F345283

General Info

Members Datasets Scaffolds Average Seq Length
232 162 464 235

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0402609|Ga0395900_0402609_41_874
Length 277
Sequence VEGTEVDTPAGLRLRGEDAGDGLAVLRKGNRARRRRLDLVHQRHAARIEAVSGRTQQALSLFAPLGPTYERTAAVLSFGQDPRWRRFLVSRVPPGSHVLDVATGTGAVAKELLARSCTVVGLDQSPDMLAEARRRLDGRLELVEASAESLPFPDASFDALTFTYLLRYVDEPGTTLRELARVVRPGGTVASLEFGLPGGLVRPAWELWTRLGLPLAGRAISPGWHAVGRFLNGSIRDFHERLPLPAQVELWRAAGLEDVHVRRMSLGGGVLMWARRA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.36
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0402609 3300037418 Bacteria 1332
2 Ga0070683_100100193 3300005329 Bacteria 2727
3 Ga0070690_100047913 3300005330 Bacteria 2720
4 Ga0070682_100155850 3300005337 Bacteria 1572
5 Ga0070682_100399131 3300005337 Bacteria 1039
6 Ga0068868_100038926 3300005338 Unclassified 3691
7 Ga0070660_100299107 3300005339 Bacteria 1319
8 Ga0070691_10037551 3300005341 Bacteria 2286
9 Ga0070661_100450673 3300005344 Unclassified 1024
10 Ga0070692_10226493 3300005345 Bacteria 1107
11 Ga0070659_100718587 3300005366 Unclassified 865
12 Ga0070667_100401240 3300005367 Unclassified 1248
13 Ga0070703_10011929 3300005406 Bacteria 2459
14 Ga0070709_10010649 3300005434 Bacteria 5100
15 Ga0070714_100159966 3300005435 Unclassified 2037
16 Ga0070713_100006856 3300005436 Bacteria 7940
17 Ga0070713_100401001 3300005436 Bacteria 1281
18 Ga0070701_10011678 3300005438 Bacteria 3939
19 Ga0070701_10152442 3300005438 Bacteria 1332
20 Ga0070705_100082675 3300005440 Bacteria 1976
21 Ga0070708_100035691 3300005445 Bacteria 4333
22 Ga0070662_100290436 3300005457 Bacteria 1326
23 Ga0070681_10047939 3300005458 Bacteria 4270
24 Ga0070681_10095439 3300005458 Bacteria 2923
25 Ga0068867_100169114 3300005459 Bacteria 1730
26 Ga0070706_100546950 3300005467 Bacteria 1077
27 Ga0070707_100061329 3300005468 Bacteria 3606
28 Ga0070679_100002322 3300005530 Bacteria 17205
29 Ga0068853_100076599 3300005539 Unclassified 2921
30 Ga0070695_100049436 3300005545 Bacteria 2692
31 Ga0070696_100071659 3300005546 Bacteria 2439
32 Ga0070696_100250389 3300005546 Bacteria 1339
33 Ga0070696_100421494 3300005546 Unclassified 1048
34 Ga0070693_100000985 3300005547 Bacteria 12684
35 Ga0068855_100203593 3300005563 Bacteria 2227
36 Ga0068856_100049450 3300005614 Bacteria 4144
37 Ga0070702_100017566 3300005615 Bacteria 3692
38 Ga0068852_100711066 3300005616 Bacteria 1015
39 Ga0068864_100171340 3300005618 Bacteria 1979
40 Ga0068866_10157147 3300005718 Bacteria 1322
41 Ga0068861_100141846 3300005719 Bacteria 1962
42 Ga0068860_100082142 3300005843 Bacteria 3065
43 Ga0081540_1001686 3300005983 Bacteria 18764
44 Ga0070717_10069219 3300006028 Bacteria 2938
45 Ga0070717_10191549 3300006028 Bacteria 1787
46 Ga0070716_100007528 3300006173 Bacteria 5368
47 Ga0070712_100056945 3300006175 Bacteria 2744
48 Ga0068871_100480901 3300006358 Bacteria 1117
49 Ga0075434_100169729 3300006871 Bacteria 2202
50 Ga0075434_100325516 3300006871 Unclassified 1557
51 Ga0068865_100008729 3300006881 Bacteria 6270
52 Ga0075436_100051999 3300006914 Bacteria 2827
53 Ga0105240_10538427 3300009093 Bacteria 1293
54 Ga0105245_10004716 3300009098 Bacteria 12049
55 Ga0105245_10015118 3300009098 Bacteria 6722
56 Ga0105245_10099333 3300009098 Bacteria 2691
57 Ga0114129_10148284 3300009147 Bacteria 3212
58 Ga0105243_10021509 3300009148 Bacteria 4897
59 Ga0105242_10052048 3300009176 Bacteria 3340
