F345345

General Info

Members Datasets Scaffolds Average Seq Length
232 116 464 293

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0022643|Ga0466959_0022643_1056_1982
Length 295
Sequence MIYVEKPGAENRPLIRKILDFPLVTMVLALAIAILCFTVGMLIARFLLPSIPMLDQRLKFDLVSIPLLLLAYKFVISRMGAHPRDDYKDKKALRHVGLGLAAGFLVFSLAVGIAAILGVYRIIGKGDLSDFLPALIGPALFAAVSEELVFRGILFRWIEEFGGSWMALLITSAFFGAAHLLNPNASVIAAAGIATRSLWLPMGIHAAWNFTQGEIWDIPVSGLKVHGLVVARLTGYPLLTGNGFGLEASLIAIVVATVFGLYLLRLAILRGELVKPSWIRARSSSDQLDLAVESA

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.19
Rhizosphere 91.81
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0022643 3300045049 Bacteria 4646
2 MBSR1b_contig_3124817 2162886012 Unclassified 1136
3 Ga0070658_10021739 3300005327 Bacteria 5142
4 Ga0070658_10056288 3300005327 Bacteria 3195
5 Ga0070683_100034917 3300005329 Bacteria 4596
6 Ga0070690_100327313 3300005330 Bacteria 1106
7 Ga0070670_100024044 3300005331 Bacteria 5241
8 Ga0070670_100205862 3300005331 Bacteria 1710
9 Ga0070680_100011939 3300005336 Bacteria 6739
10 Ga0070680_100015136 3300005336 Bacteria 6041
11 Ga0070680_100044904 3300005336 Bacteria 3591
12 Ga0070680_100232377 3300005336 Bacteria 1558
13 Ga0070680_100357324 3300005336 Bacteria 1242
14 Ga0070682_100261850 3300005337 Bacteria 1252
15 Ga0068868_100051541 3300005338 Bacteria 3238
16 Ga0070660_100018130 3300005339 Bacteria 5138
17 Ga0070660_100069210 3300005339 Bacteria 2752
18 Ga0070660_100175880 3300005339 Unclassified 1731
19 Ga0070660_100193303 3300005339 Bacteria 1649
20 Ga0070660_100219864 3300005339 Bacteria 1544
21 Ga0070661_100010886 3300005344 Bacteria 6336
22 Ga0070661_100045961 3300005344 Bacteria 3193
23 Ga0070692_10030094 3300005345 Bacteria 2712
24 Ga0070675_100014605 3300005354 Bacteria 6192
25 Ga0070671_100005522 3300005355 Bacteria 10071
26 Ga0070671_100039211 3300005355 Bacteria 3932
27 Ga0070671_100198208 3300005355 Bacteria 1702
28 Ga0070674_100260844 3300005356 Bacteria 1365
29 Ga0070673_100017716 3300005364 Bacteria 5073
30 Ga0070673_100162118 3300005364 Unclassified 1902
31 Ga0070673_100218947 3300005364 Bacteria 1647
32 Ga0070673_100434190 3300005364 Unclassified 1179
33 Ga0070659_100010941 3300005366 Bacteria 6696
34 Ga0070659_100021561 3300005366 Bacteria 4908
35 Ga0070659_100291099 3300005366 Bacteria 1360
36 Ga0070667_100000836 3300005367 Bacteria 28641
37 Ga0070663_100051426 3300005455 Bacteria 2935
38 Ga0070678_100002055 3300005456 Bacteria 10907
39 Ga0070662_100033189 3300005457 Bacteria 3633
40 Ga0070662_100423340 3300005457 Unclassified 1102
41 Ga0070679_100315563 3300005530 Bacteria 1513
42 Ga0070679_100433917 3300005530 Unclassified 1259
43 Ga0070684_100007236 3300005535 Bacteria 8625
44 Ga0070684_100009573 3300005535 Bacteria 7634
45 Ga0068853_100066514 3300005539 Bacteria 3130
46 Ga0068853_100319324 3300005539 Bacteria 1439
47 Ga0070672_100231111 3300005543 Bacteria 1554
48 Ga0070665_100108137 3300005548 Bacteria 2783
49 Ga0068855_100052057 3300005563 Bacteria 4821
50 Ga0068855_100078583 3300005563 Bacteria 3827
51 Ga0068855_100217501 3300005563 Bacteria 2144
