Ga0495599_0251361
444 Ga0495623_0027717
445 Ga0495581_0130440
446 Ga0495604_0049752
447 Ga0495674_0257239
448 Ga0495674_0727499
449 Ga0495674_0891299
450 Ga0495680_0558235
451 Ga0495684_0107339
452 Ga0495684_0149076
453 Ga0495602_0241503
454 Ga0496100_0065763
455 Ga0496102_0601729
456 Ga0496103_0725999
457 Ga0496104_0749663
458 Ga0496106_0132676
459 Ga0496109_0080756
460 Ga0496110_1370748
461 Ga0496115_0523668
462 Ga0501034_0746709
463 Ga0501076_0697853
464 nmdc:mga0qj67_46369_c2
465 Ga0495595_0313926
466 Ga0501082_0002361

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

46

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq2-assembly1.cif.gz_A crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9581 2 141
2qq2-assembly1.cif.gz_C crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9561 2 141
3sps-assembly1.cif.gz_B crystal structure of apo-hexameric acyl-coa thioesterase 0.9546 2 141
2eis-assembly1.cif.gz_A x-ray structure of acyl-coa hydrolase-like protein, tt1379, from thermus thermophilus hb8 0.9505 1 117
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9478 2 136
ID Description Score Start End Superfamily
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9381 2 142 3.10.129.10
4mobA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9367 2 137 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9354 2 139 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9347 2 103 3.10.129.10
4mocA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.934 3 116 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A699USR9-F1-model_v4 Thioesterase superfamily protein 0.989 22 137 GO:0005737
GO:0006637
GO:0052816
AF-A0A4V1UNS3-F1-model_v4 Acyl-CoA thioesterase 0.9883 26 137 GO:0005829
GO:0006637
GO:0052816
AF-K4KIU7-F1-model_v4 Cytosolic long-chain acyl-CoA thioester hydrolase family protein 0.9874 16 141 GO:0005829
GO:0006637
GO:0052816
AF-A0A2W5Y592-F1-model_v4 Acyl-CoA thioesterase 0.9863 9 143 GO:0005829
GO:0006637
GO:0052816
AF-A0A2T2T4K9-F1-model_v4 Acyl-CoA thioesterase 0.9858 16 137 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Map