60 Ga0105239_10009930 3300010375 Bacteria 10687
61 Ga0105239_11339032 3300010375 Unclassified 826
62 Ga0157373_10028214 3300013100 Bacteria 4050
63 Ga0157371_10030388 3300013102 Bacteria 3897
64 Ga0157369_10684563 3300013105 Bacteria 1056
65 Ga0157378_10028184 3300013297 Bacteria 4953
66 Ga0163162_10169599 3300013306 Bacteria 2307
67 Ga0157372_10012740 3300013307 Bacteria 8959
68 Ga0157372_10623311 3300013307 Bacteria 1257
69 Ga0157375_10679624 3300013308 Bacteria 1184
70 Ga0163163_10072190 3300014325 Bacteria 3441
71 Ga0157380_10258151 3300014326 Bacteria 1581
72 Ga0182008_10001206 3300014497 Bacteria 17813
73 Ga0182008_10064416 3300014497 Bacteria 1805
74 Ga0182006_1004617 3300015261 Bacteria 6748
75 Ga0207642_10130922 3300025899 Unclassified 1309
76 Ga0207707_10151695 3300025912 Bacteria 2026
77 Ga0207693_10056778 3300025915 Bacteria 3069
78 Ga0207663_10047925 3300025916 Bacteria 2641
79 Ga0207662_10050491 3300025918 Unclassified 2471
80 Ga0207657_10017321 3300025919 Bacteria 6913
81 Ga0207657_10070531 3300025919 Bacteria 2961
82 Ga0207652_10135455 3300025921 Bacteria 2199
83 Ga0207652_10270432 3300025921 Bacteria 1533
84 Ga0207646_10251358 3300025922 Bacteria 1597
85 Ga0207700_10000028 3300025928 Bacteria 135555
86 Ga0207700_10038736 3300025928 Bacteria 3463
87 Ga0207664_10022527 3300025929 Bacteria 4707
88 Ga0207664_10239531 3300025929 Bacteria 1579
89 Ga0207664_10240783 3300025929 Bacteria 1575
90 Ga0207690_10093819 3300025932 Bacteria 2128
91 Ga0207690_10139319 3300025932 Archaea 1786
92 Ga0207706_10042921 3300025933 Bacteria 4008
93 Ga0207670_10255570 3300025936 Bacteria 1356
94 Ga0207669_10126898 3300025937 Bacteria 1745
95 Ga0207665_10021111 3300025939 Bacteria 4280
96 Ga0207665_10076488 3300025939 Bacteria 2295
97 Ga0207661_10200228 3300025944 Bacteria 1755
98 Ga0207677_10184661 3300026023 Archaea 1643
99 Ga0207639_10390600 3300026041 Bacteria 1251
100 Ga0207708_10046769 3300026075 Bacteria 3295
101 Ga0207648_10002938 3300026089 Bacteria 18038
102 Ga0207648_10232124 3300026089 Bacteria 1641
103 Ga0207676_10121440 3300026095 Bacteria 2204
104 Ga0207675_100175587 3300026118 Bacteria 2050
105 Ga0207683_10045061 3300026121 Bacteria 3857
106 Ga0207698_10964630 3300026142 Bacteria 862
107 Ga0268265_10904694 3300028380 Bacteria 867
108 Ga0265337_1063900 3300028556 Bacteria 1017
109 Ga0265318_10065873 3300028577 Bacteria 1347
110 Ga0265338_10093241 3300028800 Bacteria 2481
111 Ga0265332_10029053 3300031238 Bacteria 2418
112 Ga0265339_10063795 3300031249 Bacteria 1977
113 Ga0265327_10045019 3300031251 Bacteria 2348
114 Ga0265313_10010635 3300031595 Bacteria 5795
115 Ga0265314_10055560 3300031711 Bacteria 2731
116 Ga0265342_10035976 3300031712 Bacteria 3027
117 Ga0307409_100151190 3300031995 Bacteria 2015
118 Ga0373943_0008391 3300035170 Bacteria 4636
119 Ga0373955_0218085 3300035172 Bacteria 1139
120 Ga0373935_0114353 3300035692 Bacteria 1795
121 Ga0373933_0461869 3300035724 Bacteria 831
122 Ga0373947_0002805 3300035725 Bacteria 10416
123 Ga0373925_0022241 3300037068 Bacteria 4624
124 Ga0395899_0003008 3300037312 Bacteria 13460
125 Ga0395899_0100779 3300037312 Bacteria 2085
126 Ga0395899_0138410 3300037312 Bacteria 1734
127 Ga0395900_0016158 3300037418 Bacteria 7602
128 Ga0395900_0016253 3300037418 Bacteria 7583
129 Ga0395900_0145411 3300037418 Unclassified 2424
130 Ga0395900_0186245 3300037418 Bacteria 2107