52 Ga0070664_100028257 3300005564 Bacteria 4665
53 Ga0070664_100031896 3300005564 Bacteria 4406
54 Ga0070664_100183004 3300005564 Bacteria 1863
55 Ga0068857_100004087 3300005577 Bacteria 12294
56 Ga0068857_100244133 3300005577 Bacteria 1645
57 Ga0068854_100142540 3300005578 Bacteria 1840
58 Ga0068856_100073171 3300005614 Bacteria 3393
59 Ga0068856_100092350 3300005614 Bacteria 3012
60 Ga0068856_100127574 3300005614 Bacteria 2547
61 Ga0068856_100388379 3300005614 Bacteria 1415
62 Ga0068852_100036841 3300005616 Bacteria 4097
63 Ga0068852_100137039 3300005616 Bacteria 2261
64 Ga0068859_100039058 3300005617 Bacteria 4760
65 Ga0068859_100050924 3300005617 Bacteria 4161
66 Ga0068851_10021767 3300005834 Bacteria 3115
67 Ga0068863_100007580 3300005841 Bacteria 10614
68 Ga0068860_100202535 3300005843 Unclassified 1924
69 Ga0097621_100042387 3300006237 Bacteria 3666
70 Ga0097621_100120330 3300006237 Bacteria 2226
71 Ga0068871_100034888 3300006358 Unclassified 3995
72 Ga0068865_100045360 3300006881 Bacteria 3013
73 Ga0097620_100039057 3300006931 Bacteria 4760
74 Ga0097620_100050920 3300006931 Bacteria 4161
75 Ga0105251_10080376 3300009011 Bacteria 1507
76 Ga0105245_10022426 3300009098 Bacteria 5543
77 Ga0105248_10049460 3300009177 Bacteria 4715
78 Ga0105248_10078965 3300009177 Bacteria 3699
79 Ga0105237_10256622 3300009545 Bacteria 1750
80 Ga0105238_10041752 3300009551 Bacteria 4646
81 Ga0105239_10338056 3300010375 Bacteria 1699
82 Ga0105246_10150690 3300011119 Bacteria 1760
83 Ga0157373_10113973 3300013100 Bacteria 1900
84 Ga0157371_10015749 3300013102 Bacteria 5659
85 Ga0157371_10090372 3300013102 Bacteria 2169
86 Ga0157371_10199567 3300013102 Bacteria 1434
87 Ga0157371_10210356 3300013102 Bacteria 1395
88 Ga0157370_10001258 3300013104 Bacteria 31653
89 Ga0157370_10064127 3300013104 Bacteria 3479
90 Ga0157370_10070635 3300013104 Bacteria 3296
91 Ga0157370_10072087 3300013104 Bacteria 3259
92 Ga0157370_10149227 3300013104 Bacteria 2176
93 Ga0157369_10037984 3300013105 Bacteria 5268
94 Ga0157369_10090434 3300013105 Bacteria 3268
95 Ga0157369_10290218 3300013105 Bacteria 1703
96 Ga0157369_10696519 3300013105 Bacteria 1046
97 Ga0157374_10008502 3300013296 Bacteria 8781
98 Ga0157378_10066974 3300013297 Bacteria 3217
99 Ga0163162_10014543 3300013306 Bacteria 7690
100 Ga0163162_10072294 3300013306 Bacteria 3504
101 Ga0163162_10157224 3300013306 Bacteria 2394
102 Ga0157372_10096704 3300013307 Bacteria 3366
103 Ga0157372_10143299 3300013307 Unclassified 2755
104 Ga0157375_10009604 3300013308 Bacteria 8498
105 Ga0157379_10019273 3300014968 Bacteria 6024
106 Ga0157379_10060698 3300014968 Bacteria 3381
107 Ga0207656_10042773 3300025321 Bacteria 1929
108 Ga0207688_10247850 3300025901 Bacteria 1078
109 Ga0207705_10210632 3300025909 Bacteria 1474
110 Ga0207671_10103918 3300025914 Bacteria 2155
111 Ga0207660_10000241 3300025917 Bacteria 35515
112 Ga0207660_10005125 3300025917 Bacteria 8525
113 Ga0207660_10078307 3300025917 Bacteria 2422
114 Ga0207660_10097082 3300025917 Bacteria 2195
115 Ga0207657_10036916 3300025919 Bacteria 4370
116 Ga0207657_10038926 3300025919 Bacteria 4228
