F344756

General Info

Members Datasets Scaffolds Average Seq Length
232 128 464 126

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100226988|Ga0070675_1002269883
Length 137
Sequence MTMALLRYLANLTASKIALWCFLIWYLATVIHHFDPTPSIWLNALGISAIIGVALYLSVLEPGKPPPDRWTVVRLFLMPFCVSSFSQLIKGKGFVLVFPPNLHENAVALAACALFVAFVLLVKRVFLRRPRSASSRP

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 1.72
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 22.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100226988 3300005354 Bacteria 1628
2 rootH2_10181415 3300003320 Unclassified 1912
3 rootL2_10066613 3300003322 Bacteria 5395
4 Ga0070658_11058251 3300005327 Bacteria 706
5 Ga0070676_10126890 3300005328 Bacteria 1609
6 Ga0070690_100455041 3300005330 Bacteria 950
7 Ga0070670_100108349 3300005331 Bacteria 2393
8 Ga0070677_10014870 3300005333 Bacteria 2748
9 Ga0070677_10456586 3300005333 Unclassified 684
10 Ga0070677_10525774 3300005333 Unclassified 645
11 Ga0068869_100079723 3300005334 Bacteria 2441
12 Ga0068869_100096559 3300005334 Bacteria 2231
13 Ga0068869_100533154 3300005334 Bacteria 984
14 Ga0068869_101289844 3300005334 Bacteria 644
15 Ga0070682_100012070 3300005337 Bacteria 4944
16 Ga0070682_100058213 3300005337 Bacteria 2436
17 Ga0070682_100101256 3300005337 Bacteria 1902
18 Ga0070682_100279171 3300005337 Bacteria 1217
19 Ga0070682_100578871 3300005337 Bacteria 883
20 Ga0068868_100251100 3300005338 Unclassified 1489
21 Ga0068868_102080119 3300005338 Bacteria 540
22 Ga0070689_100007595 3300005340 Bacteria 7594
23 Ga0070691_10621965 3300005341 Unclassified 640
24 Ga0070687_100537918 3300005343 Bacteria 793
25 Ga0070661_100950340 3300005344 Unclassified 711
26 Ga0070661_101658589 3300005344 Bacteria 541
27 Ga0070668_100127382 3300005347 Bacteria 2040
28 Ga0070668_100702889 3300005347 Bacteria 892
29 Ga0070675_100191658 3300005354 Bacteria 1771
30 Ga0070675_100223405 3300005354 Bacteria 1641
31 Ga0070671_100980918 3300005355 Bacteria 740
32 Ga0070674_100132232 3300005356 Bacteria 1862
33 Ga0070674_100343941 3300005356 Bacteria 1202
34 Ga0070674_100399634 3300005356 Bacteria 1122
35 Ga0070673_100102488 3300005364 Bacteria 2360
36 Ga0070673_100104433 3300005364 Bacteria 2339
37 Ga0070688_100211266 3300005365 Bacteria 1362
38 Ga0070688_100224556 3300005365 Bacteria 1325
39 Ga0070688_100593663 3300005365 Bacteria 847
40 Ga0070688_101296283 3300005365 Bacteria 588
41 Ga0070710_10103249 3300005437 Bacteria 1701
42 Ga0070701_10009136 3300005438 Bacteria 4330
43 Ga0070711_100524730 3300005439 Unclassified 979
44 Ga0070705_100033435 3300005440 Bacteria 2866
45 Ga0070700_100088596 3300005441 Bacteria 2014
46 Ga0070700_100169034 3300005441 Unclassified 1512
47 Ga0070700_100355993 3300005441 Bacteria 1087
48 Ga0070663_100153214 3300005455 Bacteria 1769
49 Ga0070678_100122658 3300005456 Bacteria 2051
50 Ga0070678_100343905 3300005456 Bacteria 1280
