F344786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 166 | 232 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300005438|Ga0070701_10054353|Ga0070701_100543532 |
| Length | 429 |
| Sequence | MGRPSGTLRTAVVLASLAALRLFQPPESFRLTTFAEATVAKKAEATSEPAGWADVVQGYRAALGRAGIVGSSLMIVRDGRIVARANEGLQDREAGAPVTDDTIYHWASITKTFTGIAIMQLRDRGLLSLDDPVVKFVPELRLAHDPFGDISQVKIRHLMSHSAGFRASTWPWGGDKPWHPFEPTSWEQIVAMMPYTDVQFAPGSKYSYSNPGVIFLGRIIQLLSGDDYEVYVTKNILMPLGMQRTFFDRAPYFLRPFRSHSYVRDEAGLREAPFDFDTGITVSNGGLNAPFGDMARYLAFLSGSGDSAVAATYNTVLKRTSLEEMWTPQIRASEGEGVNGTDSQAALSFFVEQWPLDSRRSLGTGPVELVGHSGDQNGFISHLYLHRPSRTAWVISLNTDTTASKDGSRPSSRQVDMAVRDLIVNKILH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 120 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 123 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 125 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 127 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 154 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 157 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 165 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 166 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.47 |
| Nodule | 0 |
| Rhizoplane | 5.17 |
| Rhizosphere | 88.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10007008 | 3300005290 | Bacteria | 2858 |
| 2 | Ga0065712_10097036 | 3300005290 | Bacteria | 2163 |
| 3 | Ga0065715_10003970 | 3300005293 | Bacteria | 6343 |
| 4 | Ga0065707_10028992 | 3300005295 | Bacteria | 1681 |
| 5 | Ga0070676_10029335 | 3300005328 | Bacteria | 3128 |
| 6 | Ga0070683_100000197 | 3300005329 | Bacteria | 40400 |
| 7 | Ga0070670_100018976 | 3300005331 | Bacteria | 5898 |
| 8 | Ga0070670_100090930 | 3300005331 | Bacteria | 2623 |
| 9 | Ga0068869_100013754 | 3300005334 | Bacteria | 5391 |
| 10 | Ga0070680_100145406 | 3300005336 | Bacteria | 1989 |
| 11 | Ga0070660_100019428 | 3300005339 | Bacteria | 4980 |
| 12 | Ga0070660_100085840 | 3300005339 | Bacteria | 2476 |
| 13 | Ga0070660_100146618 | 3300005339 | Bacteria | 1896 |
| 14 | Ga0070689_100049046 | 3300005340 | Bacteria | 3258 |
| 15 | Ga0070687_100012098 | 3300005343 | Bacteria | 3798 |
| 16 | Ga0070687_100028274 | 3300005343 | Bacteria | 2718 |
| 17 | Ga0070661_100055485 | 3300005344 | Bacteria | 2901 |
| 18 | Ga0070668_100210459 | 3300005347 | Bacteria | 1599 |
| 19 | Ga0070669_100006946 | 3300005353 | Bacteria | 8135 |
| 20 | Ga0070669_100147442 | 3300005353 | Unclassified | 1819 |
| 21 | Ga0070675_100001330 | 3300005354 | Bacteria | 18075 |
| 22 | Ga0070675_100150660 | 3300005354 | Bacteria | 1994 |
| 23 | Ga0070671_100037908 | 3300005355 | Unclassified | 4000 |
| 24 | Ga0070674_100066680 | 3300005356 | Bacteria | 2530 |
| 25 | Ga0070673_100000770 | 3300005364 | Bacteria | 17805 |
| 26 | Ga0070673_100068749 | 3300005364 | Bacteria | 2837 |
| 27 | Ga0070688_100144555 | 3300005365 | Unclassified | 1619 |
| 28 | Ga0070659_100134656 | 3300005366 | Bacteria | 2009 |
| 29 | Ga0070659_100139170 | 3300005366 | Bacteria | 1976 |
| 30 | Ga0070659_100152300 | 3300005366 | Bacteria | 1887 |
| 31 | Ga0070659_100173782 | 3300005366 | Bacteria | 1766 |
| 32 | Ga0070709_10125876 | 3300005434 | Bacteria | 1743 |
| 33 | Ga0070701_10054353 | 3300005438 | Bacteria | 2088 |
| 34 | Ga0070701_10087354 | 3300005438 | Unclassified | 1701 |
| 35 | Ga0070705_100036381 | 3300005440 | Bacteria | 2768 |
| 36 | Ga0070705_100082931 | 3300005440 | Bacteria | 1974 |
| 37 | Ga0070694_100093590 | 3300005444 | Unclassified | 2113 |
| 38 | Ga0070662_100081728 | 3300005457 | Bacteria | 2408 |
| 39 | Ga0070681_10039172 | 3300005458 | Bacteria | 4751 |
| 40 | Ga0070679_100059323 | 3300005530 | Bacteria | 3814 |
| 41 | Ga0070684_100020869 | 3300005535 | Bacteria | 5438 |
| 42 | Ga0068853_100154790 | 3300005539 | Bacteria | 2065 |
| 43 | Ga0070672_100076192 | 3300005543 | Bacteria | 2679 |
| 44 | Ga0070672_100138581 | 3300005543 | Bacteria | 2005 |
| 45 | Ga0070686_100001318 | 3300005544 | Bacteria | 14039 |
| 46 | Ga0070693_100077401 | 3300005547 | Bacteria | 1974 |
| 47 | Ga0070665_100127316 | 3300005548 | Bacteria | 2549 |
| 48 | Ga0070704_100018297 | 3300005549 | Bacteria | 4477 |
| 49 | Ga0068855_100009176 | 3300005563 | Bacteria | 11943 |