131 Ga0395898_0004729 3300037466 Bacteria 14820
132 Ga0395898_0052633 3300037466 Bacteria 3977
133 Ga0395898_0073525 3300037466 Bacteria 3302
134 Ga0395898_0078788 3300037466 Bacteria 3179
135 Ga0395898_0299124 3300037466 Bacteria 1535
136 Ga0395898_0546065 3300037466 Bacteria 1101
137 Ga0395898_0691081 3300037466 Bacteria 962
138 Ga0395898_1109701 3300037466 Bacteria 724
139 Ga0395905_0004049 3300037471 Bacteria 15373
140 Ga0395905_0036132 3300037471 Bacteria 4640
141 Ga0395905_0173322 3300037471 Bacteria 2026
142 Ga0395901_0007150 3300038443 Bacteria 11268
143 Ga0395901_0021809 3300038443 Bacteria 6565
144 Ga0395901_0061347 3300038443 Bacteria 3912
145 Ga0395901_0069366 3300038443 Bacteria 3671
146 Ga0395901_0074636 3300038443 Bacteria 3538
147 Ga0395901_0149367 3300038443 Bacteria 2456
148 Ga0451802_2132583 3300041460 Bacteria 967
149 Ga0451853_3453607 3300041512 Unclassified 1002
150 Ga0439459_0020662 3300042438 Bacteria 1258
151 Ga0466963_0002892 3300044694 Bacteria 9695
152 Ga0466963_0163153 3300044694 Unclassified 1551
153 Ga0466963_0244610 3300044694 Bacteria 1258
154 Ga0466963_0362046 3300044694 Bacteria 1022
155 Ga0466957_0351786 3300044842 Bacteria 1000
156 Ga0466958_0015747 3300045836 Bacteria 4341
157 Ga0466958_0102655 3300045836 Bacteria 1779
158 Ga0466967_0021485 3300045976 Bacteria 5244
159 Ga0466967_0024510 3300045976 Bacteria 4961
160 Ga0466967_0051781 3300045976 Bacteria 3600
161 Ga0466967_0102415 3300045976 Unclassified 2619
162 Ga0495603_0003521 3300046455 Bacteria 9320
163 Ga0495603_0023478 3300046455 Bacteria 3731
164 Ga0495603_0062768 3300046455 Bacteria 2193
165 Ga0495629_0063418 3300046459 Bacteria 2581
166 Ga0495641_0001752 3300046461 Bacteria 18080
167 Ga0495653_0020385 3300046463 Bacteria 5376
168 Ga0495584_0092096 3300046491 Unclassified 1529
169 Ga0495594_0005092 3300046499 Bacteria 6765
170 Ga0495596_0026310 3300046500 Bacteria 2346
171 Ga0495630_0037841 3300046517 Bacteria 3608
172 Ga0495588_0001448 3300046674 Bacteria 10166
173 Ga0495647_0016963 3300046681 Bacteria 2572
174 Ga0495669_0101314 3300046684 Bacteria 1338
175 Ga0495676_0013741 3300047321 Bacteria 7263
176 Ga0495676_0020917 3300047321 Bacteria 5729
177 Ga0496101_0064839 3300048904 Bacteria 2662
178 Ga0496102_0021593 3300048905 Bacteria 5694
179 Ga0496102_0338298 3300048905 Bacteria 1418
180 Ga0496102_0557233 3300048905 Bacteria 1069
181 Ga0496102_0596291 3300048905 Bacteria 1028
182 Ga0496103_0077444 3300048906 Bacteria 2087
183 Ga0496104_0001845 3300048907 Bacteria 18334
184 Ga0496105_0001914 3300048908 Bacteria 14954
185 Ga0496105_0413995 3300048908 Bacteria 1068
186 Ga0496107_0361569 3300048910 Bacteria 1080
187 Ga0496108_0187189 3300048911 Bacteria 1793
188 Ga0496109_0016026 3300048912 Bacteria 6550
189 Ga0496109_0141537 3300048912 Unclassified 2249
190 Ga0496109_0328307 3300048912 Bacteria 1444
191 Ga0496110_0001481 3300048913 Bacteria 17015
192 Ga0496110_0008459 3300048913 Bacteria 8282
193 Ga0496111_0000412 3300048914 Bacteria 21482
194 Ga0496111_0027656 3300048914 Bacteria 4015
195 Ga0496111_0082315 3300048914 Unclassified 2351
196 Ga0496111_0102209 3300048914 Unclassified 2107
197 Ga0496111_0224647 3300048914 Bacteria 1395
198 Ga0496112_0008592 3300048915 Bacteria 9154
199 Ga0496112_0027781 3300048915 Bacteria 5457
200 Ga0496112_0246612 3300048915 Bacteria 1738
201 Ga0496113_0011816 3300048916 Bacteria 5849
202 Ga0496113_0018202 3300048916 Bacteria 4891
203 Ga0496113_0182894 3300048916 Bacteria 1662
204 Ga0496114_0110073 3300048917 Unclassified 2359
205 Ga0496115_0015970 3300048918 Bacteria 5708
206 Ga0496115_0203691 3300048918 Bacteria 1635
207 Ga0501031_0000110 3300049568 Bacteria 43369
208 Ga0501036_0200918 3300049572 Bacteria 1676
209 Ga0501038_0086516 3300049574 Bacteria 2633
210 Ga0501039_0034948 3300049575 Bacteria 3879
211 Ga0501040_0037258 3300049576 Bacteria 3303
212 Ga0501041_0084237 3300049577 Bacteria 1959
213 Ga0501046_0215586 3300049580 Unclassified 1423
214 Ga0501048_0072605 3300049582 Bacteria 2429
215 Ga0501067_0007661 3300049583 Bacteria 6002
216 Ga0501067_0016163 3300049583 Bacteria 4126
217 Ga0501074_0080429 3300049590 Bacteria 2338
218 Ga0501075_0182139 3300049591 Bacteria 1602
219 Ga0501076_0035372 3300049592 Bacteria 3908
220 Ga0501077_0149810 3300049593 Bacteria 1480
221 Ga0501079_0324926 3300049741 Unclassified 1204
222 Ga0501080_0585062 3300049742 Bacteria 992
223 Ga0501081_0025883 3300049743 Bacteria 3951
224 Ga0501045_0195275 3300049824 Bacteria 1508
225 nmdc:mga05p37_353909_c1 3300050507 Bacteria 1728
226 nmdc:mga05p37_91832_c1 3300050507 Bacteria 3741
227 nmdc:mga0n895_191854_c1 3300050512 Unclassified 2074
228 nmdc:mga0a205_476348_c1 3300050515 Bacteria 1107
229 Ga0501084_0157177 3300054114 Bacteria 1918
230 Ga0501082_0091118 3300060353 Bacteria 2632
231 Ga0530510_0184561 3300061734 Bacteria 1547
232 Ga0530510_0210985 3300061734 Bacteria 1443
233 Ga0395900_0402609
234 Ga0070683_100100193
235 Ga0070690_100047913
236 Ga0070682_100155850
237 Ga0070682_100399131
238 Ga0068868_100038926
239 Ga0070660_100299107
240 Ga0070691_10037551
241 Ga0070661_100450673
242 Ga0070692_10226493
243 Ga0070659_100718587
244 Ga0070667_100401240
245 Ga0070703_10011929
246 Ga0070709_10010649
247 Ga0070714_100159966
248 Ga0070713_100006856
249 Ga0070713_100401001
250 Ga0070701_10011678
251 Ga0070701_10152442
252 Ga0070705_100082675
253 Ga0070708_100035691
254 Ga0070662_100290436
255 Ga0070681_10047939
256 Ga0070681_10095439
257 Ga0068867_100169114
258 Ga0070706_100546950
259 Ga0070707_100061329
260 Ga0070679_100002322
261 Ga0068853_100076599
262 Ga0070695_100049436
263 Ga0070696_100071659
264 Ga0070696_100250389
265 Ga0070696_100421494
266 Ga0070693_100000985
267 Ga0068855_100203593
268 Ga0068856_100049450
269 Ga0070702_100017566
270 Ga0068852_100711066
271 Ga0068864_100171340
272 Ga0068866_10157147
273 Ga0068861_100141846
274 Ga0068860_100082142
275 Ga0081540_1001686
276 Ga0070717_10069219
277 Ga0070717_10191549
278 Ga0070716_100007528
279 Ga0070712_100056945
280 Ga0068871_100480901
281 Ga0075434_100169729
282 Ga0075434_100325516
283 Ga0068865_100008729
284 Ga0075436_100051999
285 Ga0105240_10538427
286 Ga0105245_10004716
287 Ga0105245_10015118
288 Ga0105245_10099333
289 Ga0114129_10148284
290 Ga0105243_10021509
291 Ga0105242_10052048
292 Ga0105239_10009930
293 Ga0105239_11339032
294 Ga0157373_10028214
295 Ga0157371_10030388
296 Ga0157369_10684563
297 Ga0157378_10028184
298 Ga0163162_10169599
299 Ga0157372_10012740
300 Ga0157372_10623311
301 Ga0157375_10679624
302 Ga0163163_10072190
303 Ga0157380_10258151
304 Ga0182008_10001206
305 Ga0182008_10064416
306 Ga0182006_1004617
307 Ga0207642_10130922
308 Ga0207707_10151695
309 Ga0207693_10056778
310 Ga0207663_10047925
311 Ga0207662_10050491
312 Ga0207657_10017321
313 Ga0207657_10070531
314 Ga0207652_10135455
315 Ga0207652_10270432
316 Ga0207646_10251358
317 Ga0207700_10000028
318 Ga0207700_10038736
319 Ga0207664_10022527
320 Ga0207664_10239531
321 Ga0207664_10240783
322 Ga0207690_10093819
323 Ga0207690_10139319
324 Ga0207706_10042921
325 Ga0207670_10255570
326 Ga0207669_10126898
327 Ga0207665_10021111
328 Ga0207665_10076488
329 Ga0207661_10200228
330 Ga0207677_10184661
331 Ga0207639_10390600
332 Ga0207708_10046769
333 Ga0207648_10002938
334 Ga0207648_10232124
335 Ga0207676_10121440
336 Ga0207675_100175587
337 Ga0207683_10045061
338 Ga0207698_10964630
339 Ga0268265_10904694
340 Ga0265337_1063900
341 Ga0265318_10065873
342 Ga0265338_10093241
343 Ga0265332_10029053
344 Ga0265339_10063795
345 Ga0265327_10045019
346 Ga0265313_10010635
347 Ga0265314_10055560
348 Ga0265342_10035976
349 Ga0307409_100151190
350 Ga0373943_0008391
351 Ga0373955_0218085
352 Ga0373935_0114353
353 Ga0373933_0461869
354 Ga0373947_0002805
355 Ga0373925_0022241
356 Ga0395899_0003008
357 Ga0395899_0100779
358 Ga0395899_0138410
359 Ga0395900_0016158
360 Ga0395900_0016253
361 Ga0395900_0145411
362 Ga0395900_0186245
363 Ga0395898_0004729
364 Ga0395898_0052633
365 Ga0395898_0073525
366 Ga0395898_0078788
367 Ga0395898_0299124
368 Ga0395898_0546065
369 Ga0395898_0691081
370 Ga0395898_1109701
371 Ga0395905_0004049
372 Ga0395905_0036132
373 Ga0395905_0173322
374 Ga0395901_0007150
375 Ga0395901_0021809
376 Ga0395901_0061347
377 Ga0395901_0069366
378 Ga0395901_0074636
379 Ga0395901_0149367
380 Ga0451802_2132583
381 Ga0451853_3453607
382 Ga0439459_0020662
383 Ga0466963_0002892
384 Ga0466963_0163153
385 Ga0466963_0244610
386 Ga0466963_0362046
387 Ga0466957_0351786
388 Ga0466958_0015747
389 Ga0466958_0102655
390 Ga0466967_0021485
391 Ga0466967_0024510
392 Ga0466967_0051781
393 Ga0466967_0102415
394 Ga0495603_0003521
395 Ga0495603_0023478
396 Ga0495603_0062768
397 Ga0495629_0063418
398 Ga0495641_0001752
399 Ga0495653_0020385
400 Ga0495584_0092096
401 Ga0495594_0005092
402 Ga0495596_0026310
403 Ga0495630_0037841
404 Ga0495588_0001448
405 Ga0495647_0016963
406 Ga0495669_0101314
407 Ga0495676_0013741
408 Ga0495676_0020917
409 Ga0496101_0064839
410 Ga0496102_0021593
411 Ga0496102_0338298
412 Ga0496102_0557233
413 Ga0496102_0596291
414 Ga0496103_0077444
415 Ga0496104_0001845
416 Ga0496105_0001914
417 Ga0496105_0413995
418 Ga0496107_0361569
419 Ga0496108_0187189
420 Ga0496109_0016026
421 Ga0496109_0141537
422 Ga0496109_0328307
423 Ga0496110_0001481
424 Ga0496110_0008459
425 Ga0496111_0000412
426 Ga0496111_0027656
427 Ga0496111_0082315
428 Ga0496111_0102209
429 Ga0496111_0224647
430 Ga0496112_0008592
431 Ga0496112_0027781
432 Ga0496112_0246612
433 Ga0496113_0011816
434 Ga0496113_0018202
435 Ga0496113_0182894
436 Ga0496114_0110073
437 Ga0496115_0015970
438 Ga0496115_0203691
439 Ga0501031_0000110
440 Ga0501036_0200918
441 Ga0501038_0086516
442 Ga0501039_0034948
443 Ga0501040_0037258
444 Ga0501041_0084237
445 Ga0501046_0215586
446 Ga0501048_0072605
447 Ga0501067_0007661
448 Ga0501067_0016163
449 Ga0501074_0080429
450 Ga0501075_0182139
451 Ga0501076_0035372
452 Ga0501077_0149810
453 Ga0501079_0324926
454 Ga0501080_0585062
455 Ga0501081_0025883
456 Ga0501045_0195275
457 nmdc:mga05p37_353909_c1
458 nmdc:mga05p37_91832_c1
459 nmdc:mga0n895_191854_c1
460 nmdc:mga0a205_476348_c1
461 Ga0501084_0157177
462 Ga0501082_0091118
463 Ga0530510_0184561
464 Ga0530510_0210985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

99

191

0.97

PF13649

Methyltransf_25

Methyltransferase domain

98

187

0.96

PF13847

Methyltransf_31

Methyltransferase domain

93

211

0.93

PF08242

Methyltransf_12

Methyltransferase domain

99

189

0.91

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

51

275

0.88

PF13489

Methyltransf_23

Methyltransferase domain

80

261

0.8

PF07021

MetW

Methionine biosynthesis protein MetW

84

264

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8542 16 232
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.8416 33 149
4krg-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine 0.8274 36 154
5bxy-assembly2.cif.gz_B crystal structure of rna methyltransferase from salinibacter ruber in complex with s-adenosyl-l-homocysteine 0.8199 34 147
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8098 31 231
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9382 17 232 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9254 17 232 3.40.50.150
2o57A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9193 34 147 3.40.50.150
af_Q9BTF0_272_433_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9189 31 145 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.908 34 154 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2N0L107-F1-model_v4 Methyltransferase domain-containing protein 0.9731 5 232 GO:0008168
GO:0032259
GO:0042181
AF-A0A2N0L107-F1-model_v4 Methyltransferase domain-containing protein 0.9525 5 232 GO:0008168
GO:0032259
GO:0042181
AF-A0A7I9YGS2-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9446 9 231 GO:0009234
GO:0032259
GO:0043770
AF-A0A6B1AW80-F1-model_v4 deleted 0.9375 5 232
AF-A0A285UAW9-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9373 5 231 GO:0009234
GO:0032259
GO:0043770

Map