51 Ga0070662_100749944 3300005457 Unclassified 828
52 Ga0068867_100057490 3300005459 Bacteria 2881
53 Ga0068867_101041360 3300005459 Bacteria 744
54 Ga0068867_101341243 3300005459 Bacteria 662
55 Ga0070685_10185613 3300005466 Bacteria 1342
56 Ga0070685_10335310 3300005466 Bacteria 1029
57 Ga0070685_10673721 3300005466 Bacteria 752
58 Ga0070685_10930210 3300005466 Bacteria 649
59 Ga0068853_101874974 3300005539 Bacteria 581
60 Ga0070672_100032618 3300005543 Bacteria 3933
61 Ga0070672_100073927 3300005543 Bacteria 2718
62 Ga0070672_100231796 3300005543 Bacteria 1551
63 Ga0070686_100031667 3300005544 Bacteria 3236
64 Ga0070686_100470466 3300005544 Bacteria 970
65 Ga0070695_100318577 3300005545 Unclassified 1155
66 Ga0070695_101420180 3300005545 Bacteria 576
67 Ga0070696_100792102 3300005546 Unclassified 780
68 Ga0070693_100034759 3300005547 Bacteria 2790
69 Ga0070665_100005966 3300005548 Bacteria 12469
70 Ga0070664_100146282 3300005564 Bacteria 2084
71 Ga0070664_100616169 3300005564 Bacteria 1007
72 Ga0070664_100631171 3300005564 Bacteria 995
73 Ga0068857_101069653 3300005577 Bacteria 778
74 Ga0070702_100078292 3300005615 Bacteria 1973
75 Ga0068852_102079562 3300005616 Unclassified 590
76 Ga0068859_100319745 3300005617 Bacteria 1646
77 Ga0068859_100934705 3300005617 Unclassified 951
78 Ga0068864_100110035 3300005618 Bacteria 2453
79 Ga0068866_10494625 3300005718 Bacteria 808
80 Ga0068861_100000972 3300005719 Bacteria 17468
81 Ga0068861_100007500 3300005719 Bacteria 7477
82 Ga0068861_100227471 3300005719 Unclassified 1580
83 Ga0068861_100644581 3300005719 Unclassified 978
84 Ga0068861_100675848 3300005719 Bacteria 957
85 Ga0068861_100934052 3300005719 Unclassified 824
86 Ga0068861_101358022 3300005719 Unclassified 693
87 Ga0068851_10178211 3300005834 Bacteria 1176
88 Ga0068870_10014624 3300005840 Bacteria 3710
89 Ga0068870_10106485 3300005840 Bacteria 1594
90 Ga0068863_100074230 3300005841 Bacteria 3217
91 Ga0068863_100094412 3300005841 Bacteria 2839
92 Ga0068863_100364621 3300005841 Unclassified 1409
93 Ga0068858_100692902 3300005842 Bacteria 991
94 Ga0068860_100027807 3300005843 Bacteria 5446
95 Ga0068860_100514188 3300005843 Unclassified 1197
96 Ga0068860_100920716 3300005843 Unclassified 891
97 Ga0068862_100020040 3300005844 Bacteria 5583
98 Ga0068862_100057421 3300005844 Bacteria 3338
99 Ga0068862_100109619 3300005844 Bacteria 2422
100 Ga0068862_101145144 3300005844 Bacteria 774
101 Ga0068862_101178018 3300005844 Bacteria 764
102 Ga0097621_100141150 3300006237 Bacteria 2058
103 Ga0097621_100153376 3300006237 Bacteria 1976
104 Ga0097621_100251896 3300006237 Unclassified 1546
105 Ga0068871_100091195 3300006358 Bacteria 2539
106 Ga0068871_100101959 3300006358 Bacteria 2405
107 Ga0068871_100870617 3300006358 Unclassified 834
108 Ga0068865_100048744 3300006881 Bacteria 2916
109 Ga0068865_100157168 3300006881 Bacteria 1731