117 Ga0207657_10199889 3300025919 Bacteria 1608
118 Ga0207649_10024924 3300025920 Bacteria 3482
119 Ga0207649_10094858 3300025920 Bacteria 1961
120 Ga0207652_10078378 3300025921 Bacteria 2885
121 Ga0207652_10564286 3300025921 Bacteria 1022
122 Ga0207650_10075973 3300025925 Bacteria 2537
123 Ga0207664_10112706 3300025929 Bacteria 2264
124 Ga0207644_10009062 3300025931 Bacteria 6524
125 Ga0207644_10017399 3300025931 Bacteria 4852
126 Ga0207644_10038812 3300025931 Bacteria 3357
127 Ga0207690_10017364 3300025932 Bacteria 4390
128 Ga0207690_10062551 3300025932 Bacteria 2534
129 Ga0207706_10064449 3300025933 Bacteria 3226
130 Ga0207706_10107068 3300025933 Bacteria 2460
131 Ga0207669_10015361 3300025937 Bacteria 3860
132 Ga0207669_10199173 3300025937 Bacteria 1452
133 Ga0207711_10004208 3300025941 Bacteria 12318
134 Ga0207661_10021760 3300025944 Bacteria 4811
135 Ga0207679_10108103 3300025945 Bacteria 2189
136 Ga0207667_10069929 3300025949 Bacteria 3654
137 Ga0207667_10086927 3300025949 Bacteria 3234
138 Ga0207667_10534366 3300025949 Bacteria 1187
139 Ga0207640_10121022 3300025981 Bacteria 1875
140 Ga0207658_10076630 3300025986 Unclassified 2548
141 Ga0207639_10053144 3300026041 Bacteria 3089
142 Ga0207678_10049714 3300026067 Bacteria 3624
143 Ga0207702_10018861 3300026078 Bacteria 5707
144 Ga0207702_10398510 3300026078 Bacteria 1327
145 Ga0207676_10023049 3300026095 Bacteria 4586
146 Ga0207674_10000344 3300026116 Bacteria 59855
147 Ga0207674_10130769 3300026116 Bacteria 2473
148 Ga0207683_10008629 3300026121 Bacteria 8714
149 Ga0207698_10015856 3300026142 Bacteria 5063
150 Ga0207698_10064737 3300026142 Bacteria 2867
151 Ga0207698_10130171 3300026142 Unclassified 2149
152 Ga0268266_10275668 3300028379 Unclassified 1562
153 Ga0268264_10148696 3300028381 Bacteria 2098
154 Ga0307406_10013462 3300031901 Bacteria 4686
155 Ga0373931_0145795 3300035691 Unclassified 1376
156 Ga0395899_0007951 3300037312 Bacteria 8167
157 Ga0395899_0017261 3300037312 Bacteria 5501
158 Ga0395899_0028562 3300037312 Bacteria 4199
159 Ga0395899_0068569 3300037312 Unclassified 2600
160 Ga0395899_0091181 3300037312 Bacteria 2208
161 Ga0395899_0293454 3300037312 Bacteria 1102
162 Ga0395900_0005640 3300037418 Bacteria 13093
163 Ga0395900_0008433 3300037418 Bacteria 10601
164 Ga0395900_0019137 3300037418 Bacteria 6983
165 Ga0395900_0030392 3300037418 Bacteria 5547
166 Ga0395900_0041208 3300037418 Bacteria 4761
167 Ga0395900_0046161 3300037418 Bacteria 4486
168 Ga0395900_0082818 3300037418 Bacteria 3296
169 Ga0395900_0116674 3300037418 Bacteria 2739
170 Ga0395900_0117384 3300037418 Bacteria 2730
171 Ga0395900_0426839 3300037418 Bacteria 1285
172 Ga0395900_0492672 3300037418 Bacteria 1177
173 Ga0395900_0621624 3300037418 Unclassified 1019
174 Ga0395898_0049627 3300037466 Bacteria 4111
175 Ga0395898_0067787 3300037466 Bacteria 3454
176 Ga0395898_0075686 3300037466 Bacteria 3251
177 Ga0395898_0292630 3300037466 Bacteria 1553
178 Ga0395898_0328799 3300037466 Bacteria 1458
179 Ga0395905_0001939 3300037471 Bacteria 23712
180 Ga0395905_0006622 3300037471 Bacteria 11620
181 Ga0395905_0006816 3300037471 Bacteria 11438
