F345847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 233 | 157 | 466 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100798486|Ga0068867_1007984862 |
| Length | 180 |
| Sequence | MKQLPSSSGKQRFFSKIMTDILTGRRVQESISEYSEIALPNDANTLGNLLGGRVMHLVDLAGAIAASRHCRCVVVTASVDHMTFLHPVHIGELLTLKSSVNRVFRTSMEVGVKIFVENLREGVVRHTSSAYLTFVALDSKHNRIPIPPVIPETDEEKRRFEEAGVRREYRLAQKKRSLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 105 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 106 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.43 |
| Rhizosphere | 94.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068867_100798486 | 3300005459 | Bacteria | 841 |
| 2 | Ga0065712_10082233 | 3300005290 | Bacteria | 2934 |
| 3 | Ga0065715_10111001 | 3300005293 | Bacteria | 2593 |
| 4 | Ga0070658_10040082 | 3300005327 | Bacteria | 3779 |
| 5 | Ga0070683_100000013 | 3300005329 | Bacteria | 241235 |
| 6 | Ga0070683_100064174 | 3300005329 | Bacteria | 3418 |
| 7 | Ga0070683_100066794 | 3300005329 | Unclassified | 3349 |
| 8 | Ga0070683_100866364 | 3300005329 | Bacteria | 866 |
| 9 | Ga0070682_100035097 | 3300005337 | Bacteria | 3059 |
| 10 | Ga0070682_100395994 | 3300005337 | Bacteria | 1043 |
| 11 | Ga0070682_100457698 | 3300005337 | Unclassified | 979 |
| 12 | Ga0070689_100105590 | 3300005340 | Bacteria | 2234 |
| 13 | Ga0070669_100064435 | 3300005353 | Bacteria | 2699 |
| 14 | Ga0070675_101255376 | 3300005354 | Unclassified | 682 |
| 15 | Ga0070671_100868340 | 3300005355 | Unclassified | 787 |
| 16 | Ga0070673_100033816 | 3300005364 | Unclassified | 3863 |
| 17 | Ga0070688_100369895 | 3300005365 | Bacteria | 1054 |
| 18 | Ga0070659_100023590 | 3300005366 | Bacteria | 4710 |
| 19 | Ga0070659_101434822 | 3300005366 | Bacteria | 614 |
| 20 | Ga0070709_10349387 | 3300005434 | Unclassified | 1092 |
| 21 | Ga0070709_10357883 | 3300005434 | Bacteria | 1080 |
| 22 | Ga0070713_100005758 | 3300005436 | Bacteria | 8511 |
| 23 | Ga0070713_100073702 | 3300005436 | Unclassified | 2890 |
| 24 | Ga0070711_100169223 | 3300005439 | Unclassified | 1664 |
| 25 | Ga0070711_100716873 | 3300005439 | Bacteria | 843 |
| 26 | Ga0070708_100027695 | 3300005445 | Bacteria | 4866 |
| 27 | Ga0070708_101179876 | 3300005445 | Bacteria | 716 |
| 28 | Ga0070678_101226453 | 3300005456 | Unclassified | 696 |
| 29 | Ga0070681_10087435 | 3300005458 | Bacteria | 3070 |
| 30 | Ga0070681_10236348 | 3300005458 | Bacteria | 1741 |
| 31 | Ga0068867_100817850 | 3300005459 | Bacteria | 832 |
| 32 | Ga0070706_100413586 | 3300005467 | Bacteria | 1255 |
| 33 | Ga0070707_100148724 | 3300005468 | Unclassified | 2280 |
| 34 | Ga0070698_100139568 | 3300005471 | Bacteria | 2376 |
| 35 | Ga0070699_100342246 | 3300005518 | Bacteria | 1346 |
| 36 | Ga0070684_100000015 | 3300005535 | Bacteria | 143515 |
| 37 | Ga0070684_101011514 | 3300005535 | Bacteria | 780 |
| 38 | Ga0070697_100231715 | 3300005536 | Bacteria | 1575 |
| 39 | Ga0068853_100016551 | 3300005539 | Bacteria | 6072 |
| 40 | Ga0070695_100335797 | 3300005545 | Bacteria | 1128 |
