F345455

General Info

Members Datasets Scaffolds Average Seq Length
232 150 464 209

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0162035|Ga0496110_0162035_1027_1734
Length 235
Sequence VTGGFAGERRCVPFGAGFKGESDMSGFHEVRFPLRVALGASGGPVRRTDIVNLSNGREQRNQRWRDSRRSYDAGSGIRSLTDLYAVLEFFEARRGQLYGFRFRDPVDWASCAPGGTVSAQDQVIGTGDGATAAFSLVKAYQDAGGGWTRRIAKPVAGTVVVSVDGVEVSETAYSVDVTTGIVTFAAAHVPDAGALVQAGYEFDVPVRFDIDRIDVNLAHFDAGRIPSIPLTEILA

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
22 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
23 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
33 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
35 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
36 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
37 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
41 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
42 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
43 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
44 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
45 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
46 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
47 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
48 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
49 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
50 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
51 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
55 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
56 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
57 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
58 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
59 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
60 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
61 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
62 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
63 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
64 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
85 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
86 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
87 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
88 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
91 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
92 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
93 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
94 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
95 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
96 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
97 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
98 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
99 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
100 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
101 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
102 2643221582 Rhizobium sp. Root651 Isolate Unclassified
103 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
104 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
105 2738541293 Rhizobium sp. GV031 Isolate Unclassified
106 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
107 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
108 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
109 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
110 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
111 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
112 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
113 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
114 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
115 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
116 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
117 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
118 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
119 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
120 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
121 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
122 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
123 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
124 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
125 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
126 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
127 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
128 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
129 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
130 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
131 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
132 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
133 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
134 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
135 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
136 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
137 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
138 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
139 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
140 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
141 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
142 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
143 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
144 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
145 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
146 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
147 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
148 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
149 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
150 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.14
Metatranscriptomes 0.43
Isolates 25.43

Biome Distribution

Category Percentage (%)
Aerial Root 1.72
Bulb 0
Endosphere 23.71
Nodule 12.93
Rhizoplane 4.74
Rhizosphere 24.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0162035 3300048913 Bacteria 2028
2 JGI25152J39213_1002207 3300002773 Bacteria 7569
3 JGI25150J39212_1000361 3300002774 Bacteria 22328
4 JGI25151J46595_10000062 3300003187 Bacteria 146687
5 JGI25151J46595_10011464 3300003187 Bacteria 4073
6 JGI25153J46596_10001133 3300003215 Bacteria 16132
7 rootH1_10221144 3300003323 Bacteria 3290
8 Ga0006562J51391_1116551 3300003578 Bacteria 1645
9 Ga0055526_1024505 3300003771 Bacteria 1971
10 Ga0055526_1031159 3300003771 Bacteria 1536
11 Ga0055524_1009916 3300003775 Bacteria 3831
12 Ga0055524_1049793 3300003775 Bacteria 962
13 Ga0055536_1014875 3300003781 Bacteria 2700
14 Ga0055528_1000607 3300003790 Bacteria 26876
15 Ga0055540_1018400 3300003792 Bacteria 1915
16 Ga0055531_10001997 3300003794 Bacteria 14175
17 Ga0058692_1000641 3300003856 Bacteria 14417
18 Ga0058692_1014772 3300003856 Bacteria 1780
19 Ga0065165_1009988 3300005262 Bacteria 4173
20 Ga0065165_1020102 3300005262 Bacteria 2363
21 Ga0075365_10000488 3300006038 Bacteria 15084
22 Ga0075365_10310067 3300006038 Bacteria 1111
23 Ga0075367_10145349 3300006178 Bacteria 1470
24 Ga0075370_10319023 3300006353 Bacteria 925
25 Ga0079104_1000010 3300006946 Bacteria 366021
26 Ga0099826_10000030 3300006948 Bacteria 128684
27 Ga0099826_10061625 3300006948 Bacteria 2436
28 Ga0207425_1000031 3300025245 Bacteria 261181
29 Ga0209129_1000053 3300025258 Bacteria 262823
30 Ga0209129_1000125 3300025258 Bacteria 133506
31 Ga0209673_1000122 3300025273 Bacteria 170443
32 Ga0209673_1002166 3300025273 Bacteria 14522
33 Ga0209676_1021739 3300025292 Bacteria 2144
34 Ga0209676_1026557 3300025292 Bacteria 1837
35 Ga0209025_1000074 3300025294 Bacteria 277445
36 Ga0209025_1000080 3300025294 Bacteria 267244
37 Ga0209025_1000087 3300025294 Bacteria 261181
38 Ga0209025_1000953 3300025294 Bacteria 43794
39 Ga0209564_1002198 3300025295 Bacteria 16300
40 Ga0209564_1027262 3300025295 Bacteria 1860
41 Ga0209758_1000081 3300025297 Bacteria 261181
42 Ga0209758_1000121 3300025297 Bacteria 192028
43 Ga0209050_1018634 3300025298 Bacteria 2684
44 Ga0209256_1001198 3300025299 Bacteria 29038
45 Ga0209256_1002568 3300025299 Bacteria 14509
46 Ga0209256_1027215 3300025299 Bacteria 1633
47 Ga0209051_1007083 3300025303 Bacteria 6200
48 Ga0209257_1009091 3300025304 Bacteria 5433
49 Ga0209257_1015795 3300025304 Bacteria 3106
50 Ga0209281_1000053 3300027111 Bacteria 309587
51 Ga0209371_1000009 3300027312 Bacteria 963030
52 Ga0209371_1001344 3300027312 Bacteria 17077
53 Ga0209282_1000222 3300027666 Bacteria 29551
54 Ga0209282_1077548 3300027666 Bacteria 1786
55 Ga0209813_10099327 3300027866 Bacteria 988
56 Ga0268256_1000010 3300030500 Bacteria 963034
57 Ga0268256_1002555 3300030500 Bacteria 9117
58 Ga0316181_1139846 3300030744 Bacteria 1564
59 Ga0307406_10013111 3300031901 Bacteria 4740
60 Ga0307412_10000890 3300031911 Bacteria 17185
61 Ga0466968_0219692 3300044735 Bacteria 895
62 Ga0495606_0003609 3300046507 Bacteria 16271
63 Ga0495606_0298298 3300046507 Bacteria 874
64 Ga0495620_0036259 3300046515 Bacteria 2208
65 Ga0495632_0004017 3300046519 Bacteria 10165
66 Ga0495632_0016098 3300046519 Bacteria 4170
67 Ga0495643_0007635 3300046522 Bacteria 6947
68 Ga0495643_0113595 3300046522 Bacteria 1375
69 Ga0495654_0000130 3300046530 Bacteria 81643
70 Ga0495633_0020050 3300046558 Bacteria 3369
71 Ga0495633_0032519 3300046558 Bacteria 2519
72 Ga0495588_0000397 3300046674 Bacteria 24653
73 Ga0495671_0019944 3300046692 Bacteria 3538
74 Ga0495673_0025341 3300047469 Bacteria 2850
75 Ga0495681_0003569 3300047470 Bacteria 10825
76 Ga0495686_0000613 3300047472 Bacteria 49253
77 Ga0495686_0001574 3300047472 Bacteria 24183
78 Ga0495686_0047106 3300047472 Bacteria 2723
79 Ga0495686_0100326 3300047472 Bacteria 1747
80 Ga0495686_0181287 3300047472 Bacteria 1220
81 Ga0495686_0217558 3300047472 Bacteria 1088
82 Ga0495686_0247549 3300047472 Bacteria 1003
83 Ga0496101_0226894 3300048904 Bacteria 1451
84 Ga0496102_0413691 3300048905 Bacteria 1267
85 Ga0496104_0049905 3300048907 Bacteria 3947
86 Ga0496104_0716088 3300048907 Bacteria 908
87 Ga0496106_0198355 3300048909 Bacteria 1597
88 Ga0496107_0042637 3300048910 Bacteria 3259
89 Ga0496111_0003557 3300048914 Bacteria 9647
90 Ga0496114_0079691 3300048917 Bacteria 2765
91 Ga0496116_0002344 3300048919 Bacteria 20048
92 Ga0496116_0002518 3300048919 Bacteria 19170
93 Ga0496116_0006212 3300048919 Bacteria 10914
94 Ga0496116_0023334 3300048919 Bacteria 4608
95 Ga0496116_0037412 3300048919 Bacteria 3385
96 Ga0496116_0047231 3300048919 Bacteria 2899
97 Ga0496117_0007566 3300048920 Bacteria 10574
98 Ga0496117_0009653 3300048920 Bacteria 8929
99 Ga0496117_0031603 3300048920 Bacteria 4038
100 Ga0496118_0004628 3300048921 Bacteria 16152
101 Ga0496118_0010405 3300048921 Bacteria 9219
102 Ga0496118_0013362 3300048921 Bacteria 7772
103 Ga0496118_0297590 3300048921 Bacteria 888
104 Ga0496119_0180342 3300048922 Bacteria 1108
105 Ga0496119_0305889 3300048922 Bacteria 782
106 Ga0496119_0327845 3300048922 Bacteria 747
107 Ga0496120_0065539 3300048923 Bacteria 2012
108 Ga0496121_0000662 3300048924 Bacteria 64326
109 Ga0496121_0005597 3300048924 Bacteria 16031
110 Ga0496121_0013032 3300048924 Bacteria 8979
111 Ga0496121_0016402 3300048924 Bacteria 7653
112 Ga0496121_0048681 3300048924 Bacteria 3604
113 Ga0496121_0052687 3300048924 Bacteria 3414
114 Ga0496121_0096030 3300048924 Bacteria 2301
115 Ga0496121_0140592 3300048924 Bacteria 1792
116 Ga0496121_0144258 3300048924 Bacteria 1761
117 Ga0496121_0144270 3300048924 Bacteria 1761
118 Ga0496122_0000009 3300048925 Bacteria 584024
119 Ga0496122_0004312 3300048925 Bacteria 17816
120 Ga0496122_0005649 3300048925 Bacteria 14764
121 Ga0496122_0009037 3300048925 Bacteria 10578
122 Ga0496122_0009128 3300048925 Bacteria 10512
123 Ga0496122_0010821 3300048925 Bacteria 9343
124 Ga0496123_0000245 3300048926 Bacteria 109471
125 Ga0496123_0003667 3300048926 Bacteria 16946
126 Ga0496123_0009260 3300048926 Bacteria 8897
127 Ga0496123_0053870 3300048926 Bacteria 2654
128 Ga0496124_0000133 3300048927 Bacteria 154328
129 Ga0496124_0002504 3300048927 Bacteria 23903
130 Ga0496124_0002757 3300048927 Bacteria 22367
131 Ga0496124_0006728 3300048927 Bacteria 12435
132 Ga0496124_0009340 3300048927 Bacteria 10104
133 Ga0496124_0033118 3300048927 Bacteria 4550
134 Ga0496124_0049232 3300048927 Bacteria 3596
135 Ga0496124_0085694 3300048927 Bacteria 2581
136 Ga0496124_0114177 3300048927 Bacteria 2169
137 Ga0496124_0144533 3300048927 Bacteria 1873
138 Ga0496124_0181232 3300048927 Bacteria 1621
139 Ga0496124_0258750 3300048927 Bacteria 1282
140 Ga0496125_0001996 3300048928 Bacteria 27672
141 Ga0496125_0020060 3300048928 Bacteria 6284
142 Ga0496125_0173786 3300048928 Bacteria 1444
143 Ga0496126_0081603 3300048929 Bacteria 2858
144 Ga0496126_0274306 3300048929 Bacteria 1399
145 Ga0496126_0387452 3300048929 Bacteria 1136
146 Ga0495678_022228 3300049459 Bacteria 2776
147 Ga0501031_0175746 3300049568 Bacteria 1399
148 Ga0501033_0000038 3300049570 Bacteria 144438
149 Ga0501033_0065194 3300049570 Bacteria 2680
150 Ga0501038_0158104 3300049574 Bacteria 1844
151 Ga0501040_0166422 3300049576 Bacteria 1560
152 Ga0501046_0148705 3300049580 Bacteria 1768
153 Ga0501047_0103549 3300049581 Bacteria 2727
154 Ga0501048_0138888 3300049582 Bacteria 1718
155 Ga0501071_0079864 3300049587 Bacteria 2392
156 Ga0501074_0217323 3300049590 Bacteria 1361
157 Ga0501080_0154535 3300049742 Bacteria 2120
158 Ga0501035_0004626 3300049822 Bacteria 13048
159 Ga0501044_0181101 3300049823 Bacteria 2074
160 Ga0501044_0891356 3300049823 Bacteria 765
161 nmdc:mga0yw44_158161_c1 3300050492 Bacteria 1482
162 nmdc:mga0yw44_816_c1 3300050492 Bacteria 11605
163 nmdc:mga04h51_152406_c1 3300050495 Bacteria 884
164 Ga0500556_0152847 3300053104 Bacteria 910
165 Ga0500560_000800 3300053107 Bacteria 4825
166 Ga0500618_000055 3300053125 Bacteria 99876
167 Ga0500618_000812 3300053125 Bacteria 17176
168 Ga0500618_003697 3300053125 Bacteria 5155
169 Ga0500618_027963 3300053125 Bacteria 1339
170 Ga0500573_0068441 3300053140 Bacteria 2027
171 Ga0500616_0001430 3300053153 Bacteria 22933
172 Ga0500624_000427 3300053157 Bacteria 12837
173 Ga0500634_0034613 3300053161 Bacteria 2752
174 2511173160 2510917026 Bacteria 7046020
175 2535515587 2534681796 Bacteria 7146037
176 2537874530 2537561587 Bacteria 5425293
177 2585202949 2582581294 Bacteria 6626667
178 2585256734 2582581304 Bacteria 5831370
179 2585847337 2585427594 Bacteria 6180594
180 2585994963 2585427633 Bacteria 6413184
181 2585999506 2585427634 Bacteria 6455027
182 2601608802 2600255279 Bacteria 5605316
183 2601745576 2600255308 Bacteria 5611129
184 2643918586 2643221582 Bacteria 5804683
185 2644191055 2643221634 Bacteria 6705461
186 2644242762 2643221643 Bacteria 5749658
187 2738803614 2738541293 Bacteria 7065685
188 2776912598 2775507049 Bacteria 6284736
189 2819556130 2818991439 Bacteria 6907412
190 2819684293 2818991461 Bacteria 7026071
191 2821124120 2821123053 Bacteria 7836056
192 2837652564 2837651117 Bacteria 3772164
193 2838676857 2838675328 Bacteria 4909118
194 2838715742 2838714209 Bacteria 5525906
195 2838720457 2838719591 Bacteria 5523910
196 2838726497 2838724970 Bacteria 4908691
197 2838738856 2838736955 Bacteria 5760694
198 2841842755 2841840854 Bacteria 5761912
199 2841847387 2841846520 Bacteria 5345850
200 2841860074 2841859092 Bacteria 5436171
201 2842126583 2842124991 Bacteria 5346824
202 2842131750 2842130223 Bacteria 4909145
203 2842142535 2842140634 Bacteria 5759631
204 2842153081 2842152218 Bacteria 4908957
205 2842171986 2842170452 Bacteria 5525737
206 2842176700 2842175837 Bacteria 4908771
207 2842188851 2842187318 Bacteria 5524014
208 2842213163 2842211629 Bacteria 5523832
209 2842225219 2842224351 Bacteria 5524473
210 2842516859 2842515876 Bacteria 5436280
211 2857531701 2857531043 Bacteria 6754041
212 2891051978 2891048133 Bacteria 4447501
213 2899792142 2899792073 Bacteria 4926588
214 2919115946 2919114240 Bacteria 5700270
215 2919171585 2919171160 Bacteria 6499771
216 2926756900 2926754445 Bacteria 5964435
217 2933007724 2933006813 Bacteria 4912075
218 2933012499 2933011516 Bacteria 5439334
219 2933594939 2933594066 Bacteria 5594265
220 2979105573 2979100975 Bacteria 5423623
221 2984512580 2984509177 Bacteria 5274802
222 2984521060 2984518228 Bacteria 5277463
223 2984540354 2984537506 Bacteria 5277481
224 2984602551 2984601300 Bacteria 5455244
225 2995394943 2995392953 Bacteria 4539380
226 3005412261 3005409236 Bacteria 7188837
227 8003570447 8003570095 Bacteria 5747666
228 8005544216 8005542996 Bacteria 7077758
229 8018150738 8018150411 Bacteria 5549903
230 8024489876 8024486573 Bacteria 6540512
231 8055434048 8055431914 Bacteria 4551896
232 8056880001 8056875544 Bacteria 4355797
233 Ga0496110_0162035
234 JGI25152J39213_1002207
235 JGI25150J39212_1000361
236 JGI25151J46595_10000062
237 JGI25151J46595_10011464
238 JGI25153J46596_10001133
239 rootH1_10221144
240 Ga0006562J51391_1116551
241 Ga0055526_1024505
242 Ga0055526_1031159
243 Ga0055524_1009916
244 Ga0055524_1049793
245 Ga0055536_1014875
246 Ga0055528_1000607
247 Ga0055540_1018400
248 Ga0055531_10001997
249 Ga0058692_1000641
250 Ga0058692_1014772
251 Ga0065165_1009988
252 Ga0065165_1020102
253 Ga0075365_10000488
254 Ga0075365_10310067
255 Ga0075367_10145349
256 Ga0075370_10319023
257 Ga0079104_1000010
258 Ga0099826_10000030
259 Ga0099826_10061625
260 Ga0207425_1000031
261 Ga0209129_1000053
262 Ga0209129_1000125
263 Ga0209673_1000122
264 Ga0209673_1002166
265 Ga0209676_1021739
266 Ga0209676_1026557
267 Ga0209025_1000074
268 Ga0209025_1000080
269 Ga0209025_1000087
270 Ga0209025_1000953
271 Ga0209564_1002198
272 Ga0209564_1027262
273 Ga0209758_1000081
274 Ga0209758_1000121
275 Ga0209050_1018634
276 Ga0209256_1001198
277 Ga0209256_1002568
278 Ga0209256_1027215
279 Ga0209051_1007083
280 Ga0209257_1009091
281 Ga0209257_1015795
282 Ga0209281_1000053
283 Ga0209371_1000009
284 Ga0209371_1001344
285 Ga0209282_1000222
286 Ga0209282_1077548
287 Ga0209813_10099327
288 Ga0268256_1000010
289 Ga0268256_1002555
290 Ga0316181_1139846
291 Ga0307406_10013111
292 Ga0307412_10000890
293 Ga0466968_0219692
294 Ga0495606_0003609
295 Ga0495606_0298298
296 Ga0495620_0036259
297 Ga0495632_0004017
298 Ga0495632_0016098
299 Ga0495643_0007635
300 Ga0495643_0113595
301 Ga0495654_0000130
302 Ga0495633_0020050
303 Ga0495633_0032519
304 Ga0495588_0000397
305 Ga0495671_0019944
306 Ga0495673_0025341
307 Ga0495681_0003569
308 Ga0495686_0000613
309 Ga0495686_0001574
310 Ga0495686_0047106
311 Ga0495686_0100326
312 Ga0495686_0181287
313 Ga0495686_0217558
314 Ga0495686_0247549
315 Ga0496101_0226894
316 Ga0496102_0413691
317 Ga0496104_0049905
318 Ga0496104_0716088
319 Ga0496106_0198355
320 Ga0496107_0042637
321 Ga0496111_0003557
322 Ga0496114_0079691
323 Ga0496116_0002344
324 Ga0496116_0002518
325 Ga0496116_0006212
326 Ga0496116_0023334
327 Ga0496116_0037412
328 Ga0496116_0047231
329 Ga0496117_0007566
330 Ga0496117_0009653
331 Ga0496117_0031603
332 Ga0496118_0004628
333 Ga0496118_0010405
334 Ga0496118_0013362
335 Ga0496118_0297590
336 Ga0496119_0180342
337 Ga0496119_0305889
338 Ga0496119_0327845
339 Ga0496120_0065539
340 Ga0496121_0000662
341 Ga0496121_0005597
342 Ga0496121_0013032
343 Ga0496121_0016402
344 Ga0496121_0048681
345 Ga0496121_0052687
346 Ga0496121_0096030
347 Ga0496121_0140592
348 Ga0496121_0144258
349 Ga0496121_0144270
350 Ga0496122_0000009
351 Ga0496122_0004312
352 Ga0496122_0005649
353 Ga0496122_0009037
354 Ga0496122_0009128
355 Ga0496122_0010821
356 Ga0496123_0000245
357 Ga0496123_0003667
358 Ga0496123_0009260
359 Ga0496123_0053870
360 Ga0496124_0000133
361 Ga0496124_0002504
362 Ga0496124_0002757
363 Ga0496124_0006728
364 Ga0496124_0009340
365 Ga0496124_0033118
366 Ga0496124_0049232
367 Ga0496124_0085694
368 Ga0496124_0114177
369 Ga0496124_0144533
370 Ga0496124_0181232
371 Ga0496124_0258750
372 Ga0496125_0001996
373 Ga0496125_0020060
374 Ga0496125_0173786
375 Ga0496126_0081603
376 Ga0496126_0274306
377 Ga0496126_0387452
378 Ga0495678_022228
379 Ga0501031_0175746
380 Ga0501033_0000038
381 Ga0501033_0065194
382 Ga0501038_0158104
383 Ga0501040_0166422
384 Ga0501046_0148705
385 Ga0501047_0103549
386 Ga0501048_0138888
387 Ga0501071_0079864
388 Ga0501074_0217323
389 Ga0501080_0154535
390 Ga0501035_0004626
391 Ga0501044_0181101
392 Ga0501044_0891356
393 nmdc:mga0yw44_158161_c1
394 nmdc:mga0yw44_816_c1
395 nmdc:mga04h51_152406_c1
396 Ga0500556_0152847
397 Ga0500560_000800
398 Ga0500618_000055
399 Ga0500618_000812
400 Ga0500618_003697
401 Ga0500618_027963
402 Ga0500573_0068441
403 Ga0500616_0001430
404 Ga0500624_000427
405 Ga0500634_0034613
406 2511173160
407 2535515587
408 2537874530
409 2585202949
410 2585256734
411 2585847337
412 2585994963
413 2585999506
414 2601608802
415 2601745576
416 2643918586
417 2644191055
418 2644242762
419 2738803614
420 2776912598
421 2819556130
422 2819684293
423 2821124120
424 2837652564
425 2838676857
426 2838715742
427 2838720457
428 2838726497
429 2838738856
430 2841842755
431 2841847387
432 2841860074
433 2842126583
434 2842131750
435 2842142535
436 2842153081
437 2842171986
438 2842176700
439 2842188851
440 2842213163
441 2842225219
442 2842516859
443 2857531701
444 2891051978
445 2899792142
446 2919115946
447 2919171585
448 2926756900
449 2933007724
450 2933012499
451 2933594939
452 2979105573
453 2984512580
454 2984521060
455 2984540354
456 2984602551
457 2995394943
458 3005412261
459 8003570447
460 8005544216
461 8018150738
462 8024489876
463 8055434048
464 8056880001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09343

DUF2460

Conserved hypothetical protein 2217 (DUF2460)

28

234

1

Map