182 Ga0395905_0011331 3300037471 Bacteria 8622
183 Ga0395905_0021838 3300037471 Bacteria 6054
184 Ga0395905_0041771 3300037471 Bacteria 4303
185 Ga0395905_0044412 3300037471 Bacteria 4171
186 Ga0395905_0061568 3300037471 Bacteria 3511
187 Ga0395905_0104853 3300037471 Bacteria 2654
188 Ga0395905_0110574 3300037471 Bacteria 2580
189 Ga0395905_0137211 3300037471 Bacteria 2301
190 Ga0395905_0311420 3300037471 Bacteria 1463
191 Ga0395905_0387669 3300037471 Bacteria 1291
192 Ga0395901_0002717 3300038443 Bacteria 17820
193 Ga0395901_0015583 3300038443 Bacteria 7742
194 Ga0395901_0071656 3300038443 Bacteria 3611
195 Ga0395901_0130699 3300038443 Bacteria 2638
196 Ga0395901_0249931 3300038443 Bacteria 1848
197 Ga0395901_0481002 3300038443 Bacteria 1266
198 Ga0466972_0061063 3300044658 Bacteria 1808
199 Ga0466963_0015857 3300044694 Bacteria 4677
200 Ga0466963_0021753 3300044694 Bacteria 4050
201 Ga0466963_0042154 3300044694 Bacteria 2996
202 Ga0466957_0078102 3300044842 Unclassified 2058
203 Ga0466957_0139548 3300044842 Bacteria 1561
204 Ga0466960_0156428 3300044901 Bacteria 1221
205 Ga0466958_0029113 3300045836 Bacteria 3276
206 Ga0466967_0149983 3300045976 Bacteria 2178
207 Ga0466967_0375659 3300045976 Bacteria 1379
208 Ga0495598_0006669 3300046537 Bacteria 2616
209 Ga0495621_0024687 3300046539 Bacteria 2010
210 Ga0495669_0078637 3300046684 Bacteria 1511
211 Ga0495670_0041773 3300046691 Bacteria 2288
212 Ga0496100_0007291 3300048903 Bacteria 6086
213 Ga0496100_0274720 3300048903 Bacteria 1254
214 Ga0496101_0003562 3300048904 Bacteria 9716
215 Ga0496102_0035525 3300048905 Bacteria 4486
216 Ga0496104_0122115 3300048907 Bacteria 2501
217 Ga0496106_0091374 3300048909 Bacteria 2350
218 Ga0496106_0197583 3300048909 Bacteria 1600
219 Ga0496108_0019713 3300048911 Bacteria 5539
220 Ga0496108_0022233 3300048911 Bacteria 5214
221 Ga0496108_0059279 3300048911 Bacteria 3218
222 Ga0496109_0015529 3300048912 Bacteria 6638
223 Ga0496109_0245555 3300048912 Bacteria 1685
224 Ga0496110_0019377 3300048913 Bacteria 5723
225 Ga0496112_0019187 3300048915 Bacteria 6448
226 Ga0496112_0077619 3300048915 Bacteria 3284
227 Ga0496112_0309313 3300048915 Unclassified 1525
228 Ga0496113_0021500 3300048916 Bacteria 4552
229 Ga0496113_0071211 3300048916 Bacteria 2644
230 Ga0496114_0000206 3300048917 Bacteria 42865
231 Ga0501070_0083275 3300049586 Bacteria 2648
232 Ga0501071_0020102 3300049587 Bacteria 4640
233 Ga0466959_0022643
234 MBSR1b_contig_3124817
235 Ga0070658_10021739
236 Ga0070658_10056288
237 Ga0070683_100034917
238 Ga0070690_100327313
239 Ga0070670_100024044
240 Ga0070670_100205862
241 Ga0070680_100011939
242 Ga0070680_100015136
243 Ga0070680_100044904
244 Ga0070680_100232377
245 Ga0070680_100357324
246 Ga0070682_100261850
247 Ga0068868_100051541
248 Ga0070660_100018130
249 Ga0070660_100069210
250 Ga0070660_100175880
251 Ga0070660_100193303
252 Ga0070660_100219864
253 Ga0070661_100010886
254 Ga0070661_100045961
255 Ga0070692_10030094
256 Ga0070675_100014605
257 Ga0070671_100005522
258 Ga0070671_100039211
259 Ga0070671_100198208
260 Ga0070674_100260844