110 Ga0068865_100176270 3300006881 Unclassified 1643
111 Ga0068865_100290450 3300006881 Bacteria 1305
112 Ga0097620_100319774 3300006931 Bacteria 1646
113 Ga0097620_100934587 3300006931 Unclassified 951
114 Ga0105245_12087960 3300009098 Unclassified 620
115 Ga0105243_11375883 3300009148 Bacteria 725
116 Ga0105242_12206642 3300009176 Bacteria 596
117 Ga0105248_10212124 3300009177 Bacteria 2182
118 Ga0105237_10453561 3300009545 Unclassified 1288
119 Ga0105249_11264575 3300009553 Unclassified 809
120 Ga0157375_10014699 3300013308 Bacteria 6994
121 Ga0157375_10274313 3300013308 Unclassified 1849
122 Ga0157375_10485727 3300013308 Unclassified 1400
123 Ga0157375_10757750 3300013308 Unclassified 1122
124 Ga0157375_12241775 3300013308 Unclassified 651
125 Ga0163163_10028372 3300014325 Bacteria 5373
126 Ga0163163_10237505 3300014325 Bacteria 1872
127 Ga0157380_10009330 3300014326 Bacteria 7027
128 Ga0157380_10047536 3300014326 Bacteria 3376
129 Ga0157380_10208802 3300014326 Bacteria 1738
130 Ga0157380_10869073 3300014326 Unclassified 925
131 Ga0157380_12378414 3300014326 Unclassified 595
132 Ga0157376_10108418 3300014969 Bacteria 2440
133 Ga0163161_10248632 3300017792 Bacteria 1385
134 Ga0163161_10830753 3300017792 Bacteria 778
135 Ga0163161_11043264 3300017792 Unclassified 700
136 Ga0207656_10129517 3300025321 Bacteria 1181
137 Ga0207682_10005809 3300025893 Bacteria 5000
138 Ga0207682_10015999 3300025893 Bacteria 2924
139 Ga0207682_10125630 3300025893 Bacteria 1142
140 Ga0207692_10862499 3300025898 Bacteria 594
141 Ga0207642_10668263 3300025899 Bacteria 652
142 Ga0207645_10275823 3300025907 Bacteria 1116
143 Ga0207645_10286763 3300025907 Bacteria 1094
144 Ga0207643_10097268 3300025908 Bacteria 1722
145 Ga0207662_10169764 3300025918 Bacteria 1398
146 Ga0207649_10095850 3300025920 Bacteria 1953
147 Ga0207649_11454141 3300025920 Bacteria 542
148 Ga0207681_10061306 3300025923 Bacteria 2585
149 Ga0207650_10096938 3300025925 Bacteria 2263
150 Ga0207650_10267965 3300025925 Bacteria 1387
151 Ga0207659_10183611 3300025926 Bacteria 1659
152 Ga0207659_10317499 3300025926 Bacteria 1284
153 Ga0207706_10138296 3300025933 Bacteria 2143
154 Ga0207709_10169197 3300025935 Unclassified 1532
155 Ga0207670_10057471 3300025936 Bacteria 2638
156 Ga0207669_10147548 3300025937 Bacteria 1642
157 Ga0207704_10070443 3300025938 Bacteria 2214
158 Ga0207704_11132108 3300025938 Unclassified 666
159 Ga0207691_10046527 3300025940 Bacteria 3986
160 Ga0207691_10099012 3300025940 Bacteria 2604
161 Ga0207691_10264305 3300025940 Bacteria 1483
162 Ga0207689_10060270 3300025942 Bacteria 3121
163 Ga0207689_10149034 3300025942 Unclassified 1928
164 Ga0207689_10218583 3300025942 Bacteria 1574
165 Ga0207679_10859089 3300025945 Bacteria 829
166 Ga0207679_11436014 3300025945 Bacteria 633
167 Ga0207651_10069440 3300025960 Bacteria 2488