| 50 | Ga0068855_100041733 | 3300005563 | Bacteria | 5437 |
| 51 | Ga0070664_100030444 | 3300005564 | Bacteria | 4502 |
| 52 | Ga0068857_100042244 | 3300005577 | Bacteria | 4043 |
| 53 | Ga0068854_100002292 | 3300005578 | Bacteria | 11776 |
| 54 | Ga0068856_100230156 | 3300005614 | Bacteria | 1869 |
| 55 | Ga0068852_100210161 | 3300005616 | Bacteria | 1846 |
| 56 | Ga0068859_100082908 | 3300005617 | Bacteria | 3248 |
| 57 | Ga0068859_100092503 | 3300005617 | Bacteria | 3075 |
| 58 | Ga0068864_100005160 | 3300005618 | Bacteria | 10699 |
| 59 | Ga0068864_100160447 | 3300005618 | Bacteria | 2044 |
| 60 | Ga0068866_10058181 | 3300005718 | Bacteria | 1995 |
| 61 | Ga0068861_100007053 | 3300005719 | Bacteria | 7682 |
| 62 | Ga0068861_100096526 | 3300005719 | Bacteria | 2343 |
| 63 | Ga0068861_100108218 | 3300005719 | Bacteria | 2223 |
| 64 | Ga0068870_10013692 | 3300005840 | Bacteria | 3818 |
| 65 | Ga0068858_100068660 | 3300005842 | Bacteria | 3285 |
| 66 | Ga0068860_100309635 | 3300005843 | Unclassified | 1548 |
| 67 | Ga0068862_100014888 | 3300005844 | Bacteria | 6460 |
| 68 | Ga0068862_100036488 | 3300005844 | Bacteria | 4166 |
| 69 | Ga0068862_100253154 | 3300005844 | Bacteria | 1606 |
| 70 | Ga0075365_10000667 | 3300006038 | Bacteria | 13721 |
| 71 | Ga0075365_10093464 | 3300006038 | Bacteria | 2051 |
| 72 | Ga0075364_10002152 | 3300006051 | Bacteria | 11039 |
| 73 | Ga0075364_10027154 | 3300006051 | Bacteria | 3656 |
| 74 | Ga0075362_10002514 | 3300006177 | Bacteria | 6174 |
| 75 | Ga0075367_10012837 | 3300006178 | Bacteria | 4485 |
| 76 | Ga0075366_10000813 | 3300006195 | Bacteria | 14971 |
| 77 | Ga0075366_10051487 | 3300006195 | Bacteria | 2446 |
| 78 | Ga0097621_100001775 | 3300006237 | Bacteria | 14791 |
| 79 | Ga0075370_10002724 | 3300006353 | Bacteria | 8269 |
| 80 | Ga0068871_100028167 | 3300006358 | Bacteria | 4402 |
| 81 | Ga0075428_100014244 | 3300006844 | Bacteria | 8847 |
| 82 | Ga0075431_100013106 | 3300006847 | Bacteria | 8377 |
| 83 | Ga0075433_10273374 | 3300006852 | Unclassified | 1497 |
| 84 | Ga0075434_100195943 | 3300006871 | Bacteria | 2040 |
| 85 | Ga0075434_100244094 | 3300006871 | Bacteria | 1816 |
| 86 | Ga0068865_100011288 | 3300006881 | Bacteria | 5585 |
| 87 | Ga0097620_100082906 | 3300006931 | Bacteria | 3248 |
| 88 | Ga0097620_100092504 | 3300006931 | Bacteria | 3075 |
| 89 | Ga0075435_100001758 | 3300007076 | Bacteria | 14102 |
| 90 | Ga0075435_100043307 | 3300007076 | Bacteria | 3603 |
| 91 | Ga0105240_10022324 | 3300009093 | Bacteria | 8393 |
| 92 | Ga0105240_10049136 | 3300009093 | Bacteria | 5327 |
| 93 | Ga0105240_10063239 | 3300009093 | Bacteria | 4604 |
| 94 | Ga0111539_10000691 | 3300009094 | Bacteria | 43728 |
| 95 | Ga0111539_10140926 | 3300009094 | Bacteria | 2822 |
| 96 | Ga0111539_10184203 | 3300009094 | Bacteria | 2439 |
| 97 | Ga0105245_10040694 | 3300009098 | Bacteria | 4142 |
| 98 | Ga0105245_10067206 | 3300009098 | Bacteria | 3246 |
| 99 | Ga0105245_10093163 | 3300009098 | Bacteria | 2775 |
| 100 | Ga0114129_10002287 | 3300009147 | Bacteria | 26519 |
| 101 | Ga0114129_10014743 | 3300009147 | Bacteria | 11134 |
| 102 | Ga0114129_10046704 | 3300009147 | Bacteria | 6085 |
| 103 | Ga0105241_10099609 | 3300009174 | Bacteria | 2308 |
| 104 | Ga0105242_10006639 | 3300009176 | Bacteria | 8924 |
| 105 | Ga0105242_10072620 | 3300009176 | Bacteria | 2858 |
| 106 | Ga0105242_10262867 | 3300009176 | Bacteria | 1560 |
| 107 | Ga0105248_10010397 | 3300009177 | Bacteria | 10249 |
| 108 | Ga0105248_10062649 | 3300009177 | Bacteria | 4176 |
| 109 | Ga0105248_10158732 | 3300009177 | Bacteria | 2551 |
| 110 | Ga0105249_10001531 | 3300009553 | Bacteria | 20288 |
| 111 | Ga0157374_10010973 | 3300013296 | Bacteria | 7823 |
| 112 | Ga0157374_10077248 | 3300013296 | Bacteria | 3151 |
| 113 | Ga0163162_10120970 | 3300013306 | Bacteria | 2722 |
| 114 | Ga0157372_10241984 | 3300013307 | Bacteria | 2094 |
| 115 | Ga0157380_10170208 | 3300014326 | Bacteria | 1903 |
| 116 | Ga0157379_10073172 | 3300014968 | Bacteria | 3067 |
| 117 | Ga0157379_10090358 | 3300014968 | Bacteria | 2747 |
| 118 | Ga0157376_10220387 | 3300014969 | Bacteria | 1757 |
| 119 | Ga0207682_10043870 | 3300025893 | Bacteria | 1832 |