261 Ga0070673_100017716
262 Ga0070673_100162118
263 Ga0070673_100218947
264 Ga0070673_100434190
265 Ga0070659_100010941
266 Ga0070659_100021561
267 Ga0070659_100291099
268 Ga0070667_100000836
269 Ga0070663_100051426
270 Ga0070678_100002055
271 Ga0070662_100033189
272 Ga0070662_100423340
273 Ga0070679_100315563
274 Ga0070679_100433917
275 Ga0070684_100007236
276 Ga0070684_100009573
277 Ga0068853_100066514
278 Ga0068853_100319324
279 Ga0070672_100231111
280 Ga0070665_100108137
281 Ga0068855_100052057
282 Ga0068855_100078583
283 Ga0068855_100217501
284 Ga0070664_100028257
285 Ga0070664_100031896
286 Ga0070664_100183004
287 Ga0068857_100004087
288 Ga0068857_100244133
289 Ga0068854_100142540
290 Ga0068856_100073171
291 Ga0068856_100092350
292 Ga0068856_100127574
293 Ga0068856_100388379
294 Ga0068852_100036841
295 Ga0068852_100137039
296 Ga0068859_100039058
297 Ga0068859_100050924
298 Ga0068851_10021767
299 Ga0068863_100007580
300 Ga0068860_100202535
301 Ga0097621_100042387
302 Ga0097621_100120330
303 Ga0068871_100034888
304 Ga0068865_100045360
305 Ga0097620_100039057
306 Ga0097620_100050920
307 Ga0105251_10080376
308 Ga0105245_10022426
309 Ga0105248_10049460
310 Ga0105248_10078965
311 Ga0105237_10256622
312 Ga0105238_10041752
313 Ga0105239_10338056
314 Ga0105246_10150690
315 Ga0157373_10113973
316 Ga0157371_10015749
317 Ga0157371_10090372
318 Ga0157371_10199567
319 Ga0157371_10210356
320 Ga0157370_10001258
321 Ga0157370_10064127
322 Ga0157370_10070635
323 Ga0157370_10072087
324 Ga0157370_10149227
325 Ga0157369_10037984
326 Ga0157369_10090434
327 Ga0157369_10290218
328 Ga0157369_10696519
329 Ga0157374_10008502
330 Ga0157378_10066974
331 Ga0163162_10014543
332 Ga0163162_10072294
333 Ga0163162_10157224
334 Ga0157372_10096704
335 Ga0157372_10143299
336 Ga0157375_10009604
337 Ga0157379_10019273
338 Ga0157379_10060698
339 Ga0207656_10042773
340 Ga0207688_10247850
341 Ga0207705_10210632
342 Ga0207671_10103918
343 Ga0207660_10000241
344 Ga0207660_10005125
345 Ga0207660_10078307
346 Ga0207660_10097082
347 Ga0207657_10036916
348 Ga0207657_10038926
349 Ga0207657_10199889
350 Ga0207649_10024924
351 Ga0207649_10094858
352 Ga0207652_10078378
353 Ga0207652_10564286
354 Ga0207650_10075973
355 Ga0207664_10112706
356 Ga0207644_10009062
357 Ga0207644_10017399
358 Ga0207644_10038812
359 Ga0207690_10017364
360 Ga0207690_10062551
361 Ga0207706_10064449
362 Ga0207706_10107068
363 Ga0207669_10015361
364 Ga0207669_10199173
365 Ga0207711_10004208
366 Ga0207661_10021760
367 Ga0207679_10108103
368 Ga0207667_10069929
369 Ga0207667_10086927
370 Ga0207667_10534366
371 Ga0207640_10121022
372 Ga0207658_10076630
373 Ga0207639_10053144
374 Ga0207678_10049714
375 Ga0207702_10018861
376 Ga0207702_10398510
377 Ga0207676_10023049
378 Ga0207674_10000344
379 Ga0207674_10130769
380 Ga0207683_10008629
381 Ga0207698_10015856
382 Ga0207698_10064737
383 Ga0207698_10130171
384 Ga0268266_10275668
385 Ga0268264_10148696
386 Ga0307406_10013462
387 Ga0373931_0145795
388 Ga0395899_0007951
389 Ga0395899_0017261
390 Ga0395899_0028562
391 Ga0395899_0068569
392 Ga0395899_0091181
393 Ga0395899_0293454