168 Ga0207651_10254176 3300025960 Bacteria 1439
169 Ga0207640_11438734 3300025981 Unclassified 618
170 Ga0207678_10092042 3300026067 Bacteria 2592
171 Ga0207678_10528679 3300026067 Bacteria 1030
172 Ga0207708_10029257 3300026075 Bacteria 4174
173 Ga0207708_10031928 3300026075 Bacteria 3999
174 Ga0207641_10077038 3300026088 Bacteria 2884
175 Ga0207641_10125519 3300026088 Bacteria 2297
176 Ga0207648_10053940 3300026089 Bacteria 3512
177 Ga0207648_10120193 3300026089 Bacteria 2310
178 Ga0207648_10598445 3300026089 Unclassified 1016
179 Ga0207648_10788156 3300026089 Bacteria 884
180 Ga0207676_10228373 3300026095 Bacteria 1662
181 Ga0207676_10785041 3300026095 Bacteria 928
182 Ga0207674_10605742 3300026116 Bacteria 1058
183 Ga0207675_100004813 3300026118 Bacteria 13002
184 Ga0207675_100006984 3300026118 Bacteria 10679
185 Ga0207675_100354608 3300026118 Bacteria 1438
186 Ga0207675_100394327 3300026118 Unclassified 1363
187 Ga0207683_10051891 3300026121 Bacteria 3593
188 Ga0268266_10021112 3300028379 Bacteria 5548
189 Ga0268265_10123021 3300028380 Unclassified 2141
190 Ga0268265_10409474 3300028380 Unclassified 1256
191 Ga0268265_10618641 3300028380 Unclassified 1037
192 Ga0268265_10792674 3300028380 Bacteria 923
193 Ga0268264_10360529 3300028381 Bacteria 1386
194 Ga0268264_10565864 3300028381 Bacteria 1117
195 Ga0268264_11252429 3300028381 Unclassified 752
196 Ga0268264_12172061 3300028381 Unclassified 563
197 Ga0307511_10123584 3300030521 Bacteria 1589
198 Ga0307513_10034843 3300031456 Bacteria 5641
199 Ga0307513_10065737 3300031456 Bacteria 3815
200 Ga0307513_10200245 3300031456 Bacteria 1839
201 Ga0307408_100422035 3300031548 Bacteria 1150
202 Ga0307405_10063623 3300031731 Bacteria 2341
203 Ga0307413_10233544 3300031824 Bacteria 1352
204 Ga0307413_11556640 3300031824 Bacteria 586
205 Ga0307410_10031978 3300031852 Bacteria 3381
206 Ga0307406_10118408 3300031901 Bacteria 1836
207 Ga0307406_10371339 3300031901 Unclassified 1125
208 Ga0307409_100029921 3300031995 Bacteria 3905
209 Ga0307416_101130481 3300032002 Bacteria 888
210 Ga0307416_101776000 3300032002 Bacteria 721
211 Ga0307411_11150989 3300032005 Bacteria 701
212 Ga0451802_1413033 3300041460 Bacteria 636
213 Ga0451807_0624715 3300041486 Bacteria 1313
214 Ga0495639_0429023 3300046475 Bacteria 670
215 Ga0495585_0397195 3300046492 Bacteria 664
216 Ga0495656_0103170 3300046615 Unclassified 1322
217 Ga0495668_0068564 3300046616 Bacteria 1951
218 Ga0495668_0716598 3300046616 Bacteria 554
219 Ga0495625_0064425 3300046660 Bacteria 2585
220 Ga0495649_0005302 3300046694 Bacteria 8234
221 Ga0495672_0531525 3300047320 Unclassified 518
222 Ga0496104_0131242 3300048907 Unclassified 2407
223 Ga0496114_0066830 3300048917 Bacteria 3015
224 Ga0495678_136573 3300049459 Bacteria 807
225 Ga0501040_0174024 3300049576 Bacteria 1525
226 Ga0501042_0153943 3300049578 Bacteria 1658
227 Ga0501043_0587514 3300049579 Unclassified 824
228 Ga0501071_0935854 3300049587 Bacteria 669
229 nmdc:mga08y16_76773_c1 3300050511 Bacteria 3482
230 Ga0495655_0321798 3300053083 Bacteria 536
231 Ga0500644_0029998 3300053088 Unclassified 1716
232 Ga0500611_158907 3300053727 Unclassified 624
233 Ga0070675_100226988
234 rootH2_10181415
235 rootL2_10066613
236 Ga0070658_11058251
237 Ga0070676_10126890
238 Ga0070690_100455041
239 Ga0070670_100108349
240 Ga0070677_10014870
241 Ga0070677_10456586
242 Ga0070677_10525774
243 Ga0068869_100079723
244 Ga0068869_100096559
245 Ga0068869_100533154
246 Ga0068869_101289844
247 Ga0070682_100012070
248 Ga0070682_100058213
249 Ga0070682_100101256
250 Ga0070682_100279171
251 Ga0070682_100578871
252 Ga0068868_100251100
253 Ga0068868_102080119
254 Ga0070689_100007595
255 Ga0070691_10621965
256 Ga0070687_100537918
257 Ga0070661_100950340
258 Ga0070661_101658589
259 Ga0070668_100127382
260 Ga0070668_100702889
261 Ga0070675_100191658
262 Ga0070675_100223405
263 Ga0070671_100980918
264 Ga0070674_100132232
265 Ga0070674_100343941
266 Ga0070674_100399634
267 Ga0070673_100102488
268 Ga0070673_100104433
269 Ga0070688_100211266
270 Ga0070688_100224556
271 Ga0070688_100593663
272 Ga0070688_101296283
273 Ga0070710_10103249
274 Ga0070701_10009136
275 Ga0070711_100524730
276 Ga0070705_100033435
277 Ga0070700_100088596
278 Ga0070700_100169034
279 Ga0070700_100355993
280 Ga0070663_100153214
281 Ga0070678_100122658
282 Ga0070678_100343905
283 Ga0070662_100749944
284 Ga0068867_100057490
285 Ga0068867_101041360
286 Ga0068867_101341243
287 Ga0070685_10185613
288 Ga0070685_10335310
289 Ga0070685_10673721
290 Ga0070685_10930210
291 Ga0068853_101874974
292 Ga0070672_100032618
293 Ga0070672_100073927
294 Ga0070672_100231796
295 Ga0070686_100031667
296 Ga0070686_100470466
297 Ga0070695_100318577
298 Ga0070695_101420180
299 Ga0070696_100792102
300 Ga0070693_100034759
301 Ga0070665_100005966
302 Ga0070664_100146282
303 Ga0070664_100616169
304 Ga0070664_100631171
305 Ga0068857_101069653
306 Ga0070702_100078292
307 Ga0068852_102079562
308 Ga0068859_100319745
309 Ga0068859_100934705
310 Ga0068864_100110035
311 Ga0068866_10494625
312 Ga0068861_100000972
313 Ga0068861_100007500
314 Ga0068861_100227471
315 Ga0068861_100644581
316 Ga0068861_100675848
317 Ga0068861_100934052
318 Ga0068861_101358022
319 Ga0068851_10178211
320 Ga0068870_10014624
321 Ga0068870_10106485
322 Ga0068863_100074230
323 Ga0068863_100094412
324 Ga0068863_100364621
325 Ga0068858_100692902
326 Ga0068860_100027807
327 Ga0068860_100514188
328 Ga0068860_100920716
329 Ga0068862_100020040
330 Ga0068862_100057421
331 Ga0068862_100109619
332 Ga0068862_101145144
333 Ga0068862_101178018
334 Ga0097621_100141150
335 Ga0097621_100153376
336 Ga0097621_100251896
337 Ga0068871_100091195
338 Ga0068871_100101959
339 Ga0068871_100870617
340 Ga0068865_100048744
341 Ga0068865_100157168
342 Ga0068865_100176270
343 Ga0068865_100290450
344 Ga0097620_100319774
345 Ga0097620_100934587
346 Ga0105245_12087960
347 Ga0105243_11375883
348 Ga0105242_12206642
349 Ga0105248_10212124
350 Ga0105237_10453561
351 Ga0105249_11264575
352 Ga0157375_10014699
353 Ga0157375_10274313
354 Ga0157375_10485727
355 Ga0157375_10757750
356 Ga0157375_12241775
357 Ga0163163_10028372
358 Ga0163163_10237505
359 Ga0157380_10009330
360 Ga0157380_10047536
361 Ga0157380_10208802
362 Ga0157380_10869073
363 Ga0157380_12378414
364 Ga0157376_10108418
365 Ga0163161_10248632
366 Ga0163161_10830753
367 Ga0163161_11043264
368 Ga0207656_10129517
369 Ga0207682_10005809
370 Ga0207682_10015999
371 Ga0207682_10125630
372 Ga0207692_10862499
373 Ga0207642_10668263
374 Ga0207645_10275823
375 Ga0207645_10286763
376 Ga0207643_10097268
377 Ga0207662_10169764
378 Ga0207649_10095850
379 Ga0207649_11454141
380 Ga0207681_10061306
381 Ga0207650_10096938
382 Ga0207650_10267965
383 Ga0207659_10183611
384 Ga0207659_10317499
385 Ga0207706_10138296
386 Ga0207709_10169197
387 Ga0207670_10057471
388 Ga0207669_10147548
389 Ga0207704_10070443
390 Ga0207704_11132108
391 Ga0207691_10046527
392 Ga0207691_10099012
393 Ga0207691_10264305
394 Ga0207689_10060270
395 Ga0207689_10149034
396 Ga0207689_10218583
397 Ga0207679_10859089
398 Ga0207679_11436014
399 Ga0207651_10069440
400 Ga0207651_10254176
401 Ga0207640_11438734
402 Ga0207678_10092042
403 Ga0207678_10528679
404 Ga0207708_10029257
405 Ga0207708_10031928
406 Ga0207641_10077038
407 Ga0207641_10125519
408 Ga0207648_10053940
409 Ga0207648_10120193
410 Ga0207648_10598445
411 Ga0207648_10788156
412 Ga0207676_10228373
413 Ga0207676_10785041
414 Ga0207674_10605742
415 Ga0207675_100004813
416 Ga0207675_100006984
417 Ga0207675_100354608
418 Ga0207675_100394327
419 Ga0207683_10051891
420 Ga0268266_10021112
421 Ga0268265_10123021
422 Ga0268265_10409474
423 Ga0268265_10618641
424 Ga0268265_10792674
425 Ga0268264_10360529
426 Ga0268264_10565864
427 Ga0268264_11252429
428 Ga0268264_12172061
429 Ga0307511_10123584
430 Ga0307513_10034843
431 Ga0307513_10065737
432 Ga0307513_10200245
433 Ga0307408_100422035
434 Ga0307405_10063623
435 Ga0307413_10233544
436 Ga0307413_11556640
437 Ga0307410_10031978
438 Ga0307406_10118408
439 Ga0307406_10371339
440 Ga0307409_100029921
441 Ga0307416_101130481
442 Ga0307416_101776000
443 Ga0307411_11150989
444 Ga0451802_1413033
445 Ga0451807_0624715
446 Ga0495639_0429023
447 Ga0495585_0397195
448 Ga0495656_0103170
449 Ga0495668_0068564
450 Ga0495668_0716598
451 Ga0495625_0064425
452 Ga0495649_0005302
453 Ga0495672_0531525
454 Ga0496104_0131242
455 Ga0496114_0066830
456 Ga0495678_136573
457 Ga0501040_0174024
458 Ga0501042_0153943
459 Ga0501043_0587514
460 Ga0501071_0935854
461 nmdc:mga08y16_76773_c1
462 Ga0495655_0321798
463 Ga0500644_0029998
464 Ga0500611_158907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map