| 120 | Ga0207645_10015212 | 3300025907 | Bacteria | 5122 |
| 121 | Ga0207654_10096224 | 3300025911 | Bacteria | 1815 |
| 122 | Ga0207695_10192088 | 3300025913 | Bacteria | 1959 |
| 123 | Ga0207660_10134959 | 3300025917 | Bacteria | 1882 |
| 124 | Ga0207662_10018429 | 3300025918 | Bacteria | 3961 |
| 125 | Ga0207662_10072560 | 3300025918 | Bacteria | 2086 |
| 126 | Ga0207657_10144969 | 3300025919 | Bacteria | 1938 |
| 127 | Ga0207657_10165811 | 3300025919 | Bacteria | 1792 |
| 128 | Ga0207652_10238284 | 3300025921 | Bacteria | 1640 |
| 129 | Ga0207652_10249444 | 3300025921 | Bacteria | 1601 |
| 130 | Ga0207681_10006314 | 3300025923 | Bacteria | 7275 |
| 131 | Ga0207681_10026980 | 3300025923 | Bacteria | 3710 |
| 132 | Ga0207650_10018941 | 3300025925 | Bacteria | 4836 |
| 133 | Ga0207659_10000270 | 3300025926 | Bacteria | 31679 |
| 134 | Ga0207644_10043626 | 3300025931 | Bacteria | 3184 |
| 135 | Ga0207690_10122804 | 3300025932 | Bacteria | 1889 |
| 136 | Ga0207690_10152712 | 3300025932 | Bacteria | 1713 |
| 137 | Ga0207706_10056672 | 3300025933 | Bacteria | 3454 |
| 138 | Ga0207686_10046901 | 3300025934 | Bacteria | 2668 |
| 139 | Ga0207709_10196466 | 3300025935 | Bacteria | 1437 |
| 140 | Ga0207670_10120399 | 3300025936 | Bacteria | 1907 |
| 141 | Ga0207691_10090982 | 3300025940 | Bacteria | 2734 |
| 142 | Ga0207711_10135785 | 3300025941 | Bacteria | 2209 |
| 143 | Ga0207711_10239932 | 3300025941 | Bacteria | 1662 |
| 144 | Ga0207689_10021474 | 3300025942 | Bacteria | 5427 |
| 145 | Ga0207689_10023090 | 3300025942 | Bacteria | 5223 |
| 146 | Ga0207667_10149816 | 3300025949 | Bacteria | 2401 |
| 147 | Ga0207651_10005762 | 3300025960 | Bacteria | 6397 |
| 148 | Ga0207668_10135483 | 3300025972 | Bacteria | 1886 |
| 149 | Ga0207640_10001344 | 3300025981 | Bacteria | 13329 |
| 150 | Ga0207640_10240285 | 3300025981 | Bacteria | 1399 |
| 151 | Ga0207677_10175594 | 3300026023 | Bacteria | 1680 |
| 152 | Ga0207703_10032923 | 3300026035 | Bacteria | 4106 |
| 153 | Ga0207703_10105839 | 3300026035 | Bacteria | 2392 |
| 154 | Ga0207708_10010667 | 3300026075 | Bacteria | 6825 |
| 155 | Ga0207702_10232441 | 3300026078 | Bacteria | 1724 |
| 156 | Ga0207641_10282412 | 3300026088 | Bacteria | 1562 |
| 157 | Ga0207648_10231691 | 3300026089 | Bacteria | 1643 |
| 158 | Ga0207676_10019080 | 3300026095 | Bacteria | 4997 |
| 159 | Ga0207676_10027622 | 3300026095 | Bacteria | 4229 |
| 160 | Ga0207674_10046435 | 3300026116 | Bacteria | 4459 |
| 161 | Ga0207674_10091496 | 3300026116 | Bacteria | 3032 |
| 162 | Ga0207675_100129134 | 3300026118 | Bacteria | 2396 |
| 163 | Ga0207675_100235087 | 3300026118 | Bacteria | 1769 |
| 164 | Ga0207683_10073381 | 3300026121 | Bacteria | 3027 |
| 165 | Ga0207428_10007456 | 3300027907 | Bacteria | 9972 |
| 166 | Ga0207428_10014674 | 3300027907 | Bacteria | 6791 |
| 167 | Ga0268266_10062016 | 3300028379 | Bacteria | 3225 |
| 168 | Ga0268265_10033522 | 3300028380 | Bacteria | 3734 |
| 169 | Ga0268264_10281668 | 3300028381 | Unclassified | 1558 |
| 170 | Ga0307413_10006384 | 3300031824 | Bacteria | 5376 |
| 171 | Ga0307407_10005911 | 3300031903 | Bacteria | 5373 |
| 172 | Ga0307407_10021729 | 3300031903 | Bacteria | 3316 |
| 173 | Ga0307412_10103731 | 3300031911 | Unclassified | 2016 |
| 174 | Ga0373930_0002288 | 3300034816 | Bacteria | 2953 |
| 175 | Ga0373959_0001402 | 3300034820 | Bacteria | 3852 |
| 176 | Ga0373928_0001099 | 3300035084 | Bacteria | 5349 |
| 177 | Ga0373929_0002195 | 3300035085 | Bacteria | 3621 |
| 178 | Ga0373949_0000401 | 3300035090 | Bacteria | 15100 |
| 179 | Ga0373952_0001258 | 3300035092 | Bacteria | 4626 |
| 180 | Ga0373932_0008273 | 3300035112 | Bacteria | 2484 |
| 181 | Ga0373939_0000437 | 3300035114 | Bacteria | 10500 |
| 182 | Ga0373941_0013915 | 3300035115 | Bacteria | 2137 |
| 183 | Ga0373960_0000079 | 3300035121 | Bacteria | 14145 |
| 184 | Ga0373961_0001454 | 3300035241 | Bacteria | 6963 |
| 185 | Ga0373931_0018317 | 3300035691 | Bacteria | 3481 |
| 186 | Ga0373947_0025872 | 3300035725 | Bacteria | 3424 |
| 187 | Ga0395905_0430541 | 3300037471 | Bacteria | 1216 |
| 188 | Ga0439434_0050872 | 3300042435 | Bacteria | 1284 |
| 189 | Ga0466963_0029428 | 3300044694 | Unclassified | 3536 |
