F345648

General Info

Members Datasets Scaffolds Average Seq Length
232 175 464 392

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954711539|2954718890
Length 434
Sequence ADPMTAPQGSGPGPFFAHPNTLADNRARAYADFVPLINKLRTGIALPDNSLTRLRIALTVFFALDGFVFAGWVVRIPAIKEQTGASASALGLALLGVSAGAVITMMLTGRLCRRYGTHRVTVVCAVLLSLSVALPPLTHSAPALGAVLLVFGAAYGSINVAFNSAAVDLVGALRRPIMPSFHAAFSLGGMLGAGIGGLVAGGLSPTRHLFGLTLVGLLVTAVAGRTLLRIQPPTPVRDTPPHDAARRPSKTPTRTRGLVVTFGLIALCTAYGEGALADWSALHLEHDLDATPGVAAVGYSCFALAMTIGRLSGTKLLERLGQTRTLVGGGTTAALGMLLGALAPSVWAALLGFMITGLGLANLFPVAVERAGRLAGPDGVAVASTLGYGGMLLGPPAIGFMADWFSLPAALTSVAVLAGTAAVIAALTRRAAAG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
13 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
29 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
32 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
33 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
34 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
35 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
36 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
37 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
41 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
42 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
52 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
56 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
57 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
58 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
61 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
62 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
85 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
107 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
108 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
109 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
112 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
113 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
114 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
115 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
116 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
117 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
118 2643221548 Streptomyces sp. Root55 Isolate Unclassified
119 2643221578 Streptomyces sp. Root63 Isolate Unclassified
120 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
121 2643221647 Streptomyces sp. Root369 Isolate Unclassified
122 2643221670 Streptomyces sp. Root431 Isolate Unclassified
123 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
124 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
125 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
126 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
127 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
128 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
129 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
130 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
131 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
132 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
133 2808606448 Streptomyces sp. 193411 Isolate Unclassified
134 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
135 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
136 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
137 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
138 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
139 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
140 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
141 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
142 2862574272 Streptomyces sp. AcE210 Isolate Nodule
143 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
144 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
145 2867428634 Streptomyces sp. RP5T Isolate Unclassified
146 2867475112 Streptomyces sp. TM32 Isolate Unclassified
147 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
148 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
149 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
150 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
151 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
152 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
153 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
154 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
155 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
156 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
157 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
158 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
159 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
160 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
161 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
162 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
163 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
164 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
165 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
166 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
167 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
168 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
169 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
170 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
171 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
172 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
173 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
174 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
175 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.55
Metatranscriptomes 0.43
Isolates 28.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0.86
Rhizoplane 0.86
Rhizosphere 71.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015551 3300001989 Bacteria 2765
2 rootH1_10003969 3300003316 Bacteria 14738
3 rootH2_10109501 3300003320 Bacteria 4240
4 rootH1_10240122 3300003323 Bacteria 3207
5 JGI25160J50197_1007701 3300003354 Bacteria 4187
6 JGI25160J50197_1011935 3300003354 Bacteria 3046
7 Ga0006562J51391_1062332 3300003578 Bacteria 3620
8 Ga0068856_100337513 3300005614 Bacteria 1525
9 Ga0075368_10001399 3300006042 Bacteria 7699
10 Ga0075367_10003898 3300006178 Bacteria 7195
11 Ga0182007_10000862 3300015262 Bacteria 16823
12 Ga0183367_1003 3300015688 Bacteria 814276
13 Ga0207426_1001508 3300025302 Bacteria 18995
14 Ga0207426_1006273 3300025302 Bacteria 5201
15 Ga0207647_10114036 3300025904 Bacteria 1597
16 Ga0207702_10293989 3300026078 Bacteria 1540
17 Ga0209371_1010786 3300027312 Bacteria 2773
18 Ga0307517_10005627 3300028786 Bacteria 18796
19 Ga0307517_10018306 3300028786 Bacteria 9068
20 Ga0307515_10000189 3300028794 Bacteria 150703
21 Ga0307515_10015190 3300028794 Bacteria 14204
22 Ga0307515_10113011 3300028794 Bacteria 3153
23 Ga0307511_10000618 3300030521 Bacteria 38104
24 Ga0307512_10043870 3300030522 Bacteria 3683
25 Ga0307512_10133671 3300030522 Bacteria 1545
26 Ga0307513_10012710 3300031456 Bacteria 10367
27 Ga0307513_10131641 3300031456 Bacteria 2446
28 Ga0307509_10002865 3300031507 Bacteria 27292
29 Ga0307509_10038821 3300031507 Bacteria 5191
30 Ga0307509_10148381 3300031507 Bacteria 2266
31 Ga0307508_10174112 3300031616 Bacteria 1755
32 Ga0307514_10052067 3300031649 Bacteria 3168
33 Ga0307518_10005975 3300031838 Bacteria 8726
34 Ga0307518_10043002 3300031838 Bacteria 3288
35 Ga0307510_10001655 3300033180 Bacteria 24719
36 Ga0395898_0005101 3300037466 Bacteria 14228
37 Ga0395898_0005266 3300037466 Bacteria 13987
38 Ga0439436_0002212 3300041404 Bacteria 5821
39 Ga0439436_0005918 3300041404 Bacteria 3750
40 Ga0439433_0004442 3300041999 Bacteria 3022
41 Ga0439442_014114 3300042002 Bacteria 1644
42 Ga0439449_0000531 3300042007 Bacteria 14217
43 Ga0439455_0003393 3300042012 Bacteria 3037
44 Ga0439457_000060 3300042014 Bacteria 23283
45 Ga0439457_002136 3300042014 Bacteria 5741
46 Ga0439462_0003480 3300042015 Bacteria 3779
47 Ga0450894_000999 3300042131 Bacteria 4385
48 Ga0450898_000489 3300042134 Bacteria 4609
49 Ga0450899_000460 3300042135 Bacteria 4571
50 Ga0450903_000359 3300042138 Bacteria 10012
51 Ga0466972_0013712 3300044658 Bacteria 4066
52 Ga0466972_0055665 3300044658 Bacteria 1902
53 Ga0466965_0025932 3300044683 Bacteria 2840
54 Ga0466965_0037122 3300044683 Bacteria 2392
55 Ga0466961_0024321 3300044693 Bacteria 3897
56 Ga0466963_0000455 3300044694 Bacteria 18966
57 Ga0466971_0104890 3300044719 Bacteria 1301
58 Ga0466970_0040639 3300044765 Bacteria 2470
59 Ga0466960_0004662 3300044901 Bacteria 5375
60 Ga0495592_0008174 3300046454 Bacteria 7860
61 Ga0495592_0056661 3300046454 Bacteria 2895
62 Ga0495603_0000444 3300046455 Bacteria 22690
63 Ga0495603_0029331 3300046455 Bacteria 3318
64 Ga0495603_0059464 3300046455 Bacteria 2259
65 Ga0495603_0082940 3300046455 Bacteria 1877
66 Ga0495629_0006630 3300046459 Bacteria 8567
67 Ga0495629_0010025 3300046459 Bacteria 6914
68 Ga0495629_0012056 3300046459 Bacteria 6265
69 Ga0495638_0115828 3300046460 Bacteria 1588
70 Ga0495580_0038008 3300046472 Bacteria 3451
71 Ga0495582_0157912 3300046473 Bacteria 1289
72 Ga0495639_0014926 3300046475 Bacteria 3366
73 Ga0495662_0039909 3300046476 Bacteria 2267
74 Ga0495594_0009563 3300046499 Bacteria 5011
75 Ga0495594_0044690 3300046499 Bacteria 2430
76 Ga0495594_0102716 3300046499 Bacteria 1608
77 Ga0495583_0015207 3300046506 Bacteria 4196
78 Ga0495620_0002914 3300046515 Bacteria 9838
79 Ga0495643_0021727 3300046522 Bacteria 3674
80 Ga0495648_0037098 3300046524 Bacteria 3136
81 Ga0495642_0075498 3300046528 Bacteria 1414
82 Ga0495652_0103474 3300046529 Bacteria 2305
83 Ga0495640_0008650 3300046533 Bacteria 7978
84 Ga0495587_0000417 3300046536 Bacteria 29901
85 Ga0495597_0020343 3300046542 Bacteria 3093
86 Ga0495645_0116693 3300046543 Bacteria 1884
87 Ga0495622_0005637 3300046557 Bacteria 5808
88 Ga0495668_0023971 3300046616 Bacteria 3473
89 Ga0495611_0009365 3300046648 Bacteria 4140
90 Ga0495635_0001518 3300046663 Bacteria 15545
91 Ga0495635_0112399 3300046663 Bacteria 1860
92 Ga0495588_0019428 3300046674 Bacteria 3327
93 Ga0495588_0067177 3300046674 Bacteria 1861
94 Ga0495657_0002021 3300046675 Bacteria 17283
95 Ga0495657_0008860 3300046675 Bacteria 7658
96 Ga0495657_0026016 3300046675 Bacteria 4149
97 Ga0495658_0102754 3300046683 Bacteria 1708
98 Ga0495613_0004200 3300046689 Bacteria 10782
99 Ga0495613_0010608 3300046689 Bacteria 6833
100 Ga0495613_0053001 3300046689 Bacteria 2986
101 Ga0495624_0064590 3300046690 Bacteria 2287
102 Ga0495649_0023863 3300046694 Bacteria 3415
103 Ga0495649_0115913 3300046694 Bacteria 1418
104 Ga0495589_0071897 3300046794 Bacteria 1690
105 Ga0495600_0020502 3300046809 Bacteria 4227
106 Ga0495600_0096314 3300046809 Bacteria 1929
107 Ga0495581_0112607 3300047315 Bacteria 1582
108 Ga0495604_0000269 3300047317 Bacteria 46308
109 Ga0495604_0012772 3300047317 Bacteria 6686
110 Ga0495636_0001909 3300047318 Bacteria 7974
111 Ga0495674_0146371 3300047319 Bacteria 1983
112 Ga0495676_0006297 3300047321 Bacteria 10920
113 Ga0495676_0008584 3300047321 Bacteria 9359
114 Ga0495676_0021871 3300047321 Bacteria 5575
115 Ga0495676_0033378 3300047321 Bacteria 4335
116 Ga0495675_0060826 3300047444 Bacteria 2393
117 Ga0495675_0070251 3300047444 Bacteria 2211
118 Ga0495685_005876 3300047447 Bacteria 4009
119 Ga0495685_013139 3300047447 Bacteria 2808
120 Ga0495686_0095059 3300047472 Bacteria 1805
121 Ga0495593_0038452 3300047673 Bacteria 2584
122 Ga0495614_0000381 3300048089 Bacteria 17955
123 Ga0495614_0008698 3300048089 Bacteria 4514
124 Ga0496108_0170812 3300048911 Bacteria 1881
125 Ga0496109_0025334 3300048912 Bacteria 5285
126 Ga0501031_0007510 3300049568 Bacteria 7098
127 Ga0501032_0010512 3300049569 Bacteria 6677
128 Ga0501033_0000850 3300049570 Bacteria 27891
129 Ga0501033_0029808 3300049570 Bacteria 4100
130 Ga0501033_0151479 3300049570 Bacteria 1673
131 Ga0501034_0002805 3300049571 Bacteria 20384
132 Ga0501034_0012087 3300049571 Bacteria 8925
133 Ga0501034_0163023 3300049571 Bacteria 2199
134 Ga0501036_0004043 3300049572 Bacteria 11793
135 Ga0501036_0009721 3300049572 Bacteria 7919
136 Ga0501036_0012614 3300049572 Bacteria 7009
137 Ga0501037_0009587 3300049573 Bacteria 7105
138 Ga0501037_0030150 3300049573 Bacteria 4008
139 Ga0501037_0030636 3300049573 Bacteria 3975
140 Ga0501038_0000469 3300049574 Bacteria 35427
141 Ga0501038_0007194 3300049574 Bacteria 10289
142 Ga0501038_0029417 3300049574 Bacteria 4869
143 Ga0501039_0002941 3300049575 Bacteria 12754
144 Ga0501039_0034610 3300049575 Bacteria 3898
145 Ga0501043_0001527 3300049579 Bacteria 20201
146 Ga0501043_0005883 3300049579 Bacteria 9866
147 Ga0501043_0152674 3300049579 Bacteria 1807
148 Ga0501046_0008759 3300049580 Bacteria 8790
149 Ga0501047_0004636 3300049581 Bacteria 12935
150 Ga0501047_0011972 3300049581 Bacteria 8208
151 Ga0501047_0013582 3300049581 Bacteria 7723
152 Ga0501047_0016286 3300049581 Bacteria 7091
153 Ga0501048_0012056 3300049582 Bacteria 6442
154 Ga0501070_0013865 3300049586 Bacteria 6789
155 Ga0501074_0001432 3300049590 Bacteria 15934
156 Ga0501080_0040438 3300049742 Bacteria 4349
157 Ga0501035_0005920 3300049822 Bacteria 11512
158 Ga0501035_0127140 3300049822 Bacteria 2224
159 Ga0501044_0003487 3300049823 Bacteria 17715
160 Ga0501044_0004671 3300049823 Bacteria 15323
161 Ga0501044_0022651 3300049823 Bacteria 6690
162 nmdc:mga06z11_1896_c1 3300050494 Bacteria 7883
163 nmdc:mga04h51_3246_c1 3300050495 Bacteria 3931
164 Ga0500553_030356 3300053101 Bacteria 2703
165 Ga0500572_007872 3300053111 Bacteria 2478
166 Ga0500634_0038023 3300053161 Bacteria 2617
167 Ga0501084_0274615 3300054114 Bacteria 1423
168 2954718890 2954711539 Bacteria 10867210
169 2547408666 2547132111 Bacteria 8013147
170 2554259930 2554235005 Bacteria 6457341
171 2585300693 2582581312 Bacteria 7308206
172 2585306460 2582581313 Bacteria 10042643
173 2585320380 2582581314 Bacteria 11452267
174 2616693340 2616644814 Bacteria 11555299
175 2643764242 2643221548 Bacteria 8053412
176 2643898965 2643221578 Bacteria 9213798
177 2643947383 2643221587 Bacteria 7586415
178 2644263302 2643221647 Bacteria 10741251
179 2644386177 2643221670 Bacteria 6497041
180 2644403475 2643221673 Bacteria 9196637
181 2644433146 2643221677 Bacteria 7584031
182 2644458698 2643221682 Bacteria 6743283
183 2768643956 2767802112 Bacteria 6465194
184 2784586320 2784132148 Bacteria 8627943
185 2785346490 2784746763 Bacteria 9783172
186 2785366552 2784746768 Bacteria 10036182
187 2786667633 2786546132 Bacteria 10419719
188 2804849345 2802429296 Bacteria 7227771
189 2808917908 2808606375 Bacteria 9466072
190 2809229819 2808606448 Bacteria 8656184
191 2811846638 2808606982 Bacteria 7791042
192 2812360872 2811994879 Bacteria 9313447
193 2812482768 2811994917 Bacteria 7761064
194 2819698573 2818991463 Bacteria 7948711
195 2852639406 2852635781 Bacteria 8251373
196 2862181040 2862178590 Bacteria 8583590
197 2862282650 2862281513 Bacteria 9621493
198 2862292001 2862290372 Bacteria 7471434
199 2862580485 2862574272 Bacteria 10567477
200 2862706332 2862705112 Bacteria 6563286
201 2863408080 2863404153 Bacteria 9672205
202 2867435185 2867428634 Bacteria 9590268
203 2867478010 2867475112 Bacteria 6909112
204 2873157970 2873151551 Bacteria 8625867
205 2875392277 2875391855 Bacteria 7600475
206 2877683994 2877676314 Bacteria 9512378
207 2912726636 2912723979 Bacteria 8557534
208 2918502127 2918501144 Bacteria 8668083
209 2946052599 2946045630 Bacteria 8527308
210 2946064997 2946064051 Bacteria 8957905
211 2954389294 2954380949 Bacteria 10050426
212 2954673773 2954673503 Bacteria 9685905
213 2954690217 2954682443 Bacteria 9862841
214 2954700067 2954691527 Bacteria 10720516
215 2954702153 2954701450 Bacteria 10834262
216 2954728860 2954721474 Bacteria 10456478
217 2954732952 2954731030 Bacteria 10243860
218 2954747759 2954740390 Bacteria 10229294
219 2954751829 2954749733 Bacteria 10366972
220 2954766882 2954759201 Bacteria 9358192
221 2990045655 2990044586 Bacteria 6603797
222 2990088825 2990088156 Bacteria 6657676
223 2997605877 2997600082 Bacteria 9896405
224 3006494654 3006493962 Bacteria 8825450
225 8008488167 8008485437 Bacteria 7198341
226 8008560599 8008558824 Bacteria 10610750
227 8023630656 8023623736 Bacteria 8593882
228 8025415999 8025413630 Bacteria 7014048
229 8025527243 8025524527 Bacteria 7197316
230 8048407253 8048406513 Bacteria 8936924
231 8056669978 8056667051 Bacteria 6953971
232 8056832791 8056829672 Bacteria 9045328
233 JGI24739J22299_10015551
234 rootH1_10003969
235 rootH2_10109501
236 rootH1_10240122
237 JGI25160J50197_1007701
238 JGI25160J50197_1011935
239 Ga0006562J51391_1062332
240 Ga0068856_100337513
241 Ga0075368_10001399
242 Ga0075367_10003898
243 Ga0182007_10000862
244 Ga0183367_1003
245 Ga0207426_1001508
246 Ga0207426_1006273
247 Ga0207647_10114036
248 Ga0207702_10293989
249 Ga0209371_1010786
250 Ga0307517_10005627
251 Ga0307517_10018306
252 Ga0307515_10000189
253 Ga0307515_10015190
254 Ga0307515_10113011
255 Ga0307511_10000618
256 Ga0307512_10043870
257 Ga0307512_10133671
258 Ga0307513_10012710
259 Ga0307513_10131641
260 Ga0307509_10002865
261 Ga0307509_10038821
262 Ga0307509_10148381
263 Ga0307508_10174112
264 Ga0307514_10052067
265 Ga0307518_10005975
266 Ga0307518_10043002
267 Ga0307510_10001655
268 Ga0395898_0005101
269 Ga0395898_0005266
270 Ga0439436_0002212
271 Ga0439436_0005918
272 Ga0439433_0004442
273 Ga0439442_014114
274 Ga0439449_0000531
275 Ga0439455_0003393
276 Ga0439457_000060
277 Ga0439457_002136
278 Ga0439462_0003480
279 Ga0450894_000999
280 Ga0450898_000489
281 Ga0450899_000460
282 Ga0450903_000359
283 Ga0466972_0013712
284 Ga0466972_0055665
285 Ga0466965_0025932
286 Ga0466965_0037122
287 Ga0466961_0024321
288 Ga0466963_0000455
289 Ga0466971_0104890
290 Ga0466970_0040639
291 Ga0466960_0004662
292 Ga0495592_0008174
293 Ga0495592_0056661
294 Ga0495603_0000444
295 Ga0495603_0029331
296 Ga0495603_0059464
297 Ga0495603_0082940
298 Ga0495629_0006630
299 Ga0495629_0010025
300 Ga0495629_0012056
301 Ga0495638_0115828
302 Ga0495580_0038008
303 Ga0495582_0157912
304 Ga0495639_0014926
305 Ga0495662_0039909
306 Ga0495594_0009563
307 Ga0495594_0044690
308 Ga0495594_0102716
309 Ga0495583_0015207
310 Ga0495620_0002914
311 Ga0495643_0021727
312 Ga0495648_0037098
313 Ga0495642_0075498
314 Ga0495652_0103474
315 Ga0495640_0008650
316 Ga0495587_0000417
317 Ga0495597_0020343
318 Ga0495645_0116693
319 Ga0495622_0005637
320 Ga0495668_0023971
321 Ga0495611_0009365
322 Ga0495635_0001518
323 Ga0495635_0112399
324 Ga0495588_0019428
325 Ga0495588_0067177
326 Ga0495657_0002021
327 Ga0495657_0008860
328 Ga0495657_0026016
329 Ga0495658_0102754
330 Ga0495613_0004200
331 Ga0495613_0010608
332 Ga0495613_0053001
333 Ga0495624_0064590
334 Ga0495649_0023863
335 Ga0495649_0115913
336 Ga0495589_0071897
337 Ga0495600_0020502
338 Ga0495600_0096314
339 Ga0495581_0112607
340 Ga0495604_0000269
341 Ga0495604_0012772
342 Ga0495636_0001909
343 Ga0495674_0146371
344 Ga0495676_0006297
345 Ga0495676_0008584
346 Ga0495676_0021871
347 Ga0495676_0033378
348 Ga0495675_0060826
349 Ga0495675_0070251
350 Ga0495685_005876
351 Ga0495685_013139
352 Ga0495686_0095059
353 Ga0495593_0038452
354 Ga0495614_0000381
355 Ga0495614_0008698
356 Ga0496108_0170812
357 Ga0496109_0025334
358 Ga0501031_0007510
359 Ga0501032_0010512
360 Ga0501033_0000850
361 Ga0501033_0029808
362 Ga0501033_0151479
363 Ga0501034_0002805
364 Ga0501034_0012087
365 Ga0501034_0163023
366 Ga0501036_0004043
367 Ga0501036_0009721
368 Ga0501036_0012614
369 Ga0501037_0009587
370 Ga0501037_0030150
371 Ga0501037_0030636
372 Ga0501038_0000469
373 Ga0501038_0007194
374 Ga0501038_0029417
375 Ga0501039_0002941
376 Ga0501039_0034610
377 Ga0501043_0001527
378 Ga0501043_0005883
379 Ga0501043_0152674
380 Ga0501046_0008759
381 Ga0501047_0004636
382 Ga0501047_0011972
383 Ga0501047_0013582
384 Ga0501047_0016286
385 Ga0501048_0012056
386 Ga0501070_0013865
387 Ga0501074_0001432
388 Ga0501080_0040438
389 Ga0501035_0005920
390 Ga0501035_0127140
391 Ga0501044_0003487
392 Ga0501044_0004671
393 Ga0501044_0022651
394 nmdc:mga06z11_1896_c1
395 nmdc:mga04h51_3246_c1
396 Ga0500553_030356
397 Ga0500572_007872
398 Ga0500634_0038023
399 Ga0501084_0274615
400 2954718890
401 2547408666
402 2554259930
403 2585300693
404 2585306460
405 2585320380
406 2616693340
407 2643764242
408 2643898965
409 2643947383
410 2644263302
411 2644386177
412 2644403475
413 2644433146
414 2644458698
415 2768643956
416 2784586320
417 2785346490
418 2785366552
419 2786667633
420 2804849345
421 2808917908
422 2809229819
423 2811846638
424 2812360872
425 2812482768
426 2819698573
427 2852639406
428 2862181040
429 2862282650
430 2862292001
431 2862580485
432 2862706332
433 2863408080
434 2867435185
435 2867478010
436 2873157970
437 2875392277
438 2877683994
439 2912726636
440 2918502127
441 2946052599
442 2946064997
443 2954389294
444 2954673773
445 2954690217
446 2954700067
447 2954702153
448 2954728860
449 2954732952
450 2954747759
451 2954751829
452 2954766882
453 2990045655
454 2990088825
455 2997605877
456 3006494654
457 8008488167
458 8008560599
459 8023630656
460 8025415999
461 8025527243
462 8048407253
463 8056669978
464 8056832791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

262

433

0.92

PF07690

MFS_1

Major Facilitator Superfamily

56

276

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.8504 1 369
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.8441 1 369
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8359 14 365
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.8297 5 365
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8292 6 365
ID Description Score Start End Superfamily
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9439 10 185 1.20.1250.20
af_P75810_211_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9299 199 369 1.20.1250.20
af_A0A1D6E9C8_1_113_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9278 238 317 1.20.1250.20
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9092 10 185 1.20.1250.20
af_Q7XKJ7_33_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9021 202 363 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0C2AF08-F1-model_v4 deleted 0.9829 6 344
AF-A0A7K3CZU6-F1-model_v4 MFS transporter 0.9826 1 192 GO:0016020
GO:0022857
AF-A0A170V6I3-F1-model_v4 Transporter 0.9758 6 369 GO:0016020
GO:0022857
AF-A0A0M8VVF3-F1-model_v4 Transporter 0.9741 23 368 GO:0016020
GO:0022857
AF-A0A1G6XD08-F1-model_v4 Cyanate permease 0.9697 19 368 GO:0016020
GO:0022857

Map