| 41 | Ga0070665_100290691 | 3300005548 | Unclassified | 1637 |
| 42 | Ga0068855_100132428 | 3300005563 | Bacteria | 2846 |
| 43 | Ga0068855_100185936 | 3300005563 | Bacteria | 2346 |
| 44 | Ga0070664_100960869 | 3300005564 | Unclassified | 802 |
| 45 | Ga0068856_101589240 | 3300005614 | Unclassified | 667 |
| 46 | Ga0068852_100046956 | 3300005616 | Bacteria | 3682 |
| 47 | Ga0068859_100794542 | 3300005617 | Unclassified | 1034 |
| 48 | Ga0068864_100050974 | 3300005618 | Unclassified | 3564 |
| 49 | Ga0068861_100576188 | 3300005719 | Bacteria | 1029 |
| 50 | Ga0068851_10237967 | 3300005834 | Bacteria | 1028 |
| 51 | Ga0068863_100983649 | 3300005841 | Unclassified | 846 |
| 52 | Ga0081540_1048265 | 3300005983 | Bacteria | 2133 |
| 53 | Ga0081540_1158497 | 3300005983 | Unclassified | 882 |
| 54 | Ga0070717_10172837 | 3300006028 | Bacteria | 1880 |
| 55 | Ga0097621_100731452 | 3300006237 | Bacteria | 913 |
| 56 | Ga0097621_101162057 | 3300006237 | Bacteria | 726 |
| 57 | Ga0068871_100616679 | 3300006358 | Bacteria | 988 |
| 58 | Ga0075430_100131914 | 3300006846 | Bacteria | 2082 |
| 59 | Ga0075431_100338607 | 3300006847 | Bacteria | 1514 |
| 60 | Ga0097620_100794629 | 3300006931 | Unclassified | 1034 |
| 61 | Ga0105240_10001838 | 3300009093 | Bacteria | 35562 |
| 62 | Ga0105240_10009832 | 3300009093 | Bacteria | 13501 |
| 63 | Ga0105240_10013087 | 3300009093 | Bacteria | 11420 |
| 64 | Ga0105240_10397350 | 3300009093 | Bacteria | 1553 |
| 65 | Ga0105247_10506839 | 3300009101 | Bacteria | 880 |
| 66 | Ga0105243_11567700 | 3300009148 | Unclassified | 684 |
| 67 | Ga0105241_10186357 | 3300009174 | Unclassified | 1725 |
| 68 | Ga0105241_10958851 | 3300009174 | Unclassified | 798 |
| 69 | Ga0105248_10050658 | 3300009177 | Bacteria | 4658 |
| 70 | Ga0105248_10142431 | 3300009177 | Bacteria | 2704 |
| 71 | Ga0105248_10300340 | 3300009177 | Unclassified | 1808 |
| 72 | Ga0105248_10611099 | 3300009177 | Unclassified | 1230 |
| 73 | Ga0105248_11025733 | 3300009177 | Bacteria | 932 |
| 74 | Ga0105237_10007230 | 3300009545 | Bacteria | 12182 |
| 75 | Ga0105237_10010221 | 3300009545 | Bacteria | 9999 |
| 76 | Ga0105237_10035894 | 3300009545 | Bacteria | 5015 |
| 77 | Ga0105237_10273235 | 3300009545 | Bacteria | 1693 |
| 78 | Ga0105238_10105269 | 3300009551 | Bacteria | 2803 |
| 79 | Ga0105238_10270707 | 3300009551 | Bacteria | 1679 |
| 80 | Ga0105239_10038014 | 3300010375 | Bacteria | 5275 |
| 81 | Ga0105246_10937011 | 3300011119 | Unclassified | 779 |
| 82 | Ga0157373_10108611 | 3300013100 | Bacteria | 1951 |
| 83 | Ga0157371_10035841 | 3300013102 | Bacteria | 3554 |
| 84 | Ga0157369_10096456 | 3300013105 | Bacteria | 3155 |
| 85 | Ga0157369_10192700 | 3300013105 | Bacteria | 2141 |
| 86 | Ga0157369_10546282 | 3300013105 | Unclassified | 1198 |
| 87 | Ga0157374_10027928 | 3300013296 | Bacteria | 5094 |
| 88 | Ga0157378_10099706 | 3300013297 | Bacteria | 2650 |
| 89 | Ga0157378_10190405 | 3300013297 | Bacteria | 1934 |
| 90 | Ga0157378_10738167 | 3300013297 | Bacteria | 1007 |
| 91 | Ga0163162_10717217 | 3300013306 | Unclassified | 1121 |
| 92 | Ga0157372_11747101 | 3300013307 | Unclassified | 716 |
| 93 | Ga0163163_10007638 | 3300014325 | Bacteria | 9550 |
| 94 | Ga0163163_11007496 | 3300014325 | Unclassified | 896 |
| 95 | Ga0157379_10800994 | 3300014968 | Unclassified | 889 |
| 96 | Ga0157376_10251154 | 3300014969 | Unclassified | 1652 |
| 97 | Ga0157376_10947884 | 3300014969 | Unclassified | 881 |
| 98 | Ga0157376_11886394 | 3300014969 | Bacteria | 634 |
| 99 | Ga0182006_1017855 | 3300015261 | Bacteria | 3007 |
| 100 | Ga0182007_10010243 | 3300015262 | Bacteria | 3717 |
| 101 | Ga0182005_1019104 | 3300015265 | Unclassified | 1891 |
| 102 | Ga0197907_10672398 | 3300020069 | Bacteria | 913 |
| 103 | Ga0213875_10002009 | 3300021388 | Bacteria | 12558 |
| 104 | Ga0213875_10009966 | 3300021388 | Bacteria | 4783 |
| 105 | Ga0207680_10274118 | 3300025903 | Unclassified | 1171 |
| 106 | Ga0207699_10645645 | 3300025906 | Unclassified | 773 |
| 107 | Ga0207684_10049732 | 3300025910 | Unclassified | 3556 |
| 108 | Ga0207707_10254410 | 3300025912 | Bacteria | 1525 |
| 109 | Ga0207695_10008092 | 3300025913 | Bacteria | 13224 |
| 110 | Ga0207695_10010645 | 3300025913 | Bacteria | 11237 |
| 111 | Ga0207695_10019011 | 3300025913 | Bacteria | 7923 |
| 112 | Ga0207671_10012182 | 3300025914 | Bacteria | 6936 |
| 113 | Ga0207671_10021258 | 3300025914 | Bacteria | 4926 |
| 114 | Ga0207693_10061738 | 3300025915 | Bacteria | 2935 |
| 115 | Ga0207663_10006110 | 3300025916 | Bacteria | 6129 |
| 116 | Ga0207663_10459507 | 3300025916 | Unclassified | 983 |
| 117 | Ga0207646_10661869 | 3300025922 | Bacteria | 935 |
| 118 | Ga0207650_10599289 | 3300025925 | Unclassified | 926 |
| 119 | Ga0207659_10751179 | 3300025926 | Unclassified | 837 |
| 120 | Ga0207700_10002422 | 3300025928 | Bacteria | 10716 |
| 121 | Ga0207700_10184747 | 3300025928 | Unclassified | 1748 |
| 122 | Ga0207664_10003489 | 3300025929 | Bacteria | 10492 |
| 123 | Ga0207670_10080263 | 3300025936 | Bacteria | 2280 |
| 124 | Ga0207670_11087358 | 3300025936 | Unclassified | 675 |
| 125 | Ga0207691_10849824 | 3300025940 | Bacteria | 765 |
| 126 | Ga0207711_10201130 | 3300025941 | Bacteria | 1818 |
| 127 | Ga0207711_10207969 | 3300025941 | Unclassified | 1787 |
| 128 | Ga0207711_10533421 | 3300025941 | Unclassified | 1095 |
| 129 | Ga0207689_10477797 | 3300025942 | Unclassified | 1043 |
| 130 | Ga0207661_10000018 | 3300025944 | Bacteria | 242506 |
| 131 | Ga0207661_10270775 | 3300025944 | Bacteria | 1515 |
| 132 | Ga0207667_10185024 | 3300025949 | Bacteria | 2139 |
| 133 | Ga0207667_10197818 | 3300025949 | Bacteria | 2062 |
| 134 | Ga0207667_10585316 | 3300025949 | Bacteria | 1126 |
| 135 | Ga0207651_10133928 | 3300025960 | Bacteria | 1902 |
| 136 | Ga0207677_10152873 | 3300026023 | Bacteria | 1783 |
| 137 | Ga0207641_10340617 | 3300026088 | Unclassified | 1427 |
| 138 | Ga0207676_10153392 | 3300026095 | Unclassified | 1987 |
| 139 | Ga0207683_11207378 | 3300026121 | Unclassified | 701 |
| 140 | Ga0207683_11513598 | 3300026121 | Unclassified | 619 |
| 141 | Ga0268266_10302015 | 3300028379 | Bacteria | 1494 |
| 142 | Ga0265318_10084672 | 3300028577 | Bacteria | 1169 |
| 143 | Ga0265338_10832744 | 3300028800 | Bacteria | 631 |
| 144 | Ga0265770_1097706 | 3300030878 | Unclassified | 594 |
| 145 | Ga0265330_10067374 | 3300031235 | Unclassified | 1551 |
| 146 | Ga0265320_10013523 | 3300031240 | Bacteria | 4690 |
| 147 | Ga0265325_10030271 | 3300031241 | Bacteria | 2904 |
| 148 | Ga0265325_10121895 | 3300031241 | Bacteria | 1256 |
| 149 | Ga0265329_10064394 | 3300031242 | Bacteria | 1160 |
| 150 | Ga0265339_10120002 | 3300031249 | Bacteria | 1352 |
| 151 | Ga0265316_10005424 | 3300031344 | Bacteria | 12393 |
| 152 | Ga0265316_10120191 | 3300031344 | Bacteria | 1984 |
| 153 | Ga0265316_10279419 | 3300031344 | Bacteria | 1220 |
| 154 | Ga0265316_10368764 | 3300031344 | Bacteria | 1037 |
| 155 | Ga0265342_10025355 | 3300031712 | Bacteria | 3730 |
| 156 | Ga0265342_10325976 | 3300031712 | Bacteria | 804 |
| 157 | Ga0373930_0214050 | 3300034816 | Unclassified | 506 |
| 158 | Ga0373938_0238617 | 3300034957 | Unclassified | 516 |
| 159 | Ga0373923_0038831 | 3300035111 | Unclassified | 1953 |
| 160 | Ga0373953_0088818 | 3300035117 | Unclassified | 1291 |
| 161 | Ga0373954_0069844 | 3300035118 | Bacteria | 1668 |
| 162 | Ga0373954_0190174 | 3300035118 | Bacteria | 1008 |
| 163 | Ga0373954_0349055 | 3300035118 | Bacteria | 731 |
| 164 | Ga0373960_0326635 | 3300035121 | Unclassified | 576 |
| 165 | Ga0373943_0068747 | 3300035170 | Bacteria | 1789 |
| 166 | Ga0373946_0265900 | 3300035171 | Unclassified | 840 |
| 167 | Ga0373955_0453600 | 3300035172 | Unclassified | 782 |
| 168 | Ga0373935_0052598 | 3300035692 | Unclassified | 2589 |
| 169 | Ga0373935_0376358 | 3300035692 | Unclassified | 1016 |
| 170 | Ga0373927_0003188 | 3300035695 | Bacteria | 11821 |
| 171 | Ga0373927_0171733 | 3300035695 | Bacteria | 1421 |
| 172 | Ga0373947_0065538 | 3300035725 | Bacteria | 2216 |
| 173 | Ga0373947_0285570 | 3300035725 | Bacteria | 1098 |
| 174 | Ga0373947_0606412 | 3300035725 | Bacteria | 746 |
| 175 | Ga0373937_0017838 | 3300036401 | Bacteria | 6334 |
| 176 | Ga0373925_0048871 | 3300037068 | Bacteria | 3153 |
| 177 | Ga0373925_0101803 | 3300037068 | Bacteria | 2209 |
| 178 | Ga0373925_0181998 | 3300037068 | Unclassified | 1664 |
| 179 | Ga0373925_0317081 | 3300037068 | Unclassified | 1261 |
| 180 | Ga0395905_0228369 | 3300037471 | Bacteria | 1741 |
| 181 | Ga0436364_0961638 | 3300037853 | Bacteria | 4472 |
| 182 | Ga0436364_1155207 | 3300037853 | Bacteria | 1819 |
| 183 | Ga0451577_1592094 | 3300042876 | Unclassified | 576 |
| 184 | Ga0453683_0001499 | 3300044673 | Bacteria | 19964 |
| 185 | Ga0453683_0111196 | 3300044673 | Bacteria | 1723 |
| 186 | Ga0453684_0259850 | 3300044712 | Unclassified | 1990 |
| 187 | Ga0453684_0426004 | 3300044712 | Bacteria | 1481 |
| 188 | Ga0453684_0548718 | 3300044712 | Bacteria | 1273 |
| 189 | Ga0453684_0665303 | 3300044712 | Unclassified | 1135 |
| 190 | Ga0451576_0440935 | 3300045051 | Unclassified | 1367 |
| 191 | Ga0451576_1870147 | 3300045051 | Unclassified | 620 |
| 192 | Ga0495580_0008109 | 3300046472 | Bacteria | 8377 |
| 193 | Ga0495580_0050525 | 3300046472 | Bacteria | 2940 |
| 194 | Ga0495580_0126869 | 3300046472 | Bacteria | 1771 |
| 195 | Ga0495580_0394899 | 3300046472 | Unclassified | 933 |
| 196 | Ga0495580_0735307 | 3300046472 | Bacteria | 644 |
| 197 | Ga0495582_0294379 | 3300046473 | Bacteria | 933 |
| 198 | Ga0495639_0241314 | 3300046475 | Bacteria | 892 |
| 199 | Ga0495662_0158699 | 3300046476 | Bacteria | 1114 |
| 200 | Ga0495594_0565138 | 3300046499 | Unclassified | 645 |
| 201 | Ga0495630_0173381 | 3300046517 | Bacteria | 1644 |
| 202 | Ga0495666_0304138 | 3300046526 | Unclassified | 721 |
| 203 | Ga0495652_0530389 | 3300046529 | Bacteria | 812 |
| 204 | Ga0495665_0107220 | 3300046531 | Bacteria | 1465 |
| 205 | Ga0495665_0154215 | 3300046531 | Bacteria | 1198 |
| 206 | Ga0495640_0344886 | 3300046533 | Unclassified | 920 |
| 207 | Ga0495587_0201356 | 3300046536 | Unclassified | 1126 |
| 208 | Ga0495645_0037312 | 3300046543 | Unclassified | 3542 |
| 209 | Ga0495667_0048938 | 3300046559 | Unclassified | 2791 |
| 210 | Ga0495599_0251361 | 3300046678 | Unclassified | 1076 |
| 211 | Ga0495623_0027717 | 3300046679 | Bacteria | 3647 |
| 212 | Ga0495581_0130440 | 3300047315 | Bacteria | 1465 |
| 213 | Ga0495604_0049752 | 3300047317 | Bacteria | 3255 |
| 214 | Ga0495674_0257239 | 3300047319 | Bacteria | 1435 |
| 215 | Ga0495674_0727499 | 3300047319 | Unclassified | 777 |
| 216 | Ga0495674_0891299 | 3300047319 | Bacteria | 687 |
| 217 | Ga0495680_0558235 | 3300047322 | Unclassified | 771 |
| 218 | Ga0495684_0107339 | 3300047471 | Bacteria | 2109 |
| 219 | Ga0495684_0149076 | 3300047471 | Bacteria | 1750 |
| 220 | Ga0495602_0241503 | 3300048088 | Bacteria | 1351 |
| 221 | Ga0496100_0065763 | 3300048903 | Bacteria | 2404 |
| 222 | Ga0496102_0601729 | 3300048905 | Bacteria | 1022 |
| 223 | Ga0496103_0725999 | 3300048906 | Bacteria | 629 |
| 224 | Ga0496104_0749663 | 3300048907 | Bacteria | 883 |
| 225 | Ga0496106_0132676 | 3300048909 | Unclassified | 1954 |
| 226 | Ga0496109_0080756 | 3300048912 | Bacteria | 2996 |
| 227 | Ga0496110_1370748 | 3300048913 | Unclassified | 617 |
| 228 | Ga0496115_0523668 | 3300048918 | Bacteria | 950 |
| 229 | Ga0501034_0746709 | 3300049571 | Bacteria | 874 |
| 230 | Ga0501076_0697853 | 3300049592 | Unclassified | 838 |
| 231 | nmdc:mga0qj67_46369_c2 | 3300050509 | Bacteria | 2124 |
| 232 | Ga0495595_0313926 | 3300053084 | Bacteria | 789 |
| 233 | Ga0501082_0002361 | 3300060353 | Bacteria | 16522 |
| 234 | Ga0068867_100798486 | |||
| 235 | Ga0065712_10082233 | |||
| 236 | Ga0065715_10111001 | |||
| 237 | Ga0070658_10040082 | |||
| 238 | Ga0070683_100000013 | |||
| 239 | Ga0070683_100064174 | |||
| 240 | Ga0070683_100066794 | |||
| 241 | Ga0070683_100866364 | |||
| 242 | Ga0070682_100035097 | |||
| 243 | Ga0070682_100395994 | |||
| 244 | Ga0070682_100457698 | |||
| 245 | Ga0070689_100105590 | |||
| 246 | Ga0070669_100064435 | |||
| 247 | Ga0070675_101255376 | |||
| 248 | Ga0070671_100868340 | |||
| 249 | Ga0070673_100033816 | |||
| 250 | Ga0070688_100369895 | |||
| 251 | Ga0070659_100023590 | |||
| 252 | Ga0070659_101434822 | |||
| 253 | Ga0070709_10349387 | |||
| 254 | Ga0070709_10357883 | |||
| 255 | Ga0070713_100005758 | |||
| 256 | Ga0070713_100073702 | |||
| 257 | Ga0070711_100169223 | |||
| 258 | Ga0070711_100716873 | |||
| 259 | Ga0070708_100027695 | |||
| 260 | Ga0070708_101179876 | |||
| 261 | Ga0070678_101226453 | |||
| 262 | Ga0070681_10087435 | |||
| 263 | Ga0070681_10236348 | |||
| 264 | Ga0068867_100817850 | |||
| 265 | Ga0070706_100413586 | |||
| 266 | Ga0070707_100148724 | |||
| 267 | Ga0070698_100139568 | |||
| 268 | Ga0070699_100342246 | |||
| 269 | Ga0070684_100000015 | |||
| 270 | Ga0070684_101011514 | |||
| 271 | Ga0070697_100231715 | |||
| 272 | Ga0068853_100016551 | |||
| 273 | Ga0070695_100335797 | |||
| 274 | Ga0070665_100290691 | |||
| 275 | Ga0068855_100132428 | |||
| 276 | Ga0068855_100185936 | |||
| 277 | Ga0070664_100960869 | |||
| 278 | Ga0068856_101589240 | |||
| 279 | Ga0068852_100046956 | |||
| 280 | Ga0068859_100794542 | |||
| 281 | Ga0068864_100050974 | |||
| 282 | Ga0068861_100576188 | |||
| 283 | Ga0068851_10237967 | |||
| 284 | Ga0068863_100983649 | |||
| 285 | Ga0081540_1048265 | |||
| 286 | Ga0081540_1158497 | |||
| 287 | Ga0070717_10172837 | |||
| 288 | Ga0097621_100731452 | |||
| 289 | Ga0097621_101162057 | |||
| 290 | Ga0068871_100616679 | |||
| 291 | Ga0075430_100131914 | |||
| 292 | Ga0075431_100338607 | |||
| 293 | Ga0097620_100794629 | |||
| 294 | Ga0105240_10001838 | |||
| 295 | Ga0105240_10009832 | |||
| 296 | Ga0105240_10013087 | |||
| 297 | Ga0105240_10397350 | |||
| 298 | Ga0105247_10506839 | |||
| 299 | Ga0105243_11567700 | |||
| 300 | Ga0105241_10186357 | |||
| 301 | Ga0105241_10958851 | |||
| 302 | Ga0105248_10050658 | |||
| 303 | Ga0105248_10142431 | |||
| 304 | Ga0105248_10300340 | |||
| 305 | Ga0105248_10611099 | |||
| 306 | Ga0105248_11025733 | |||
| 307 | Ga0105237_10007230 | |||
| 308 | Ga0105237_10010221 | |||
| 309 | Ga0105237_10035894 | |||
| 310 | Ga0105237_10273235 | |||
| 311 | Ga0105238_10105269 | |||
| 312 | Ga0105238_10270707 | |||
| 313 | Ga0105239_10038014 | |||
| 314 | Ga0105246_10937011 | |||
| 315 | Ga0157373_10108611 | |||
| 316 | Ga0157371_10035841 | |||
| 317 | Ga0157369_10096456 | |||
| 318 | Ga0157369_10192700 | |||
| 319 | Ga0157369_10546282 | |||
| 320 | Ga0157374_10027928 | |||
| 321 | Ga0157378_10099706 | |||
| 322 | Ga0157378_10190405 | |||
| 323 | Ga0157378_10738167 | |||
| 324 | Ga0163162_10717217 | |||
| 325 | Ga0157372_11747101 | |||
| 326 | Ga0163163_10007638 | |||
| 327 | Ga0163163_11007496 | |||
| 328 | Ga0157379_10800994 | |||
| 329 | Ga0157376_10251154 | |||
| 330 | Ga0157376_10947884 | |||
| 331 | Ga0157376_11886394 | |||
| 332 | Ga0182006_1017855 | |||
| 333 | Ga0182007_10010243 | |||
| 334 | Ga0182005_1019104 | |||
| 335 | Ga0197907_10672398 | |||
| 336 | Ga0213875_10002009 | |||
| 337 | Ga0213875_10009966 | |||
| 338 | Ga0207680_10274118 | |||
| 339 | Ga0207699_10645645 | |||
| 340 | Ga0207684_10049732 | |||
| 341 | Ga0207707_10254410 | |||
| 342 | Ga0207695_10008092 | |||
| 343 | Ga0207695_10010645 | |||
| 344 | Ga0207695_10019011 | |||
| 345 | Ga0207671_10012182 | |||
| 346 | Ga0207671_10021258 | |||
| 347 | Ga0207693_10061738 | |||
| 348 | Ga0207663_10006110 | |||
| 349 | Ga0207663_10459507 | |||
| 350 | Ga0207646_10661869 | |||
| 351 | Ga0207650_10599289 | |||
| 352 | Ga0207659_10751179 | |||
| 353 | Ga0207700_10002422 | |||
| 354 | Ga0207700_10184747 | |||
| 355 | Ga0207664_10003489 | |||
| 356 | Ga0207670_10080263 | |||
| 357 | Ga0207670_11087358 | |||
| 358 | Ga0207691_10849824 | |||
| 359 | Ga0207711_10201130 | |||
| 360 | Ga0207711_10207969 | |||
| 361 | Ga0207711_10533421 | |||
| 362 | Ga0207689_10477797 | |||
| 363 | Ga0207661_10000018 | |||
| 364 | Ga0207661_10270775 | |||
| 365 | Ga0207667_10185024 | |||
| 366 | Ga0207667_10197818 | |||
| 367 | Ga0207667_10585316 | |||
| 368 | Ga0207651_10133928 | |||
| 369 | Ga0207677_10152873 | |||
| 370 | Ga0207641_10340617 | |||
| 371 | Ga0207676_10153392 | |||
| 372 | Ga0207683_11207378 | |||
| 373 | Ga0207683_11513598 | |||
| 374 | Ga0268266_10302015 | |||
| 375 | Ga0265318_10084672 | |||
| 376 | Ga0265338_10832744 | |||
| 377 | Ga0265770_1097706 | |||
| 378 | Ga0265330_10067374 | |||
| 379 | Ga0265320_10013523 | |||
| 380 | Ga0265325_10030271 | |||
| 381 | Ga0265325_10121895 | |||
| 382 | Ga0265329_10064394 | |||
| 383 | Ga0265339_10120002 | |||
| 384 | Ga0265316_10005424 | |||
| 385 | Ga0265316_10120191 | |||
| 386 | Ga0265316_10279419 | |||
| 387 | Ga0265316_10368764 | |||
| 388 | Ga0265342_10025355 | |||
| 389 | Ga0265342_10325976 | |||
| 390 | Ga0373930_0214050 | |||
| 391 | Ga0373938_0238617 | |||
| 392 | Ga0373923_0038831 | |||
| 393 | Ga0373953_0088818 | |||
| 394 | Ga0373954_0069844 | |||
| 395 | Ga0373954_0190174 | |||
| 396 | Ga0373954_0349055 | |||
| 397 | Ga0373960_0326635 | |||
| 398 | Ga0373943_0068747 | |||
| 399 | Ga0373946_0265900 | |||
| 400 | Ga0373955_0453600 | |||
| 401 | Ga0373935_0052598 | |||
| 402 | Ga0373935_0376358 | |||
| 403 | Ga0373927_0003188 | |||
| 404 | Ga0373927_0171733 | |||
| 405 | Ga0373947_0065538 | |||
| 406 | Ga0373947_0285570 | |||
| 407 | Ga0373947_0606412 | |||
| 408 | Ga0373937_0017838 | |||
| 409 | Ga0373925_0048871 | |||
| 410 | Ga0373925_0101803 | |||
| 411 | Ga0373925_0181998 | |||
| 412 | Ga0373925_0317081 | |||
| 413 | Ga0395905_0228369 | |||
| 414 | Ga0436364_0961638 | |||
| 415 | Ga0436364_1155207 | |||
| 416 | Ga0451577_1592094 | |||
| 417 | Ga0453683_0001499 | |||
| 418 | Ga0453683_0111196 | |||
| 419 | Ga0453684_0259850 | |||
| 420 | Ga0453684_0426004 | |||
| 421 | Ga0453684_0548718 | |||
| 422 | Ga0453684_0665303 | |||
| 423 | Ga0451576_0440935 | |||
| 424 | Ga0451576_1870147 | |||
| 425 | Ga0495580_0008109 | |||
| 426 | Ga0495580_0050525 | |||
| 427 | Ga0495580_0126869 | |||
| 428 | Ga0495580_0394899 | |||
| 429 | Ga0495580_0735307 | |||
| 430 | Ga0495582_0294379 | |||
| 431 | Ga0495639_0241314 | |||
| 432 | Ga0495662_0158699 | |||
| 433 | Ga0495594_0565138 | |||
| 434 | Ga0495630_0173381 | |||
| 435 | Ga0495666_0304138 | |||
| 436 | Ga0495652_0530389 | |||
| 437 | Ga0495665_0107220 | |||
| 438 | Ga0495665_0154215 | |||
| 439 | Ga0495640_0344886 | |||
| 440 | Ga0495587_0201356 | |||
| 441 | Ga0495645_0037312 | |||
| 442 | Ga0495667_0048938 | |||
| 443 | Ga0495599_0251361 | |||
| 444 | Ga0495623_0027717 | |||
| 445 | Ga0495581_0130440 | |||
| 446 | Ga0495604_0049752 | |||
| 447 | Ga0495674_0257239 | |||
| 448 | Ga0495674_0727499 | |||
| 449 | Ga0495674_0891299 | |||
| 450 | Ga0495680_0558235 | |||
| 451 | Ga0495684_0107339 | |||
| 452 | Ga0495684_0149076 | |||
| 453 | Ga0495602_0241503 | |||
| 454 | Ga0496100_0065763 | |||
| 455 | Ga0496102_0601729 | |||
| 456 | Ga0496103_0725999 | |||
| 457 | Ga0496104_0749663 | |||
| 458 | Ga0496106_0132676 | |||
| 459 | Ga0496109_0080756 | |||
| 460 | Ga0496110_1370748 | |||
| 461 | Ga0496115_0523668 | |||
| 462 | Ga0501034_0746709 | |||
| 463 | Ga0501076_0697853 | |||
| 464 | nmdc:mga0qj67_46369_c2 | |||
| 465 | Ga0495595_0313926 | |||
| 466 | Ga0501082_0002361 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qq2-assembly1.cif.gz_A | crystal structure of c-terminal domain of human acyl-coa thioesterase 7 | 0.9581 | 2 | 141 |
| 2qq2-assembly1.cif.gz_C | crystal structure of c-terminal domain of human acyl-coa thioesterase 7 | 0.9561 | 2 | 141 |
| 3sps-assembly1.cif.gz_B | crystal structure of apo-hexameric acyl-coa thioesterase | 0.9546 | 2 | 141 |
| 2eis-assembly1.cif.gz_A | x-ray structure of acyl-coa hydrolase-like protein, tt1379, from thermus thermophilus hb8 | 0.9505 | 1 | 117 |
| 5szy-assembly1.cif.gz_A | novel structural insights into gdp-mediated regulation of acyl-coa thioesterases | 0.9478 | 2 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q91V12_220_381_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9381 | 2 | 142 | 3.10.129.10 |
| 4mobA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9367 | 2 | 137 | 3.10.129.10 |
| 1vpmB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9354 | 2 | 139 | 3.10.129.10 |
| 3b7kC02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9347 | 2 | 103 | 3.10.129.10 |
| 4mocA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.934 | 3 | 116 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A699USR9-F1-model_v4 | Thioesterase superfamily protein | 0.989 | 22 | 137 |
GO:0005737
GO:0006637 GO:0052816 |
| AF-A0A4V1UNS3-F1-model_v4 | Acyl-CoA thioesterase | 0.9883 | 26 | 137 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-K4KIU7-F1-model_v4 | Cytosolic long-chain acyl-CoA thioester hydrolase family protein | 0.9874 | 16 | 141 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A2W5Y592-F1-model_v4 | Acyl-CoA thioesterase | 0.9863 | 9 | 143 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A2T2T4K9-F1-model_v4 | Acyl-CoA thioesterase | 0.9858 | 16 | 137 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |