F344786

General Info

Members Datasets Scaffolds Average Seq Length
232 166 232 391

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10054353|Ga0070701_100543532
Length 429
Sequence MGRPSGTLRTAVVLASLAALRLFQPPESFRLTTFAEATVAKKAEATSEPAGWADVVQGYRAALGRAGIVGSSLMIVRDGRIVARANEGLQDREAGAPVTDDTIYHWASITKTFTGIAIMQLRDRGLLSLDDPVVKFVPELRLAHDPFGDISQVKIRHLMSHSAGFRASTWPWGGDKPWHPFEPTSWEQIVAMMPYTDVQFAPGSKYSYSNPGVIFLGRIIQLLSGDDYEVYVTKNILMPLGMQRTFFDRAPYFLRPFRSHSYVRDEAGLREAPFDFDTGITVSNGGLNAPFGDMARYLAFLSGSGDSAVAATYNTVLKRTSLEEMWTPQIRASEGEGVNGTDSQAALSFFVEQWPLDSRRSLGTGPVELVGHSGDQNGFISHLYLHRPSRTAWVISLNTDTTASKDGSRPSSRQVDMAVRDLIVNKILH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0
Rhizoplane 5.17
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10007008 3300005290 Bacteria 2858
2 Ga0065712_10097036 3300005290 Bacteria 2163
3 Ga0065715_10003970 3300005293 Bacteria 6343
4 Ga0065707_10028992 3300005295 Bacteria 1681
5 Ga0070676_10029335 3300005328 Bacteria 3128
6 Ga0070683_100000197 3300005329 Bacteria 40400
7 Ga0070670_100018976 3300005331 Bacteria 5898
8 Ga0070670_100090930 3300005331 Bacteria 2623
9 Ga0068869_100013754 3300005334 Bacteria 5391
10 Ga0070680_100145406 3300005336 Bacteria 1989
11 Ga0070660_100019428 3300005339 Bacteria 4980
12 Ga0070660_100085840 3300005339 Bacteria 2476
13 Ga0070660_100146618 3300005339 Bacteria 1896
14 Ga0070689_100049046 3300005340 Bacteria 3258
15 Ga0070687_100012098 3300005343 Bacteria 3798
16 Ga0070687_100028274 3300005343 Bacteria 2718
17 Ga0070661_100055485 3300005344 Bacteria 2901
18 Ga0070668_100210459 3300005347 Bacteria 1599
19 Ga0070669_100006946 3300005353 Bacteria 8135
20 Ga0070669_100147442 3300005353 Unclassified 1819
21 Ga0070675_100001330 3300005354 Bacteria 18075
22 Ga0070675_100150660 3300005354 Bacteria 1994
23 Ga0070671_100037908 3300005355 Unclassified 4000
24 Ga0070674_100066680 3300005356 Bacteria 2530
25 Ga0070673_100000770 3300005364 Bacteria 17805
26 Ga0070673_100068749 3300005364 Bacteria 2837
27 Ga0070688_100144555 3300005365 Unclassified 1619
28 Ga0070659_100134656 3300005366 Bacteria 2009
29 Ga0070659_100139170 3300005366 Bacteria 1976
30 Ga0070659_100152300 3300005366 Bacteria 1887
31 Ga0070659_100173782 3300005366 Bacteria 1766
32 Ga0070709_10125876 3300005434 Bacteria 1743
33 Ga0070701_10054353 3300005438 Bacteria 2088
34 Ga0070701_10087354 3300005438 Unclassified 1701
35 Ga0070705_100036381 3300005440 Bacteria 2768
36 Ga0070705_100082931 3300005440 Bacteria 1974
37 Ga0070694_100093590 3300005444 Unclassified 2113
38 Ga0070662_100081728 3300005457 Bacteria 2408
39 Ga0070681_10039172 3300005458 Bacteria 4751
40 Ga0070679_100059323 3300005530 Bacteria 3814
41 Ga0070684_100020869 3300005535 Bacteria 5438
42 Ga0068853_100154790 3300005539 Bacteria 2065
43 Ga0070672_100076192 3300005543 Bacteria 2679
44 Ga0070672_100138581 3300005543 Bacteria 2005
45 Ga0070686_100001318 3300005544 Bacteria 14039
46 Ga0070693_100077401 3300005547 Bacteria 1974
47 Ga0070665_100127316 3300005548 Bacteria 2549
48 Ga0070704_100018297 3300005549 Bacteria 4477
49 Ga0068855_100009176 3300005563 Bacteria 11943
50 Ga0068855_100041733 3300005563 Bacteria 5437
51 Ga0070664_100030444 3300005564 Bacteria 4502
52 Ga0068857_100042244 3300005577 Bacteria 4043
53 Ga0068854_100002292 3300005578 Bacteria 11776
54 Ga0068856_100230156 3300005614 Bacteria 1869
55 Ga0068852_100210161 3300005616 Bacteria 1846
56 Ga0068859_100082908 3300005617 Bacteria 3248
57 Ga0068859_100092503 3300005617 Bacteria 3075
58 Ga0068864_100005160 3300005618 Bacteria 10699
59 Ga0068864_100160447 3300005618 Bacteria 2044
60 Ga0068866_10058181 3300005718 Bacteria 1995
61 Ga0068861_100007053 3300005719 Bacteria 7682
62 Ga0068861_100096526 3300005719 Bacteria 2343
63 Ga0068861_100108218 3300005719 Bacteria 2223
64 Ga0068870_10013692 3300005840 Bacteria 3818
65 Ga0068858_100068660 3300005842 Bacteria 3285
66 Ga0068860_100309635 3300005843 Unclassified 1548
67 Ga0068862_100014888 3300005844 Bacteria 6460
68 Ga0068862_100036488 3300005844 Bacteria 4166
69 Ga0068862_100253154 3300005844 Bacteria 1606
70 Ga0075365_10000667 3300006038 Bacteria 13721
71 Ga0075365_10093464 3300006038 Bacteria 2051
72 Ga0075364_10002152 3300006051 Bacteria 11039
73 Ga0075364_10027154 3300006051 Bacteria 3656
74 Ga0075362_10002514 3300006177 Bacteria 6174
75 Ga0075367_10012837 3300006178 Bacteria 4485
76 Ga0075366_10000813 3300006195 Bacteria 14971
77 Ga0075366_10051487 3300006195 Bacteria 2446
78 Ga0097621_100001775 3300006237 Bacteria 14791
79 Ga0075370_10002724 3300006353 Bacteria 8269
80 Ga0068871_100028167 3300006358 Bacteria 4402
81 Ga0075428_100014244 3300006844 Bacteria 8847
82 Ga0075431_100013106 3300006847 Bacteria 8377
83 Ga0075433_10273374 3300006852 Unclassified 1497
84 Ga0075434_100195943 3300006871 Bacteria 2040
85 Ga0075434_100244094 3300006871 Bacteria 1816
86 Ga0068865_100011288 3300006881 Bacteria 5585
87 Ga0097620_100082906 3300006931 Bacteria 3248
88 Ga0097620_100092504 3300006931 Bacteria 3075
89 Ga0075435_100001758 3300007076 Bacteria 14102
90 Ga0075435_100043307 3300007076 Bacteria 3603
91 Ga0105240_10022324 3300009093 Bacteria 8393
92 Ga0105240_10049136 3300009093 Bacteria 5327
93 Ga0105240_10063239 3300009093 Bacteria 4604
94 Ga0111539_10000691 3300009094 Bacteria 43728
95 Ga0111539_10140926 3300009094 Bacteria 2822
96 Ga0111539_10184203 3300009094 Bacteria 2439
97 Ga0105245_10040694 3300009098 Bacteria 4142
98 Ga0105245_10067206 3300009098 Bacteria 3246
99 Ga0105245_10093163 3300009098 Bacteria 2775
100 Ga0114129_10002287 3300009147 Bacteria 26519
101 Ga0114129_10014743 3300009147 Bacteria 11134
102 Ga0114129_10046704 3300009147 Bacteria 6085
103 Ga0105241_10099609 3300009174 Bacteria 2308
104 Ga0105242_10006639 3300009176 Bacteria 8924
105 Ga0105242_10072620 3300009176 Bacteria 2858
106 Ga0105242_10262867 3300009176 Bacteria 1560
107 Ga0105248_10010397 3300009177 Bacteria 10249
108 Ga0105248_10062649 3300009177 Bacteria 4176
109 Ga0105248_10158732 3300009177 Bacteria 2551
110 Ga0105249_10001531 3300009553 Bacteria 20288
111 Ga0157374_10010973 3300013296 Bacteria 7823
112 Ga0157374_10077248 3300013296 Bacteria 3151
113 Ga0163162_10120970 3300013306 Bacteria 2722
114 Ga0157372_10241984 3300013307 Bacteria 2094
115 Ga0157380_10170208 3300014326 Bacteria 1903
116 Ga0157379_10073172 3300014968 Bacteria 3067
117 Ga0157379_10090358 3300014968 Bacteria 2747
118 Ga0157376_10220387 3300014969 Bacteria 1757
119 Ga0207682_10043870 3300025893 Bacteria 1832
120 Ga0207645_10015212 3300025907 Bacteria 5122
121 Ga0207654_10096224 3300025911 Bacteria 1815
122 Ga0207695_10192088 3300025913 Bacteria 1959
123 Ga0207660_10134959 3300025917 Bacteria 1882
124 Ga0207662_10018429 3300025918 Bacteria 3961
125 Ga0207662_10072560 3300025918 Bacteria 2086
126 Ga0207657_10144969 3300025919 Bacteria 1938
127 Ga0207657_10165811 3300025919 Bacteria 1792
128 Ga0207652_10238284 3300025921 Bacteria 1640
129 Ga0207652_10249444 3300025921 Bacteria 1601
130 Ga0207681_10006314 3300025923 Bacteria 7275
131 Ga0207681_10026980 3300025923 Bacteria 3710
132 Ga0207650_10018941 3300025925 Bacteria 4836
133 Ga0207659_10000270 3300025926 Bacteria 31679
134 Ga0207644_10043626 3300025931 Bacteria 3184
135 Ga0207690_10122804 3300025932 Bacteria 1889
136 Ga0207690_10152712 3300025932 Bacteria 1713
137 Ga0207706_10056672 3300025933 Bacteria 3454
138 Ga0207686_10046901 3300025934 Bacteria 2668
139 Ga0207709_10196466 3300025935 Bacteria 1437
140 Ga0207670_10120399 3300025936 Bacteria 1907
141 Ga0207691_10090982 3300025940 Bacteria 2734
142 Ga0207711_10135785 3300025941 Bacteria 2209
143 Ga0207711_10239932 3300025941 Bacteria 1662
144 Ga0207689_10021474 3300025942 Bacteria 5427
145 Ga0207689_10023090 3300025942 Bacteria 5223
146 Ga0207667_10149816 3300025949 Bacteria 2401
147 Ga0207651_10005762 3300025960 Bacteria 6397
148 Ga0207668_10135483 3300025972 Bacteria 1886
149 Ga0207640_10001344 3300025981 Bacteria 13329
150 Ga0207640_10240285 3300025981 Bacteria 1399
151 Ga0207677_10175594 3300026023 Bacteria 1680
152 Ga0207703_10032923 3300026035 Bacteria 4106
153 Ga0207703_10105839 3300026035 Bacteria 2392
154 Ga0207708_10010667 3300026075 Bacteria 6825
155 Ga0207702_10232441 3300026078 Bacteria 1724
156 Ga0207641_10282412 3300026088 Bacteria 1562
157 Ga0207648_10231691 3300026089 Bacteria 1643
158 Ga0207676_10019080 3300026095 Bacteria 4997
159 Ga0207676_10027622 3300026095 Bacteria 4229
160 Ga0207674_10046435 3300026116 Bacteria 4459
161 Ga0207674_10091496 3300026116 Bacteria 3032
162 Ga0207675_100129134 3300026118 Bacteria 2396
163 Ga0207675_100235087 3300026118 Bacteria 1769
164 Ga0207683_10073381 3300026121 Bacteria 3027
165 Ga0207428_10007456 3300027907 Bacteria 9972
166 Ga0207428_10014674 3300027907 Bacteria 6791
167 Ga0268266_10062016 3300028379 Bacteria 3225
168 Ga0268265_10033522 3300028380 Bacteria 3734
169 Ga0268264_10281668 3300028381 Unclassified 1558
170 Ga0307413_10006384 3300031824 Bacteria 5376
171 Ga0307407_10005911 3300031903 Bacteria 5373
172 Ga0307407_10021729 3300031903 Bacteria 3316
173 Ga0307412_10103731 3300031911 Unclassified 2016
174 Ga0373930_0002288 3300034816 Bacteria 2953
175 Ga0373959_0001402 3300034820 Bacteria 3852
176 Ga0373928_0001099 3300035084 Bacteria 5349
177 Ga0373929_0002195 3300035085 Bacteria 3621
178 Ga0373949_0000401 3300035090 Bacteria 15100
179 Ga0373952_0001258 3300035092 Bacteria 4626
180 Ga0373932_0008273 3300035112 Bacteria 2484
181 Ga0373939_0000437 3300035114 Bacteria 10500
182 Ga0373941_0013915 3300035115 Bacteria 2137
183 Ga0373960_0000079 3300035121 Bacteria 14145
184 Ga0373961_0001454 3300035241 Bacteria 6963
185 Ga0373931_0018317 3300035691 Bacteria 3481
186 Ga0373947_0025872 3300035725 Bacteria 3424
187 Ga0395905_0430541 3300037471 Bacteria 1216
188 Ga0439434_0050872 3300042435 Bacteria 1284
189 Ga0466963_0029428 3300044694 Unclassified 3536
190 Ga0451576_0004987 3300045051 Bacteria 16888
191 Ga0495587_0138986 3300046536 Bacteria 1387
192 Ga0495635_0050139 3300046663 Bacteria 2878
193 Ga0495647_0005912 3300046681 Bacteria 4029
194 Ga0495684_0176641 3300047471 Bacteria 1585
195 Ga0496102_0127071 3300048905 Bacteria 2384
196 Ga0496104_0064975 3300048907 Bacteria 3462
197 Ga0496105_0085180 3300048908 Bacteria 2611
198 Ga0496106_0131719 3300048909 Bacteria 1962
199 Ga0496108_0005060 3300048911 Bacteria 10651
200 Ga0496108_0024013 3300048911 Bacteria 5019
201 Ga0496109_0154391 3300048912 Bacteria 2150
202 Ga0496110_0000256 3300048913 Bacteria 34589
203 Ga0496112_0000239 3300048915 Bacteria 35278
204 Ga0496112_0240198 3300048915 Bacteria 1764
205 Ga0496113_0023756 3300048916 Bacteria 4350
206 Ga0496114_0090934 3300048917 Bacteria 2591
207 Ga0501047_0133692 3300049581 Bacteria 2361
208 Ga0501072_0122799 3300049588 Unclassified 2069
209 Ga0501076_0264275 3300049592 Bacteria 1409
210 nmdc:mga00v17_7477_c1 3300050491 Bacteria 5831
211 nmdc:mga00v17_9148_c1 3300050491 Bacteria 5348
212 nmdc:mga0yw44_163126_c1 3300050492 Bacteria 1460
213 nmdc:mga0k408_3616_c2 3300050493 Bacteria 6301
214 nmdc:mga06z11_37437_c1 3300050494 Bacteria 2402
215 nmdc:mga07m45_43393_c1 3300050496 Bacteria 2521
216 nmdc:mga05p37_20323_c1 3300050507 Bacteria 8034
217 nmdc:mga05p37_21731_c1 3300050507 Bacteria 7774
218 nmdc:mga05p37_9149_c1 3300050507 Bacteria 7128
219 nmdc:mga06r32_148088_c1 3300050510 Bacteria 2325
220 nmdc:mga06r32_19772_c1 3300050510 Bacteria 6188
221 nmdc:mga08y16_18244_c1 3300050511 Bacteria 7394
222 nmdc:mga08y16_46502_c1 3300050511 Bacteria 4544
223 nmdc:mga0rr50_1678_c1 3300050513 Bacteria 12208
224 nmdc:mga0a205_16740_c1 3300050515 Bacteria 6865
225 Ga0495619_0010564 3300053085 Bacteria 5809
226 Ga0495619_0116117 3300053085 Bacteria 1832
227 Ga0590071_000131 3300059421 Bacteria 20987
228 Ga0590071_001455 3300059421 Bacteria 6243
229 Ga0590075_000184 3300059424 Bacteria 17420
230 Ga0590075_000277 3300059424 Bacteria 14510
231 Ga0590077_000835 3300059426 Bacteria 7968
232 Ga0590077_001162 3300059426 Bacteria 6404

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0430541 Ga0395905_0430541_188_1201 330
2 3300005353 Ga0070669_100147442 Ga0070669_1001474421 339
3 3300005364 Ga0070673_100068749 Ga0070673_1000687491 339
4 3300005457 Ga0070662_100081728 Ga0070662_1000817281 339
5 3300005719 Ga0068861_100108218 Ga0068861_1001082182 339
6 3300006871 Ga0075434_100244094 Ga0075434_1002440942 339
7 3300007076 Ga0075435_100001758 Ga0075435_1000017583 339
8 3300025911 Ga0207654_10096224 Ga0207654_100962241 339
9 3300049592 Ga0501076_0264275 Ga0501076_0264275_40_1122 353
10 3300009094 Ga0111539_10140926 Ga0111539_101409263 356
11 3300006038 Ga0075365_10093464 Ga0075365_100934642 364
12 3300006178 Ga0075367_10012837 Ga0075367_100128371 364
13 3300006353 Ga0075370_10002724 Ga0075370_100027243 364
14 3300006844 Ga0075428_100014244 Ga0075428_1000142447 364
15 3300006847 Ga0075431_100013106 Ga0075431_1000131066 364
16 3300006852 Ga0075433_10273374 Ga0075433_102733741 364
17 3300009094 Ga0111539_10000691 Ga0111539_1000069124 364
18 3300009553 Ga0105249_10001531 Ga0105249_100015313 364
19 3300025923 Ga0207681_10006314 Ga0207681_100063141 364
20 3300050491 nmdc:mga00v17_9148_c1 nmdc:mga00v17_9148_c1_3645_4898 364
21 3300050492 nmdc:mga0yw44_163126_c1 nmdc:mga0yw44_163126_c1_14_1267 364
22 3300050496 nmdc:mga07m45_43393_c1 nmdc:mga07m45_43393_c1_495_1748 364
23 3300050511 nmdc:mga08y16_18244_c1 nmdc:mga08y16_18244_c1_4140_5255 364
24 3300050515 nmdc:mga0a205_16740_c1 nmdc:mga0a205_16740_c1_212_1327 364
25 3300044694 Ga0466963_0029428 Ga0466963_0029428_410_1582 365
26 3300005290 Ga0065712_10097036 Ga0065712_100970362 366
27 3300005329 Ga0070683_100000197 Ga0070683_10000019726 366
28 3300005331 Ga0070670_100090930 Ga0070670_1000909302 366
29 3300005344 Ga0070661_100055485 Ga0070661_1000554852 366
30 3300005355 Ga0070671_100037908 Ga0070671_1000379082 366
31 3300005535 Ga0070684_100020869 Ga0070684_1000208692 366
32 3300005543 Ga0070672_100138581 Ga0070672_1001385812 366
33 3300005564 Ga0070664_100030444 Ga0070664_1000304445 366
34 3300013296 Ga0157374_10077248 Ga0157374_100772483 366
35 3300013306 Ga0163162_10120970 Ga0163162_101209702 366
36 3300025931 Ga0207644_10043626 Ga0207644_100436262 366
37 3300048908 Ga0496105_0085180 Ga0496105_0085180_570_1691 366
38 3300048911 Ga0496108_0005060 Ga0496108_0005060_4447_5568 366
39 3300048913 Ga0496110_0000256 Ga0496110_0000256_18210_19331 366
40 3300048915 Ga0496112_0000239 Ga0496112_0000239_24200_25321 366
41 3300005354 Ga0070675_100150660 Ga0070675_1001506602 369
42 3300035725 Ga0373947_0025872 Ga0373947_0025872_1397_2527 369
43 3300009147 Ga0114129_10014743 Ga0114129_100147432 370
44 3300050507 nmdc:mga05p37_9149_c1 nmdc:mga05p37_9149_c1_5705_6862 370
45 3300050510 nmdc:mga06r32_19772_c1 nmdc:mga06r32_19772_c1_2452_3609 370
46 3300006195 Ga0075366_10000813 Ga0075366_100008132 372
47 3300025921 Ga0207652_10238284 Ga0207652_102382842 372
48 3300026116 Ga0207674_10091496 Ga0207674_100914963 372
49 3300047471 Ga0495684_0176641 Ga0495684_0176641_447_1568 373
50 3300005336 Ga0070680_100145406 Ga0070680_1001454061 374
51 3300005458 Ga0070681_10039172 Ga0070681_100391723 374
52 3300005293 Ga0065715_10003970 Ga0065715_100039706 376
53 3300005440 Ga0070705_100082931 Ga0070705_1000829312 376
54 3300009147 Ga0114129_10002287 Ga0114129_1000228724 376
55 3300025917 Ga0207660_10134959 Ga0207660_101349592 376
56 3300025932 Ga0207690_10122804 Ga0207690_101228042 376
57 3300050507 nmdc:mga05p37_20323_c1 nmdc:mga05p37_20323_c1_2856_4007 376
58 3300005339 Ga0070660_100085840 Ga0070660_1000858402 377
59 3300005366 Ga0070659_100134656 Ga0070659_1001346561 377
60 3300005563 Ga0068855_100041733 Ga0068855_1000417332 377
61 3300005334 Ga0068869_100013754 Ga0068869_1000137545 379
62 3300009094 Ga0111539_10184203 Ga0111539_101842032 379
63 3300025942 Ga0207689_10021474 Ga0207689_100214745 379
64 3300050491 nmdc:mga00v17_7477_c1 nmdc:mga00v17_7477_c1_1466_2632 379
65 3300005366 Ga0070659_100152300 Ga0070659_1001523002 380
66 3300005614 Ga0068856_100230156 Ga0068856_1002301562 380
67 3300006038 Ga0075365_10000667 Ga0075365_1000066710 380
68 3300026078 Ga0207702_10232441 Ga0207702_102324412 380
69 3300006871 Ga0075434_100195943 Ga0075434_1001959431 381
70 3300026023 Ga0207677_10175594 Ga0207677_101755942 381
71 3300026095 Ga0207676_10027622 Ga0207676_100276223 381
72 3300042435 Ga0439434_0050872 Ga0439434_0050872_42_1223 381
73 3300049581 Ga0501047_0133692 Ga0501047_0133692_1161_2339 381
74 3300005339 Ga0070660_100146618 Ga0070660_1001466182 382
75 3300005343 Ga0070687_100012098 Ga0070687_1000120982 382
76 3300005353 Ga0070669_100006946 Ga0070669_1000069462 382
77 3300005354 Ga0070675_100001330 Ga0070675_10000133013 382
78 3300005365 Ga0070688_100144555 Ga0070688_1001445552 382
79 3300005543 Ga0070672_100076192 Ga0070672_1000761922 382
80 3300005544 Ga0070686_100001318 Ga0070686_10000131811 382
81 3300005577 Ga0068857_100042244 Ga0068857_1000422443 382
82 3300005578 Ga0068854_100002292 Ga0068854_10000229210 382
83 3300005617 Ga0068859_100082908 Ga0068859_1000829084 382
84 3300005840 Ga0068870_10013692 Ga0068870_100136925 382
85 3300005843 Ga0068860_100309635 Ga0068860_1003096351 382
86 3300005844 Ga0068862_100014888 Ga0068862_1000148885 382
87 3300006931 Ga0097620_100082906 Ga0097620_1000829064 382
88 3300009093 Ga0105240_10063239 Ga0105240_100632392 382
89 3300009174 Ga0105241_10099609 Ga0105241_100996092 382
90 3300014326 Ga0157380_10170208 Ga0157380_101702082 382
91 3300025918 Ga0207662_10018429 Ga0207662_100184292 382
92 3300025919 Ga0207657_10144969 Ga0207657_101449692 382
93 3300025921 Ga0207652_10249444 Ga0207652_102494441 382
94 3300025926 Ga0207659_10000270 Ga0207659_100002703 382
95 3300025940 Ga0207691_10090982 Ga0207691_100909824 382
96 3300025981 Ga0207640_10001344 Ga0207640_100013446 382
97 3300025981 Ga0207640_10240285 Ga0207640_102402851 382
98 3300026116 Ga0207674_10046435 Ga0207674_100464351 382
99 3300026118 Ga0207675_100235087 Ga0207675_1002350872 382
100 3300027907 Ga0207428_10007456 Ga0207428_100074569 382
101 3300028381 Ga0268264_10281668 Ga0268264_102816681 382
102 3300048912 Ga0496109_0154391 Ga0496109_0154391_899_2077 382
103 3300050513 nmdc:mga0rr50_1678_c1 nmdc:mga0rr50_1678_c1_2279_3427 382
104 3300005328 Ga0070676_10029335 Ga0070676_100293353 383
105 3300005331 Ga0070670_100018976 Ga0070670_1000189764 383
106 3300005366 Ga0070659_100139170 Ga0070659_1001391702 383
107 3300005438 Ga0070701_10054353 Ga0070701_100543532 383
108 3300005547 Ga0070693_100077401 Ga0070693_1000774011 383
109 3300005549 Ga0070704_100018297 Ga0070704_1000182972 383
110 3300005616 Ga0068852_100210161 Ga0068852_1002101613 383
111 3300005617 Ga0068859_100092503 Ga0068859_1000925033 383
112 3300005719 Ga0068861_100096526 Ga0068861_1000965263 383
113 3300006051 Ga0075364_10027154 Ga0075364_100271543 383
114 3300006931 Ga0097620_100092504 Ga0097620_1000925043 383
115 3300007076 Ga0075435_100043307 Ga0075435_1000433072 383
116 3300009098 Ga0105245_10067206 Ga0105245_100672063 383
117 3300009177 Ga0105248_10062649 Ga0105248_100626494 383
118 3300025907 Ga0207645_10015212 Ga0207645_100152124 383
119 3300025918 Ga0207662_10072560 Ga0207662_100725602 383
120 3300025925 Ga0207650_10018941 Ga0207650_100189413 383
121 3300025942 Ga0207689_10023090 Ga0207689_100230902 383
122 3300025960 Ga0207651_10005762 Ga0207651_100057621 383
123 3300026118 Ga0207675_100129134 Ga0207675_1001291342 383
124 3300026121 Ga0207683_10073381 Ga0207683_100733813 383
125 3300059421 Ga0590071_000131 Ga0590071_000131_9591_10769 383
126 3300059424 Ga0590075_000277 Ga0590075_000277_5853_7031 383
127 3300059426 Ga0590077_000835 Ga0590077_000835_4296_5474 383
128 3300009093 Ga0105240_10022324 Ga0105240_100223245 384
129 3300013307 Ga0157372_10241984 Ga0157372_102419843 384
130 3300025913 Ga0207695_10192088 Ga0207695_101920882 384
131 3300048909 Ga0496106_0131719 Ga0496106_0131719_515_1714 384
132 3300005434 Ga0070709_10125876 Ga0070709_101258762 385
133 3300005438 Ga0070701_10087354 Ga0070701_100873542 385
134 3300005444 Ga0070694_100093590 Ga0070694_1000935902 385
135 3300009147 Ga0114129_10046704 Ga0114129_100467044 385
136 3300025893 Ga0207682_10043870 Ga0207682_100438701 385
137 3300031824 Ga0307413_10006384 Ga0307413_100063842 385
138 3300031903 Ga0307407_10005911 Ga0307407_100059114 385
139 3300031903 Ga0307407_10021729 Ga0307407_100217292 385
140 3300031911 Ga0307412_10103731 Ga0307412_101037312 385
141 3300034816 Ga0373930_0002288 Ga0373930_0002288_309_1469 385
142 3300034820 Ga0373959_0001402 Ga0373959_0001402_2384_3544 385
143 3300035084 Ga0373928_0001099 Ga0373928_0001099_3734_4894 385
144 3300035085 Ga0373929_0002195 Ga0373929_0002195_309_1469 385
145 3300035090 Ga0373949_0000401 Ga0373949_0000401_5867_7027 385
146 3300035092 Ga0373952_0001258 Ga0373952_0001258_1042_2202 385
147 3300035112 Ga0373932_0008273 Ga0373932_0008273_572_1732 385
148 3300035114 Ga0373939_0000437 Ga0373939_0000437_8598_9758 385
149 3300035115 Ga0373941_0013915 Ga0373941_0013915_564_1724 385
150 3300035121 Ga0373960_0000079 Ga0373960_0000079_6358_7518 385
151 3300035241 Ga0373961_0001454 Ga0373961_0001454_1480_2640 385
152 3300035691 Ga0373931_0018317 Ga0373931_0018317_1936_3096 385
153 3300045051 Ga0451576_0004987 Ga0451576_0004987_6861_8021 385
154 3300050507 nmdc:mga05p37_21731_c1 nmdc:mga05p37_21731_c1_4161_5345 385
155 3300005295 Ga0065707_10028992 Ga0065707_100289921 386
156 3300005340 Ga0070689_100049046 Ga0070689_1000490463 386
157 3300005343 Ga0070687_100028274 Ga0070687_1000282742 386
158 3300005364 Ga0070673_100000770 Ga0070673_10000077010 386
159 3300005440 Ga0070705_100036381 Ga0070705_1000363811 386
160 3300006051 Ga0075364_10002152 Ga0075364_100021525 386
161 3300006177 Ga0075362_10002514 Ga0075362_100025145 386
162 3300006195 Ga0075366_10051487 Ga0075366_100514872 386
163 3300009093 Ga0105240_10049136 Ga0105240_100491365 386
164 3300025919 Ga0207657_10165811 Ga0207657_101658112 386
165 3300025935 Ga0207709_10196466 Ga0207709_101964661 386
166 3300025936 Ga0207670_10120399 Ga0207670_101203992 386
167 3300026088 Ga0207641_10282412 Ga0207641_102824121 386
168 3300026089 Ga0207648_10231691 Ga0207648_102316912 386
169 3300048907 Ga0496104_0064975 Ga0496104_0064975_1252_2442 386
170 3300050493 nmdc:mga0k408_3616_c2 nmdc:mga0k408_3616_c2_2939_4177 386
171 3300050494 nmdc:mga06z11_37437_c1 nmdc:mga06z11_37437_c1_537_1775 386
172 3300053085 Ga0495619_0116117 Ga0495619_0116117_18_1199 386
173 3300005339 Ga0070660_100019428 Ga0070660_1000194283 387
174 3300005366 Ga0070659_100173782 Ga0070659_1001737822 387
175 3300005530 Ga0070679_100059323 Ga0070679_1000593232 387
176 3300005539 Ga0068853_100154790 Ga0068853_1001547902 387
177 3300005563 Ga0068855_100009176 Ga0068855_1000091764 387
178 3300005618 Ga0068864_100160447 Ga0068864_1001604473 387
179 3300005842 Ga0068858_100068660 Ga0068858_1000686601 387
180 3300009098 Ga0105245_10040694 Ga0105245_100406942 387
181 3300009176 Ga0105242_10072620 Ga0105242_100726202 387
182 3300009176 Ga0105242_10262867 Ga0105242_102628672 387
183 3300013296 Ga0157374_10010973 Ga0157374_100109734 387
184 3300025932 Ga0207690_10152712 Ga0207690_101527122 387
185 3300025934 Ga0207686_10046901 Ga0207686_100469011 387
186 3300025949 Ga0207667_10149816 Ga0207667_101498162 387
187 3300026035 Ga0207703_10105839 Ga0207703_101058392 387
188 3300028379 Ga0268266_10062016 Ga0268266_100620164 387
189 3300048905 Ga0496102_0127071 Ga0496102_0127071_16_1179 387
190 3300005347 Ga0070668_100210459 Ga0070668_1002104592 388
191 3300005356 Ga0070674_100066680 Ga0070674_1000666802 388
192 3300005719 Ga0068861_100007053 Ga0068861_1000070531 388
193 3300005844 Ga0068862_100036488 Ga0068862_1000364882 388
194 3300005844 Ga0068862_100253154 Ga0068862_1002531542 388
195 3300014968 Ga0157379_10073172 Ga0157379_100731721 388
196 3300014969 Ga0157376_10220387 Ga0157376_102203872 388
197 3300025923 Ga0207681_10026980 Ga0207681_100269802 388
198 3300025933 Ga0207706_10056672 Ga0207706_100566723 388
199 3300025972 Ga0207668_10135483 Ga0207668_101354832 388
200 3300026075 Ga0207708_10010667 Ga0207708_100106678 388
201 3300028380 Ga0268265_10033522 Ga0268265_100335222 388
202 3300048917 Ga0496114_0090934 Ga0496114_0090934_18_1184 388
203 3300050510 nmdc:mga06r32_148088_c1 nmdc:mga06r32_148088_c1_662_1843 388
204 3300059421 Ga0590071_001455 Ga0590071_001455_275_1468 388
205 3300059424 Ga0590075_000184 Ga0590075_000184_3856_5049 388
206 3300059426 Ga0590077_001162 Ga0590077_001162_3917_5110 388
207 3300049588 Ga0501072_0122799 Ga0501072_0122799_658_1893 390
208 3300005548 Ga0070665_100127316 Ga0070665_1001273163 394
209 3300046536 Ga0495587_0138986 Ga0495587_0138986_76_1260 394
210 3300046663 Ga0495635_0050139 Ga0495635_0050139_1628_2812 394
211 3300046681 Ga0495647_0005912 Ga0495647_0005912_1107_2291 394
212 3300053085 Ga0495619_0010564 Ga0495619_0010564_1172_2356 394
213 3300005718 Ga0068866_10058181 Ga0068866_100581812 395
214 3300006237 Ga0097621_100001775 Ga0097621_1000017756 395
215 3300006358 Ga0068871_100028167 Ga0068871_1000281673 395
216 3300006881 Ga0068865_100011288 Ga0068865_1000112883 395
217 3300009098 Ga0105245_10093163 Ga0105245_100931633 395
218 3300009176 Ga0105242_10006639 Ga0105242_100066394 395
219 3300009177 Ga0105248_10158732 Ga0105248_101587322 395
220 3300025941 Ga0207711_10239932 Ga0207711_102399322 395
221 3300027907 Ga0207428_10014674 Ga0207428_100146744 395
222 3300005290 Ga0065712_10007008 Ga0065712_100070083 398
223 3300005618 Ga0068864_100005160 Ga0068864_1000051607 398
224 3300009177 Ga0105248_10010397 Ga0105248_100103977 398
225 3300014968 Ga0157379_10090358 Ga0157379_100903582 398
226 3300025941 Ga0207711_10135785 Ga0207711_101357853 398
227 3300026035 Ga0207703_10032923 Ga0207703_100329232 398
228 3300026095 Ga0207676_10019080 Ga0207676_100190807 398
229 3300048911 Ga0496108_0024013 Ga0496108_0024013_742_1938 398
230 3300048915 Ga0496112_0240198 Ga0496112_0240198_241_1437 398
231 3300048916 Ga0496113_0023756 Ga0496113_0023756_893_2089 398
232 3300050511 nmdc:mga08y16_46502_c1 nmdc:mga08y16_46502_c1_130_1416 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

52

415

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qmi-assembly1.cif.gz_E structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi 0.8569 35 364
4gdn-assembly4.cif.gz_D structure of fmta-like protein 0.8569 38 385
4e6x-assembly2.cif.gz_B clbp in complex boron-based inhibitor 0.8562 39 389
4gdn-assembly2.cif.gz_B structure of fmta-like protein 0.8555 38 385
7mde-assembly1.cif.gz_A-2 full-length s95a clbp 0.8552 37 364
ID Description Score Start End Superfamily
af_Q54VJ1_35_370_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8902 27 364 3.40.710.10
af_A8MY62_19_346_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.885 34 363 3.40.710.10
af_Q54VJ1_35_370_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8776 27 364 3.40.710.10
af_A8MY62_19_346_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8696 34 363 3.40.710.10
2qmiA01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8646 35 364 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A3D0P5S2-F1-model_v4 Serine hydrolase 0.9445 31 269 GO:0016787
AF-A0A3D0P5S2-F1-model_v4 Serine hydrolase 0.915 31 269 GO:0016787
AF-A0A7Y5R653-F1-model_v4 Serine hydrolase 0.8867 34 390 GO:0016787
AF-A0A7V9IA13-F1-model_v4 Serine hydrolase 0.8863 31 390 GO:0016787
AF-A0A1S8N2B1-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.8859 30 367 GO:0008800

Feature Viewer

pLDDT pTM Quality
85.35 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map