394 Ga0395900_0005640
395 Ga0395900_0008433
396 Ga0395900_0019137
397 Ga0395900_0030392
398 Ga0395900_0041208
399 Ga0395900_0046161
400 Ga0395900_0082818
401 Ga0395900_0116674
402 Ga0395900_0117384
403 Ga0395900_0426839
404 Ga0395900_0492672
405 Ga0395900_0621624
406 Ga0395898_0049627
407 Ga0395898_0067787
408 Ga0395898_0075686
409 Ga0395898_0292630
410 Ga0395898_0328799
411 Ga0395905_0001939
412 Ga0395905_0006622
413 Ga0395905_0006816
414 Ga0395905_0011331
415 Ga0395905_0021838
416 Ga0395905_0041771
417 Ga0395905_0044412
418 Ga0395905_0061568
419 Ga0395905_0104853
420 Ga0395905_0110574
421 Ga0395905_0137211
422 Ga0395905_0311420
423 Ga0395905_0387669
424 Ga0395901_0002717
425 Ga0395901_0015583
426 Ga0395901_0071656
427 Ga0395901_0130699
428 Ga0395901_0249931
429 Ga0395901_0481002
430 Ga0466972_0061063
431 Ga0466963_0015857
432 Ga0466963_0021753
433 Ga0466963_0042154
434 Ga0466957_0078102
435 Ga0466957_0139548
436 Ga0466960_0156428
437 Ga0466958_0029113
438 Ga0466967_0149983
439 Ga0466967_0375659
440 Ga0495598_0006669
441 Ga0495621_0024687
442 Ga0495669_0078637
443 Ga0495670_0041773
444 Ga0496100_0007291
445 Ga0496100_0274720
446 Ga0496101_0003562
447 Ga0496102_0035525
448 Ga0496104_0122115
449 Ga0496106_0091374
450 Ga0496106_0197583
451 Ga0496108_0019713
452 Ga0496108_0022233
453 Ga0496108_0059279
454 Ga0496109_0015529
455 Ga0496109_0245555
456 Ga0496110_0019377
457 Ga0496112_0019187
458 Ga0496112_0077619
459 Ga0496112_0309313
460 Ga0496113_0021500
461 Ga0496113_0071211
462 Ga0496114_0000206
463 Ga0501070_0083275
464 Ga0501071_0020102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

128

211

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u0o-assembly1.cif.gz_A crystal structure of a peptidoglycan release complex, sagb-spdc, in lipidic cubic phase 0.4725 25 266
6u0o-assembly1.cif.gz_A crystal structure of a peptidoglycan release complex, sagb-spdc, in lipidic cubic phase 0.46 25 266
7n6g-assembly1.cif.gz_5E c1 of central pair 0.3474 114 262
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.2612 21 271
4fc4-assembly2.cif.gz_I fnt family ion channel 0.2506 21 265
ID Description Score Start End Superfamily
af_A0A1D6LWL8_1_128_1.25.40.420 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.2981 90 261 1.25.40.420
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2847 91 205 1.20.1250.20
6d5xA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.2749 25 140 1.20.1200.10
af_I1MD23_46_172_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.2731 89 204 1.10.10.1740
af_P34389_1042_1239_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2702 12 255 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A3B8ZKC5-F1-model_v4 CPBP family intramembrane metalloprotease 0.9554 121 273 GO:0004222
GO:0016020
GO:0071586
AF-A0A560A4I7-F1-model_v4 deleted 0.9502 125 270
AF-M0MC78-F1-model_v4 Abortive infection protein 0.9322 114 271 GO:0004222
GO:0016020
GO:0071586
AF-A0A1Q2TPH1-F1-model_v4 deleted 0.9311 128 270
AF-D4YM07-F1-model_v4 CAAX amino terminal protease family protein 0.9256 140 278 GO:0004222
GO:0016020
GO:0071586

Map