| 190 | Ga0451576_0004987 | 3300045051 | Bacteria | 16888 |
| 191 | Ga0495587_0138986 | 3300046536 | Bacteria | 1387 |
| 192 | Ga0495635_0050139 | 3300046663 | Bacteria | 2878 |
| 193 | Ga0495647_0005912 | 3300046681 | Bacteria | 4029 |
| 194 | Ga0495684_0176641 | 3300047471 | Bacteria | 1585 |
| 195 | Ga0496102_0127071 | 3300048905 | Bacteria | 2384 |
| 196 | Ga0496104_0064975 | 3300048907 | Bacteria | 3462 |
| 197 | Ga0496105_0085180 | 3300048908 | Bacteria | 2611 |
| 198 | Ga0496106_0131719 | 3300048909 | Bacteria | 1962 |
| 199 | Ga0496108_0005060 | 3300048911 | Bacteria | 10651 |
| 200 | Ga0496108_0024013 | 3300048911 | Bacteria | 5019 |
| 201 | Ga0496109_0154391 | 3300048912 | Bacteria | 2150 |
| 202 | Ga0496110_0000256 | 3300048913 | Bacteria | 34589 |
| 203 | Ga0496112_0000239 | 3300048915 | Bacteria | 35278 |
| 204 | Ga0496112_0240198 | 3300048915 | Bacteria | 1764 |
| 205 | Ga0496113_0023756 | 3300048916 | Bacteria | 4350 |
| 206 | Ga0496114_0090934 | 3300048917 | Bacteria | 2591 |
| 207 | Ga0501047_0133692 | 3300049581 | Bacteria | 2361 |
| 208 | Ga0501072_0122799 | 3300049588 | Unclassified | 2069 |
| 209 | Ga0501076_0264275 | 3300049592 | Bacteria | 1409 |
| 210 | nmdc:mga00v17_7477_c1 | 3300050491 | Bacteria | 5831 |
| 211 | nmdc:mga00v17_9148_c1 | 3300050491 | Bacteria | 5348 |
| 212 | nmdc:mga0yw44_163126_c1 | 3300050492 | Bacteria | 1460 |
| 213 | nmdc:mga0k408_3616_c2 | 3300050493 | Bacteria | 6301 |
| 214 | nmdc:mga06z11_37437_c1 | 3300050494 | Bacteria | 2402 |
| 215 | nmdc:mga07m45_43393_c1 | 3300050496 | Bacteria | 2521 |
| 216 | nmdc:mga05p37_20323_c1 | 3300050507 | Bacteria | 8034 |
| 217 | nmdc:mga05p37_21731_c1 | 3300050507 | Bacteria | 7774 |
| 218 | nmdc:mga05p37_9149_c1 | 3300050507 | Bacteria | 7128 |
| 219 | nmdc:mga06r32_148088_c1 | 3300050510 | Bacteria | 2325 |
| 220 | nmdc:mga06r32_19772_c1 | 3300050510 | Bacteria | 6188 |
| 221 | nmdc:mga08y16_18244_c1 | 3300050511 | Bacteria | 7394 |
| 222 | nmdc:mga08y16_46502_c1 | 3300050511 | Bacteria | 4544 |
| 223 | nmdc:mga0rr50_1678_c1 | 3300050513 | Bacteria | 12208 |
| 224 | nmdc:mga0a205_16740_c1 | 3300050515 | Bacteria | 6865 |
| 225 | Ga0495619_0010564 | 3300053085 | Bacteria | 5809 |
| 226 | Ga0495619_0116117 | 3300053085 | Bacteria | 1832 |
| 227 | Ga0590071_000131 | 3300059421 | Bacteria | 20987 |
| 228 | Ga0590071_001455 | 3300059421 | Bacteria | 6243 |
| 229 | Ga0590075_000184 | 3300059424 | Bacteria | 17420 |
| 230 | Ga0590075_000277 | 3300059424 | Bacteria | 14510 |
| 231 | Ga0590077_000835 | 3300059426 | Bacteria | 7968 |
| 232 | Ga0590077_001162 | 3300059426 | Bacteria | 6404 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0430541 | Ga0395905_0430541_188_1201 | 330 |
| 2 | 3300005353 | Ga0070669_100147442 | Ga0070669_1001474421 | 339 |
| 3 | 3300005364 | Ga0070673_100068749 | Ga0070673_1000687491 | 339 |
| 4 | 3300005457 | Ga0070662_100081728 | Ga0070662_1000817281 | 339 |
| 5 | 3300005719 | Ga0068861_100108218 | Ga0068861_1001082182 | 339 |
| 6 | 3300006871 | Ga0075434_100244094 | Ga0075434_1002440942 | 339 |
| 7 | 3300007076 | Ga0075435_100001758 | Ga0075435_1000017583 | 339 |
| 8 | 3300025911 | Ga0207654_10096224 | Ga0207654_100962241 | 339 |
| 9 | 3300049592 | Ga0501076_0264275 | Ga0501076_0264275_40_1122 | 353 |
| 10 | 3300009094 | Ga0111539_10140926 | Ga0111539_101409263 | 356 |
| 11 | 3300006038 | Ga0075365_10093464 | Ga0075365_100934642 | 364 |
| 12 | 3300006178 | Ga0075367_10012837 | Ga0075367_100128371 | 364 |
| 13 | 3300006353 | Ga0075370_10002724 | Ga0075370_100027243 | 364 |
| 14 | 3300006844 | Ga0075428_100014244 | Ga0075428_1000142447 | 364 |
| 15 | 3300006847 | Ga0075431_100013106 | Ga0075431_1000131066 | 364 |
| 16 | 3300006852 | Ga0075433_10273374 | Ga0075433_102733741 | 364 |
| 17 | 3300009094 | Ga0111539_10000691 | Ga0111539_1000069124 | 364 |
| 18 | 3300009553 | Ga0105249_10001531 | Ga0105249_100015313 | 364 |
| 19 | 3300025923 | Ga0207681_10006314 | Ga0207681_100063141 | 364 |
| 20 | 3300050491 | nmdc:mga00v17_9148_c1 | nmdc:mga00v17_9148_c1_3645_4898 | 364 |
| 21 | 3300050492 | nmdc:mga0yw44_163126_c1 | nmdc:mga0yw44_163126_c1_14_1267 | 364 |
| 22 | 3300050496 | nmdc:mga07m45_43393_c1 | nmdc:mga07m45_43393_c1_495_1748 | 364 |
| 23 | 3300050511 | nmdc:mga08y16_18244_c1 | nmdc:mga08y16_18244_c1_4140_5255 | 364 |
| 24 | 3300050515 | nmdc:mga0a205_16740_c1 | nmdc:mga0a205_16740_c1_212_1327 | 364 |
| 25 | 3300044694 | Ga0466963_0029428 | Ga0466963_0029428_410_1582 | 365 |
| 26 | 3300005290 | Ga0065712_10097036 | Ga0065712_100970362 | 366 |
| 27 | 3300005329 | Ga0070683_100000197 | Ga0070683_10000019726 | 366 |
| 28 | 3300005331 | Ga0070670_100090930 | Ga0070670_1000909302 | 366 |
| 29 | 3300005344 | Ga0070661_100055485 | Ga0070661_1000554852 | 366 |
| 30 | 3300005355 | Ga0070671_100037908 | Ga0070671_1000379082 | 366 |
| 31 | 3300005535 | Ga0070684_100020869 | Ga0070684_1000208692 | 366 |
| 32 | 3300005543 | Ga0070672_100138581 | Ga0070672_1001385812 | 366 |
| 33 | 3300005564 | Ga0070664_100030444 | Ga0070664_1000304445 | 366 |
| 34 | 3300013296 | Ga0157374_10077248 | Ga0157374_100772483 | 366 |
| 35 | 3300013306 | Ga0163162_10120970 | Ga0163162_101209702 | 366 |
| 36 | 3300025931 | Ga0207644_10043626 | Ga0207644_100436262 | 366 |
| 37 | 3300048908 | Ga0496105_0085180 | Ga0496105_0085180_570_1691 | 366 |
| 38 | 3300048911 | Ga0496108_0005060 | Ga0496108_0005060_4447_5568 | 366 |
| 39 | 3300048913 | Ga0496110_0000256 | Ga0496110_0000256_18210_19331 | 366 |
| 40 | 3300048915 | Ga0496112_0000239 | Ga0496112_0000239_24200_25321 | 366 |
| 41 | 3300005354 | Ga0070675_100150660 | Ga0070675_1001506602 | 369 |
| 42 | 3300035725 | Ga0373947_0025872 | Ga0373947_0025872_1397_2527 | 369 |
| 43 | 3300009147 | Ga0114129_10014743 | Ga0114129_100147432 | 370 |
| 44 | 3300050507 | nmdc:mga05p37_9149_c1 | nmdc:mga05p37_9149_c1_5705_6862 | 370 |
| 45 | 3300050510 | nmdc:mga06r32_19772_c1 | nmdc:mga06r32_19772_c1_2452_3609 | 370 |
| 46 | 3300006195 | Ga0075366_10000813 | Ga0075366_100008132 | 372 |
| 47 | 3300025921 | Ga0207652_10238284 | Ga0207652_102382842 | 372 |
| 48 | 3300026116 | Ga0207674_10091496 | Ga0207674_100914963 | 372 |
| 49 | 3300047471 | Ga0495684_0176641 | Ga0495684_0176641_447_1568 | 373 |
| 50 | 3300005336 | Ga0070680_100145406 | Ga0070680_1001454061 | 374 |
| 51 | 3300005458 | Ga0070681_10039172 | Ga0070681_100391723 | 374 |
| 52 | 3300005293 | Ga0065715_10003970 | Ga0065715_100039706 | 376 |
| 53 | 3300005440 | Ga0070705_100082931 | Ga0070705_1000829312 | 376 |
| 54 | 3300009147 | Ga0114129_10002287 | Ga0114129_1000228724 | 376 |
| 55 | 3300025917 | Ga0207660_10134959 | Ga0207660_101349592 | 376 |
| 56 | 3300025932 | Ga0207690_10122804 | Ga0207690_101228042 | 376 |
| 57 | 3300050507 | nmdc:mga05p37_20323_c1 | nmdc:mga05p37_20323_c1_2856_4007 | 376 |
| 58 | 3300005339 | Ga0070660_100085840 | Ga0070660_1000858402 | 377 |
| 59 | 3300005366 | Ga0070659_100134656 | Ga0070659_1001346561 | 377 |
| 60 | 3300005563 | Ga0068855_100041733 | Ga0068855_1000417332 | 377 |
| 61 | 3300005334 | Ga0068869_100013754 | Ga0068869_1000137545 | 379 |
| 62 | 3300009094 | Ga0111539_10184203 | Ga0111539_101842032 | 379 |
| 63 | 3300025942 | Ga0207689_10021474 | Ga0207689_100214745 | 379 |
| 64 | 3300050491 | nmdc:mga00v17_7477_c1 | nmdc:mga00v17_7477_c1_1466_2632 | 379 |
| 65 | 3300005366 | Ga0070659_100152300 | Ga0070659_1001523002 | 380 |
| 66 | 3300005614 | Ga0068856_100230156 | Ga0068856_1002301562 | 380 |
| 67 | 3300006038 | Ga0075365_10000667 | Ga0075365_1000066710 | 380 |
| 68 | 3300026078 | Ga0207702_10232441 | Ga0207702_102324412 | 380 |
| 69 | 3300006871 | Ga0075434_100195943 | Ga0075434_1001959431 | 381 |
| 70 | 3300026023 | Ga0207677_10175594 | Ga0207677_101755942 | 381 |
| 71 | 3300026095 | Ga0207676_10027622 | Ga0207676_100276223 | 381 |
| 72 | 3300042435 | Ga0439434_0050872 | Ga0439434_0050872_42_1223 | 381 |
| 73 | 3300049581 | Ga0501047_0133692 | Ga0501047_0133692_1161_2339 | 381 |
| 74 | 3300005339 | Ga0070660_100146618 | Ga0070660_1001466182 | 382 |
| 75 | 3300005343 | Ga0070687_100012098 | Ga0070687_1000120982 | 382 |
| 76 | 3300005353 | Ga0070669_100006946 | Ga0070669_1000069462 | 382 |
| 77 | 3300005354 | Ga0070675_100001330 | Ga0070675_10000133013 | 382 |
| 78 | 3300005365 | Ga0070688_100144555 | Ga0070688_1001445552 | 382 |
| 79 | 3300005543 | Ga0070672_100076192 | Ga0070672_1000761922 | 382 |
| 80 | 3300005544 | Ga0070686_100001318 | Ga0070686_10000131811 | 382 |
| 81 | 3300005577 | Ga0068857_100042244 | Ga0068857_1000422443 | 382 |
| 82 | 3300005578 | Ga0068854_100002292 | Ga0068854_10000229210 | 382 |
| 83 | 3300005617 | Ga0068859_100082908 | Ga0068859_1000829084 | 382 |
| 84 | 3300005840 | Ga0068870_10013692 | Ga0068870_100136925 | 382 |
| 85 | 3300005843 | Ga0068860_100309635 | Ga0068860_1003096351 | 382 |
| 86 | 3300005844 | Ga0068862_100014888 | Ga0068862_1000148885 | 382 |
| 87 | 3300006931 | Ga0097620_100082906 | Ga0097620_1000829064 | 382 |
| 88 | 3300009093 | Ga0105240_10063239 | Ga0105240_100632392 | 382 |
| 89 | 3300009174 | Ga0105241_10099609 | Ga0105241_100996092 | 382 |
| 90 | 3300014326 | Ga0157380_10170208 | Ga0157380_101702082 | 382 |
| 91 | 3300025918 | Ga0207662_10018429 | Ga0207662_100184292 | 382 |
| 92 | 3300025919 | Ga0207657_10144969 | Ga0207657_101449692 | 382 |
| 93 | 3300025921 | Ga0207652_10249444 | Ga0207652_102494441 | 382 |
| 94 | 3300025926 | Ga0207659_10000270 | Ga0207659_100002703 | 382 |
| 95 | 3300025940 | Ga0207691_10090982 | Ga0207691_100909824 | 382 |
| 96 | 3300025981 | Ga0207640_10001344 | Ga0207640_100013446 | 382 |
| 97 | 3300025981 | Ga0207640_10240285 | Ga0207640_102402851 | 382 |
| 98 | 3300026116 | Ga0207674_10046435 | Ga0207674_100464351 | 382 |
| 99 | 3300026118 | Ga0207675_100235087 | Ga0207675_1002350872 | 382 |
| 100 | 3300027907 | Ga0207428_10007456 | Ga0207428_100074569 | 382 |
| 101 | 3300028381 | Ga0268264_10281668 | Ga0268264_102816681 | 382 |
| 102 | 3300048912 | Ga0496109_0154391 | Ga0496109_0154391_899_2077 | 382 |
| 103 | 3300050513 | nmdc:mga0rr50_1678_c1 | nmdc:mga0rr50_1678_c1_2279_3427 | 382 |
| 104 | 3300005328 | Ga0070676_10029335 | Ga0070676_100293353 | 383 |
| 105 | 3300005331 | Ga0070670_100018976 | Ga0070670_1000189764 | 383 |
| 106 | 3300005366 | Ga0070659_100139170 | Ga0070659_1001391702 | 383 |
| 107 | 3300005438 | Ga0070701_10054353 | Ga0070701_100543532 | 383 |
| 108 | 3300005547 | Ga0070693_100077401 | Ga0070693_1000774011 | 383 |
| 109 | 3300005549 | Ga0070704_100018297 | Ga0070704_1000182972 | 383 |
| 110 | 3300005616 | Ga0068852_100210161 | Ga0068852_1002101613 | 383 |
| 111 | 3300005617 | Ga0068859_100092503 | Ga0068859_1000925033 | 383 |
| 112 | 3300005719 | Ga0068861_100096526 | Ga0068861_1000965263 | 383 |
| 113 | 3300006051 | Ga0075364_10027154 | Ga0075364_100271543 | 383 |
| 114 | 3300006931 | Ga0097620_100092504 | Ga0097620_1000925043 | 383 |
| 115 | 3300007076 | Ga0075435_100043307 | Ga0075435_1000433072 | 383 |
| 116 | 3300009098 | Ga0105245_10067206 | Ga0105245_100672063 | 383 |
| 117 | 3300009177 | Ga0105248_10062649 | Ga0105248_100626494 | 383 |
| 118 | 3300025907 | Ga0207645_10015212 | Ga0207645_100152124 | 383 |
| 119 | 3300025918 | Ga0207662_10072560 | Ga0207662_100725602 | 383 |
| 120 | 3300025925 | Ga0207650_10018941 | Ga0207650_100189413 | 383 |
| 121 | 3300025942 | Ga0207689_10023090 | Ga0207689_100230902 | 383 |
| 122 | 3300025960 | Ga0207651_10005762 | Ga0207651_100057621 | 383 |
| 123 | 3300026118 | Ga0207675_100129134 | Ga0207675_1001291342 | 383 |
| 124 | 3300026121 | Ga0207683_10073381 | Ga0207683_100733813 | 383 |
| 125 | 3300059421 | Ga0590071_000131 | Ga0590071_000131_9591_10769 | 383 |
| 126 | 3300059424 | Ga0590075_000277 | Ga0590075_000277_5853_7031 | 383 |
| 127 | 3300059426 | Ga0590077_000835 | Ga0590077_000835_4296_5474 | 383 |
| 128 | 3300009093 | Ga0105240_10022324 | Ga0105240_100223245 | 384 |
| 129 | 3300013307 | Ga0157372_10241984 | Ga0157372_102419843 | 384 |
| 130 | 3300025913 | Ga0207695_10192088 | Ga0207695_101920882 | 384 |
| 131 | 3300048909 | Ga0496106_0131719 | Ga0496106_0131719_515_1714 | 384 |
| 132 | 3300005434 | Ga0070709_10125876 | Ga0070709_101258762 | 385 |
| 133 | 3300005438 | Ga0070701_10087354 | Ga0070701_100873542 | 385 |
| 134 | 3300005444 | Ga0070694_100093590 | Ga0070694_1000935902 | 385 |
| 135 | 3300009147 | Ga0114129_10046704 | Ga0114129_100467044 | 385 |
| 136 | 3300025893 | Ga0207682_10043870 | Ga0207682_100438701 | 385 |
| 137 | 3300031824 | Ga0307413_10006384 | Ga0307413_100063842 | 385 |
| 138 | 3300031903 | Ga0307407_10005911 | Ga0307407_100059114 | 385 |
| 139 | 3300031903 | Ga0307407_10021729 | Ga0307407_100217292 | 385 |
| 140 | 3300031911 | Ga0307412_10103731 | Ga0307412_101037312 | 385 |
| 141 | 3300034816 | Ga0373930_0002288 | Ga0373930_0002288_309_1469 | 385 |
| 142 | 3300034820 | Ga0373959_0001402 | Ga0373959_0001402_2384_3544 | 385 |
| 143 | 3300035084 | Ga0373928_0001099 | Ga0373928_0001099_3734_4894 | 385 |
| 144 | 3300035085 | Ga0373929_0002195 | Ga0373929_0002195_309_1469 | 385 |
| 145 | 3300035090 | Ga0373949_0000401 | Ga0373949_0000401_5867_7027 | 385 |
| 146 | 3300035092 | Ga0373952_0001258 | Ga0373952_0001258_1042_2202 | 385 |
| 147 | 3300035112 | Ga0373932_0008273 | Ga0373932_0008273_572_1732 | 385 |
| 148 | 3300035114 | Ga0373939_0000437 | Ga0373939_0000437_8598_9758 | 385 |
| 149 | 3300035115 | Ga0373941_0013915 | Ga0373941_0013915_564_1724 | 385 |
| 150 | 3300035121 | Ga0373960_0000079 | Ga0373960_0000079_6358_7518 | 385 |
| 151 | 3300035241 | Ga0373961_0001454 | Ga0373961_0001454_1480_2640 | 385 |
| 152 | 3300035691 | Ga0373931_0018317 | Ga0373931_0018317_1936_3096 | 385 |
| 153 | 3300045051 | Ga0451576_0004987 | Ga0451576_0004987_6861_8021 | 385 |
| 154 | 3300050507 | nmdc:mga05p37_21731_c1 | nmdc:mga05p37_21731_c1_4161_5345 | 385 |
| 155 | 3300005295 | Ga0065707_10028992 | Ga0065707_100289921 | 386 |
| 156 | 3300005340 | Ga0070689_100049046 | Ga0070689_1000490463 | 386 |
| 157 | 3300005343 | Ga0070687_100028274 | Ga0070687_1000282742 | 386 |
| 158 | 3300005364 | Ga0070673_100000770 | Ga0070673_10000077010 | 386 |
| 159 | 3300005440 | Ga0070705_100036381 | Ga0070705_1000363811 | 386 |
| 160 | 3300006051 | Ga0075364_10002152 | Ga0075364_100021525 | 386 |
| 161 | 3300006177 | Ga0075362_10002514 | Ga0075362_100025145 | 386 |
| 162 | 3300006195 | Ga0075366_10051487 | Ga0075366_100514872 | 386 |
| 163 | 3300009093 | Ga0105240_10049136 | Ga0105240_100491365 | 386 |
| 164 | 3300025919 | Ga0207657_10165811 | Ga0207657_101658112 | 386 |
| 165 | 3300025935 | Ga0207709_10196466 | Ga0207709_101964661 | 386 |
| 166 | 3300025936 | Ga0207670_10120399 | Ga0207670_101203992 | 386 |
| 167 | 3300026088 | Ga0207641_10282412 | Ga0207641_102824121 | 386 |
| 168 | 3300026089 | Ga0207648_10231691 | Ga0207648_102316912 | 386 |
| 169 | 3300048907 | Ga0496104_0064975 | Ga0496104_0064975_1252_2442 | 386 |
| 170 | 3300050493 | nmdc:mga0k408_3616_c2 | nmdc:mga0k408_3616_c2_2939_4177 | 386 |
| 171 | 3300050494 | nmdc:mga06z11_37437_c1 | nmdc:mga06z11_37437_c1_537_1775 | 386 |
| 172 | 3300053085 | Ga0495619_0116117 | Ga0495619_0116117_18_1199 | 386 |
| 173 | 3300005339 | Ga0070660_100019428 | Ga0070660_1000194283 | 387 |
| 174 | 3300005366 | Ga0070659_100173782 | Ga0070659_1001737822 | 387 |
| 175 | 3300005530 | Ga0070679_100059323 | Ga0070679_1000593232 | 387 |
| 176 | 3300005539 | Ga0068853_100154790 | Ga0068853_1001547902 | 387 |
| 177 | 3300005563 | Ga0068855_100009176 | Ga0068855_1000091764 | 387 |
| 178 | 3300005618 | Ga0068864_100160447 | Ga0068864_1001604473 | 387 |
| 179 | 3300005842 | Ga0068858_100068660 | Ga0068858_1000686601 | 387 |
| 180 | 3300009098 | Ga0105245_10040694 | Ga0105245_100406942 | 387 |
| 181 | 3300009176 | Ga0105242_10072620 | Ga0105242_100726202 | 387 |
| 182 | 3300009176 | Ga0105242_10262867 | Ga0105242_102628672 | 387 |
| 183 | 3300013296 | Ga0157374_10010973 | Ga0157374_100109734 | 387 |
| 184 | 3300025932 | Ga0207690_10152712 | Ga0207690_101527122 | 387 |
| 185 | 3300025934 | Ga0207686_10046901 | Ga0207686_100469011 | 387 |
| 186 | 3300025949 | Ga0207667_10149816 | Ga0207667_101498162 | 387 |
| 187 | 3300026035 | Ga0207703_10105839 | Ga0207703_101058392 | 387 |
| 188 | 3300028379 | Ga0268266_10062016 | Ga0268266_100620164 | 387 |
| 189 | 3300048905 | Ga0496102_0127071 | Ga0496102_0127071_16_1179 | 387 |
| 190 | 3300005347 | Ga0070668_100210459 | Ga0070668_1002104592 | 388 |
| 191 | 3300005356 | Ga0070674_100066680 | Ga0070674_1000666802 | 388 |
| 192 | 3300005719 | Ga0068861_100007053 | Ga0068861_1000070531 | 388 |
| 193 | 3300005844 | Ga0068862_100036488 | Ga0068862_1000364882 | 388 |
| 194 | 3300005844 | Ga0068862_100253154 | Ga0068862_1002531542 | 388 |
| 195 | 3300014968 | Ga0157379_10073172 | Ga0157379_100731721 | 388 |
| 196 | 3300014969 | Ga0157376_10220387 | Ga0157376_102203872 | 388 |
| 197 | 3300025923 | Ga0207681_10026980 | Ga0207681_100269802 | 388 |
| 198 | 3300025933 | Ga0207706_10056672 | Ga0207706_100566723 | 388 |
| 199 | 3300025972 | Ga0207668_10135483 | Ga0207668_101354832 | 388 |
| 200 | 3300026075 | Ga0207708_10010667 | Ga0207708_100106678 | 388 |
| 201 | 3300028380 | Ga0268265_10033522 | Ga0268265_100335222 | 388 |
| 202 | 3300048917 | Ga0496114_0090934 | Ga0496114_0090934_18_1184 | 388 |
| 203 | 3300050510 | nmdc:mga06r32_148088_c1 | nmdc:mga06r32_148088_c1_662_1843 | 388 |
| 204 | 3300059421 | Ga0590071_001455 | Ga0590071_001455_275_1468 | 388 |
| 205 | 3300059424 | Ga0590075_000184 | Ga0590075_000184_3856_5049 | 388 |
| 206 | 3300059426 | Ga0590077_001162 | Ga0590077_001162_3917_5110 | 388 |
| 207 | 3300049588 | Ga0501072_0122799 | Ga0501072_0122799_658_1893 | 390 |
| 208 | 3300005548 | Ga0070665_100127316 | Ga0070665_1001273163 | 394 |
| 209 | 3300046536 | Ga0495587_0138986 | Ga0495587_0138986_76_1260 | 394 |
| 210 | 3300046663 | Ga0495635_0050139 | Ga0495635_0050139_1628_2812 | 394 |
| 211 | 3300046681 | Ga0495647_0005912 | Ga0495647_0005912_1107_2291 | 394 |
| 212 | 3300053085 | Ga0495619_0010564 | Ga0495619_0010564_1172_2356 | 394 |
| 213 | 3300005718 | Ga0068866_10058181 | Ga0068866_100581812 | 395 |
| 214 | 3300006237 | Ga0097621_100001775 | Ga0097621_1000017756 | 395 |
| 215 | 3300006358 | Ga0068871_100028167 | Ga0068871_1000281673 | 395 |
| 216 | 3300006881 | Ga0068865_100011288 | Ga0068865_1000112883 | 395 |
| 217 | 3300009098 | Ga0105245_10093163 | Ga0105245_100931633 | 395 |
| 218 | 3300009176 | Ga0105242_10006639 | Ga0105242_100066394 | 395 |
| 219 | 3300009177 | Ga0105248_10158732 | Ga0105248_101587322 | 395 |
| 220 | 3300025941 | Ga0207711_10239932 | Ga0207711_102399322 | 395 |
| 221 | 3300027907 | Ga0207428_10014674 | Ga0207428_100146744 | 395 |
| 222 | 3300005290 | Ga0065712_10007008 | Ga0065712_100070083 | 398 |
| 223 | 3300005618 | Ga0068864_100005160 | Ga0068864_1000051607 | 398 |
| 224 | 3300009177 | Ga0105248_10010397 | Ga0105248_100103977 | 398 |
| 225 | 3300014968 | Ga0157379_10090358 | Ga0157379_100903582 | 398 |
| 226 | 3300025941 | Ga0207711_10135785 | Ga0207711_101357853 | 398 |
| 227 | 3300026035 | Ga0207703_10032923 | Ga0207703_100329232 | 398 |
| 228 | 3300026095 | Ga0207676_10019080 | Ga0207676_100190807 | 398 |
| 229 | 3300048911 | Ga0496108_0024013 | Ga0496108_0024013_742_1938 | 398 |
| 230 | 3300048915 | Ga0496112_0240198 | Ga0496112_0240198_241_1437 | 398 |
| 231 | 3300048916 | Ga0496113_0023756 | Ga0496113_0023756_893_2089 | 398 |
| 232 | 3300050511 | nmdc:mga08y16_46502_c1 | nmdc:mga08y16_46502_c1_130_1416 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qmi-assembly1.cif.gz_E | structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi | 0.8569 | 35 | 364 |
| 4gdn-assembly4.cif.gz_D | structure of fmta-like protein | 0.8569 | 38 | 385 |
| 4e6x-assembly2.cif.gz_B | clbp in complex boron-based inhibitor | 0.8562 | 39 | 389 |
| 4gdn-assembly2.cif.gz_B | structure of fmta-like protein | 0.8555 | 38 | 385 |
| 7mde-assembly1.cif.gz_A-2 | full-length s95a clbp | 0.8552 | 37 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54VJ1_35_370_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8902 | 27 | 364 | 3.40.710.10 |
| af_A8MY62_19_346_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.885 | 34 | 363 | 3.40.710.10 |
| af_Q54VJ1_35_370_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8776 | 27 | 364 | 3.40.710.10 |
| af_A8MY62_19_346_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8696 | 34 | 363 | 3.40.710.10 |
| 2qmiA01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8646 | 35 | 364 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0P5S2-F1-model_v4 | Serine hydrolase | 0.9445 | 31 | 269 |
GO:0016787
|
| AF-A0A3D0P5S2-F1-model_v4 | Serine hydrolase | 0.915 | 31 | 269 |
GO:0016787
|
| AF-A0A7Y5R653-F1-model_v4 | Serine hydrolase | 0.8867 | 34 | 390 |
GO:0016787
|
| AF-A0A7V9IA13-F1-model_v4 | Serine hydrolase | 0.8863 | 31 | 390 |
GO:0016787
|
| AF-A0A1S8N2B1-F1-model_v4 | Beta-lactamase (EC 3.5.2.6) | 0.8859 | 30 | 367 |
GO:0008800
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar