F344579

General Info

Members Datasets Scaffolds Average Seq Length
231 159 462 310

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904765812|2904768272
Length 307
Sequence VLRTADAWWVETPAGASRIDTSATTTAELLADRAAVDAARTGTDVVAVETLSLLSPVTAPCRVVANMTNFVSHVKDSGMNPDTVPLTFFRKTSGSISGPTDDIVKPTHVKLLDYEIEIGLVFGKTLTVGTKVDATNVAEYVAGLVITNDVSARDVQLPKTQFYEGKSYPTFTPVGPRLLLLEAGEFDRFGELTLTLRVNGTVRQDSTVADMIYRPVESLKALSNFQRLDAGDLLLTGTPGGTALKAPAKPIEMIGSLIPPALKWKVFFKKQAKNPDFLQDGDVLELTCSTPDGSLDLGVQRTRVSYR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
153 2547132424 Nocardia nova SH22a Isolate Unclassified
154 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
155 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
156 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
157 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
158 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
159 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 0
Rhizoplane 20.35
Rhizosphere 64.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100175260 3300005329 Bacteria 2036
2 Ga0070683_100289200 3300005329 Bacteria 1559
3 Ga0068869_100016183 3300005334 Bacteria 5022
4 Ga0070666_10042370 3300005335 Bacteria 3046
5 Ga0070682_100015325 3300005337 Bacteria 4440
6 Ga0070682_100066959 3300005337 Bacteria 2286
7 Ga0068868_100005194 3300005338 Bacteria 9142
8 Ga0070660_100108294 3300005339 Bacteria 2208
9 Ga0070668_100089771 3300005347 Bacteria 2421
10 Ga0070673_100115046 3300005364 Bacteria 2236
11 Ga0070659_100080913 3300005366 Bacteria 2594
12 Ga0070667_100019404 3300005367 Bacteria 5641
13 Ga0070667_100576202 3300005367 Bacteria 1036
14 Ga0070714_100067540 3300005435 Bacteria 3083
15 Ga0070700_100263509 3300005441 Bacteria 1242
16 Ga0070663_100199318 3300005455 Bacteria 1561
17 Ga0070662_100217094 3300005457 Bacteria 1524
18 Ga0070685_10014461 3300005466 Bacteria 4181
19 Ga0070685_10068442 3300005466 Bacteria 2097
20 Ga0070698_100087901 3300005471 Bacteria 3093
21 Ga0070684_100140280 3300005535 Bacteria 2185
22 Ga0070684_100186989 3300005535 Bacteria 1884
23 Ga0070665_100058887 3300005548 Bacteria 3850
24 Ga0070665_100127384 3300005548 Bacteria 2548
25 Ga0068857_100247320 3300005577 Bacteria 1634
26 Ga0068857_100398400 3300005577 Bacteria 1281
27 Ga0068854_100194341 3300005578 Bacteria 1591
28 Ga0068856_100179947 3300005614 Bacteria 2127
29 Ga0068864_100252939 3300005618 Bacteria 1636
30 Ga0068851_10034637 3300005834 Bacteria 2521
31 Ga0068862_100018185 3300005844 Bacteria 5851
32 Ga0075368_10000201 3300006042 Bacteria 16556
33 Ga0075364_10003311 3300006051 Bacteria 9138
34 Ga0075364_10028605 3300006051 Bacteria 3569
35 Ga0075367_10000322 3300006178 Bacteria 16929
36 Ga0075367_10102475 3300006178 Bacteria 1751
37 Ga0075369_10002364 3300006186 Bacteria 6725
38 Ga0075370_10011158 3300006353 Bacteria 4715
39 Ga0075428_100139153 3300006844 Bacteria 2639
40 Ga0111539_10011042 3300009094 Bacteria 11362
41 Ga0105245_10009409 3300009098 Bacteria 8523
42 Ga0105245_10036268 3300009098 Bacteria 4379
43 Ga0105245_10036500 3300009098 Bacteria 4366
44 Ga0105242_10039581 3300009176 Bacteria 3795
45 Ga0105248_10107803 3300009177 Bacteria 3141
46 Ga0105237_10092494 3300009545 Bacteria 3014
47 Ga0105238_10216369 3300009551 Bacteria 1892
48 Ga0105238_10294724 3300009551 Bacteria 1605
49 Ga0105249_10015997 3300009553 Bacteria 6650
50 Ga0105249_10127353 3300009553 Bacteria 2426
51 Ga0105239_10085581 3300010375 Bacteria 3475
52 Ga0105239_10171827 3300010375 Bacteria 2424
53 Ga0105239_10744727 3300010375 Bacteria 1121
54 Ga0105246_10066907 3300011119 Bacteria 2517
55 Ga0105246_10197632 3300011119 Bacteria 1561
56 Ga0105246_10276474 3300011119 Bacteria 1345
57 Ga0105246_10470166 3300011119 Bacteria 1061
58 Ga0157369_10409498 3300013105 Bacteria 1406
59 Ga0157374_10538706 3300013296 Bacteria 1174
60 Ga0157372_10120888 3300013307 Bacteria 3008
61 Ga0163163_10057661 3300014325 Bacteria 3840
62 Ga0157380_10104033 3300014326 Bacteria 2370
63 Ga0157377_10015419 3300014745 Bacteria 3910
64 Ga0213873_10000387 3300021358 Bacteria 7229
65 Ga0213876_10008271 3300021384 Bacteria 5629
66 Ga0213875_10003895 3300021388 Bacteria 8348
67 Ga0207656_10067933 3300025321 Bacteria 1578
68 Ga0207688_10000919 3300025901 Bacteria 14868
69 Ga0207688_10074363 3300025901 Bacteria 1932
70 Ga0207680_10024754 3300025903 Bacteria 3300
71 Ga0207680_10103079 3300025903 Bacteria 1837
72 Ga0207643_10024852 3300025908 Bacteria 3307
73 Ga0207654_10104576 3300025911 Bacteria 1750
74 Ga0207657_10145228 3300025919 Bacteria 1936
75 Ga0207681_10339929 3300025923 Bacteria 1199
76 Ga0207650_10353357 3300025925 Bacteria 1209
77 Ga0207659_10131627 3300025926 Bacteria 1932
78 Ga0207687_10023272 3300025927 Bacteria 4128
79 Ga0207687_10028039 3300025927 Bacteria 3781
80 Ga0207664_10157096 3300025929 Bacteria 1937
81 Ga0207690_10121911 3300025932 Bacteria 1895
82 Ga0207669_10103215 3300025937 Bacteria 1891
83 Ga0207689_10014714 3300025942 Bacteria 6644
84 Ga0207689_10032044 3300025942 Bacteria 4372
85 Ga0207661_10115135 3300025944 Bacteria 2281
86 Ga0207661_10166051 3300025944 Bacteria 1918
87 Ga0207661_10170425 3300025944 Bacteria 1895
88 Ga0207661_10237203 3300025944 Bacteria 1617
89 Ga0207679_10136887 3300025945 Bacteria 1973
90 Ga0207712_10021521 3300025961 Bacteria 4234
91 Ga0207668_10172115 3300025972 Bacteria 1699
92 Ga0207658_10028577 3300025986 Bacteria 3928
93 Ga0207677_10107831 3300026023 Bacteria 2066
94 Ga0207677_10220380 3300026023 Bacteria 1521
95 Ga0207703_10146596 3300026035 Bacteria 2053
96 Ga0207703_10466170 3300026035 Bacteria 1182
97 Ga0207678_10002039 3300026067 Bacteria 18322
98 Ga0207678_10009940 3300026067 Bacteria 8346
99 Ga0207678_10112193 3300026067 Bacteria 2326
100 Ga0207708_10090929 3300026075 Bacteria 2353
101 Ga0207702_10075808 3300026078 Bacteria 2906
102 Ga0207676_10264146 3300026095 Bacteria 1556
103 Ga0207676_10528447 3300026095 Bacteria 1124
104 Ga0207674_10125099 3300026116 Bacteria 2537
105 Ga0207674_10387641 3300026116 Bacteria 1351
106 Ga0207683_10031814 3300026121 Bacteria 4581
107 Ga0207683_10076898 3300026121 Bacteria 2955
108 Ga0207698_10184048 3300026142 Bacteria 1854
109 Ga0209813_10003178 3300027866 Bacteria 3825
110 Ga0268266_10022031 3300028379 Bacteria 5431
111 Ga0268265_10221487 3300028380 Bacteria 1656
112 Ga0268264_10000269 3300028381 Bacteria 91321
113 Ga0265327_10000069 3300031251 Bacteria 217784
114 Ga0395898_0272245 3300037466 Bacteria 1615
115 Ga0436364_0713171 3300037853 Bacteria 13972
116 Ga0436365_0324658 3300039437 Bacteria 1468
117 Ga0436365_1319819 3300039437 Bacteria 4190
118 Ga0436365_1362981 3300039437 Bacteria 11994
119 Ga0436363_1519705 3300039450 Bacteria 5001
120 Ga0436362_1078074 3300039453 Bacteria 5835
121 Ga0439466_0030739 3300041411 Bacteria 1839
122 Ga0439445_0039535 3300042004 Bacteria 1250
123 Ga0466969_0105567 3300044656 Bacteria 1322
124 Ga0466966_0014794 3300044684 Bacteria 5162
125 Ga0466961_0052400 3300044693 Bacteria 2604
126 Ga0466971_0030034 3300044719 Bacteria 2431
127 Ga0495653_0237718 3300046463 Bacteria 1216
128 Ga0495600_0049709 3300046809 Bacteria 2736
129 Ga0495672_0031477 3300047320 Bacteria 3312
130 Ga0496100_0000009 3300048903 Bacteria 225785
131 Ga0496101_0000018 3300048904 Bacteria 236102
132 Ga0496101_0178253 3300048904 Bacteria 1636
133 Ga0496101_0315330 3300048904 Bacteria 1226
134 Ga0496101_0404752 3300048904 Bacteria 1075
135 Ga0496101_0452552 3300048904 Bacteria 1013
136 Ga0496102_0073835 3300048905 Bacteria 3134
137 Ga0496102_0184712 3300048905 Bacteria 1965
138 Ga0496102_0293899 3300048905 Bacteria 1531
139 Ga0496102_0502422 3300048905 Bacteria 1135
140 Ga0496104_0088383 3300048907 Bacteria 2960
141 Ga0496104_0155189 3300048907 Bacteria 2197
142 Ga0496104_0192035 3300048907 Bacteria 1954
143 Ga0496105_0006083 3300048908 Bacteria 9238
144 Ga0496105_0064346 3300048908 Bacteria 3026
145 Ga0496105_0173270 3300048908 Bacteria 1768
146 Ga0496106_0001031 3300048909 Bacteria 20511
147 Ga0496106_0193976 3300048909 Bacteria 1615
148 Ga0496107_0003353 3300048910 Bacteria 10701
149 Ga0496108_0007259 3300048911 Bacteria 8986
150 Ga0496108_0016334 3300048911 Bacteria 6055
151 Ga0496108_0093738 3300048911 Bacteria 2555
152 Ga0496108_0146432 3300048911 Bacteria 2036
153 Ga0496108_0216128 3300048911 Bacteria 1665
154 Ga0496109_0000434 3300048912 Bacteria 36428
155 Ga0496109_0003655 3300048912 Bacteria 12851
156 Ga0496109_0036495 3300048912 Bacteria 4437
157 Ga0496109_0037051 3300048912 Bacteria 4406
158 Ga0496109_0057415 3300048912 Bacteria 3553
159 Ga0496109_0124530 3300048912 Bacteria 2402
160 Ga0496110_0000204 3300048913 Bacteria 37863
161 Ga0496110_0008859 3300048913 Bacteria 8109
162 Ga0496110_0031974 3300048913 Bacteria 4541
163 Ga0496110_0172944 3300048913 Bacteria 1960
164 Ga0496111_0008081 3300048914 Bacteria 6948
165 Ga0496111_0193410 3300048914 Bacteria 1512
166 Ga0496112_0333960 3300048915 Bacteria 1459
167 Ga0496113_0046694 3300048916 Bacteria 3216
168 Ga0496113_0112396 3300048916 Bacteria 2122
169 Ga0496113_0202981 3300048916 Bacteria 1576
170 Ga0496113_0221653 3300048916 Bacteria 1507
171 Ga0496114_0002431 3300048917 Bacteria 14203
172 Ga0496114_0004536 3300048917 Bacteria 10780
173 Ga0496114_0117540 3300048917 Bacteria 2284
174 Ga0496114_0249780 3300048917 Bacteria 1561
175 Ga0496114_0486855 3300048917 Bacteria 1091
176 Ga0496115_0038823 3300048918 Bacteria 3780
177 Ga0496116_0049277 3300048919 Bacteria 2818
178 Ga0496121_0000023 3300048924 Bacteria 463448
179 Ga0496122_0000038 3300048925 Bacteria 295624
180 Ga0496123_0002987 3300048926 Bacteria 19631
181 Ga0496124_0000014 3300048927 Bacteria 463448
182 Ga0496125_0000020 3300048928 Bacteria 463448
183 Ga0496126_0000023 3300048929 Bacteria 463448
184 Ga0501032_0120882 3300049569 Bacteria 1731
185 Ga0501033_0080097 3300049570 Bacteria 2396
186 Ga0501037_0029317 3300049573 Bacteria 4066
187 Ga0501038_0060706 3300049574 Bacteria 3235
188 Ga0501039_0038625 3300049575 Bacteria 3686
189 Ga0501040_0025403 3300049576 Bacteria 3982
190 Ga0501041_0019546 3300049577 Bacteria 4045
191 Ga0501041_0178149 3300049577 Bacteria 1331
192 Ga0501042_0066902 3300049578 Bacteria 2568
193 Ga0501048_0019657 3300049582 Bacteria 4954
194 Ga0501068_0008023 3300049584 Bacteria 5857
195 Ga0501070_0180212 3300049586 Bacteria 1739
196 Ga0501071_0012137 3300049587 Bacteria 5829
197 Ga0501072_0010046 3300049588 Bacteria 7202
198 Ga0501073_0148934 3300049589 Bacteria 1622
199 Ga0501075_0014383 3300049591 Bacteria 5669
200 Ga0501077_0041407 3300049593 Bacteria 2932
201 Ga0501079_0053113 3300049741 Bacteria 3126
202 Ga0501083_0088832 3300049744 Bacteria 2043
203 Ga0501035_0290701 3300049822 Bacteria 1379
204 Ga0501044_0236050 3300049823 Bacteria 1774
205 Ga0501045_0019314 3300049824 Bacteria 4857
206 Ga0501045_0071768 3300049824 Bacteria 2548
207 nmdc:mga03n38_5227_c1 3300050490 Bacteria 4398
208 nmdc:mga03n38_68891_c1 3300050490 Bacteria 1632
209 nmdc:mga00v17_24276_c1 3300050491 Bacteria 3514
210 nmdc:mga00v17_38764_c1 3300050491 Bacteria 2851
211 nmdc:mga00v17_4738_c1 3300050491 Bacteria 7113
212 nmdc:mga00v17_70579_c1 3300050491 Bacteria 2164
213 nmdc:mga0yw44_121525_c1 3300050492 Bacteria 1682
214 nmdc:mga06z11_49027_c1 3300050494 Bacteria 2152
215 nmdc:mga04h51_2103_c1 3300050495 Bacteria 4674
216 nmdc:mga08y16_15531_c1 3300050511 Bacteria 8007
217 nmdc:mga0sz30_1548_c1 3300050516 Bacteria 8195
218 Ga0495655_0020691 3300053083 Bacteria 1480
219 Ga0495619_0027749 3300053085 Bacteria 3650
220 Ga0501084_0305578 3300054114 Bacteria 1343
221 Ga0501082_0098199 3300060353 Bacteria 2532
222 Ga0466962_0071991 3300061719 Bacteria 1651
223 Ga0530510_0063197 3300061734 Bacteria 2680
224 2904768272 2904765812 Bacteria 5369154
225 2548695954 2547132424 Bacteria 8348532
226 2904775406 2904770941 Bacteria 5580202
227 2908815581 2908811453 Bacteria 5478616
228 2919421596 2919420072 Bacteria 5390363
229 2919434846 2919432681 Bacteria 5390474
230 2939582906 2939582691 Bacteria 7088898
231 2996225400 2996221748 Bacteria 6799777
232 Ga0070683_100175260
233 Ga0070683_100289200
234 Ga0068869_100016183
235 Ga0070666_10042370
236 Ga0070682_100015325
237 Ga0070682_100066959
238 Ga0068868_100005194
239 Ga0070660_100108294
240 Ga0070668_100089771
241 Ga0070673_100115046
242 Ga0070659_100080913
243 Ga0070667_100019404
244 Ga0070667_100576202
245 Ga0070714_100067540
246 Ga0070700_100263509
247 Ga0070663_100199318
248 Ga0070662_100217094
249 Ga0070685_10014461
250 Ga0070685_10068442
251 Ga0070698_100087901
252 Ga0070684_100140280
253 Ga0070684_100186989
254 Ga0070665_100058887
255 Ga0070665_100127384
256 Ga0068857_100247320
257 Ga0068857_100398400
258 Ga0068854_100194341
259 Ga0068856_100179947
260 Ga0068864_100252939
261 Ga0068851_10034637
262 Ga0068862_100018185
263 Ga0075368_10000201
264 Ga0075364_10003311
265 Ga0075364_10028605
266 Ga0075367_10000322
267 Ga0075367_10102475
268 Ga0075369_10002364
269 Ga0075370_10011158
270 Ga0075428_100139153
271 Ga0111539_10011042
272 Ga0105245_10009409
273 Ga0105245_10036268
274 Ga0105245_10036500
275 Ga0105242_10039581
276 Ga0105248_10107803
277 Ga0105237_10092494
278 Ga0105238_10216369
279 Ga0105238_10294724
280 Ga0105249_10015997
281 Ga0105249_10127353
282 Ga0105239_10085581
283 Ga0105239_10171827
284 Ga0105239_10744727
285 Ga0105246_10066907
286 Ga0105246_10197632
287 Ga0105246_10276474
288 Ga0105246_10470166
289 Ga0157369_10409498
290 Ga0157374_10538706
291 Ga0157372_10120888
292 Ga0163163_10057661
293 Ga0157380_10104033
294 Ga0157377_10015419
295 Ga0213873_10000387
296 Ga0213876_10008271
297 Ga0213875_10003895
298 Ga0207656_10067933
299 Ga0207688_10000919
300 Ga0207688_10074363
301 Ga0207680_10024754
302 Ga0207680_10103079
303 Ga0207643_10024852
304 Ga0207654_10104576
305 Ga0207657_10145228
306 Ga0207681_10339929
307 Ga0207650_10353357
308 Ga0207659_10131627
309 Ga0207687_10023272
310 Ga0207687_10028039
311 Ga0207664_10157096
312 Ga0207690_10121911
313 Ga0207669_10103215
314 Ga0207689_10014714
315 Ga0207689_10032044
316 Ga0207661_10115135
317 Ga0207661_10166051
318 Ga0207661_10170425
319 Ga0207661_10237203
320 Ga0207679_10136887
321 Ga0207712_10021521
322 Ga0207668_10172115
323 Ga0207658_10028577
324 Ga0207677_10107831
325 Ga0207677_10220380
326 Ga0207703_10146596
327 Ga0207703_10466170
328 Ga0207678_10002039
329 Ga0207678_10009940
330 Ga0207678_10112193
331 Ga0207708_10090929
332 Ga0207702_10075808
333 Ga0207676_10264146
334 Ga0207676_10528447
335 Ga0207674_10125099
336 Ga0207674_10387641
337 Ga0207683_10031814
338 Ga0207683_10076898
339 Ga0207698_10184048
340 Ga0209813_10003178
341 Ga0268266_10022031
342 Ga0268265_10221487
343 Ga0268264_10000269
344 Ga0265327_10000069
345 Ga0395898_0272245
346 Ga0436364_0713171
347 Ga0436365_0324658
348 Ga0436365_1319819
349 Ga0436365_1362981
350 Ga0436363_1519705
351 Ga0436362_1078074
352 Ga0439466_0030739
353 Ga0439445_0039535
354 Ga0466969_0105567
355 Ga0466966_0014794
356 Ga0466961_0052400
357 Ga0466971_0030034
358 Ga0495653_0237718
359 Ga0495600_0049709
360 Ga0495672_0031477
361 Ga0496100_0000009
362 Ga0496101_0000018
363 Ga0496101_0178253
364 Ga0496101_0315330
365 Ga0496101_0404752
366 Ga0496101_0452552
367 Ga0496102_0073835
368 Ga0496102_0184712
369 Ga0496102_0293899
370 Ga0496102_0502422
371 Ga0496104_0088383
372 Ga0496104_0155189
373 Ga0496104_0192035
374 Ga0496105_0006083
375 Ga0496105_0064346
376 Ga0496105_0173270
377 Ga0496106_0001031
378 Ga0496106_0193976
379 Ga0496107_0003353
380 Ga0496108_0007259
381 Ga0496108_0016334
382 Ga0496108_0093738
383 Ga0496108_0146432
384 Ga0496108_0216128
385 Ga0496109_0000434
386 Ga0496109_0003655
387 Ga0496109_0036495
388 Ga0496109_0037051
389 Ga0496109_0057415
390 Ga0496109_0124530
391 Ga0496110_0000204
392 Ga0496110_0008859
393 Ga0496110_0031974
394 Ga0496110_0172944
395 Ga0496111_0008081
396 Ga0496111_0193410
397 Ga0496112_0333960
398 Ga0496113_0046694
399 Ga0496113_0112396
400 Ga0496113_0202981
401 Ga0496113_0221653
402 Ga0496114_0002431
403 Ga0496114_0004536
404 Ga0496114_0117540
405 Ga0496114_0249780
406 Ga0496114_0486855
407 Ga0496115_0038823
408 Ga0496116_0049277
409 Ga0496121_0000023
410 Ga0496122_0000038
411 Ga0496123_0002987
412 Ga0496124_0000014
413 Ga0496125_0000020
414 Ga0496126_0000023
415 Ga0501032_0120882
416 Ga0501033_0080097
417 Ga0501037_0029317
418 Ga0501038_0060706
419 Ga0501039_0038625
420 Ga0501040_0025403
421 Ga0501041_0019546
422 Ga0501041_0178149
423 Ga0501042_0066902
424 Ga0501048_0019657
425 Ga0501068_0008023
426 Ga0501070_0180212
427 Ga0501071_0012137
428 Ga0501072_0010046
429 Ga0501073_0148934
430 Ga0501075_0014383
431 Ga0501077_0041407
432 Ga0501079_0053113
433 Ga0501083_0088832
434 Ga0501035_0290701
435 Ga0501044_0236050
436 Ga0501045_0019314
437 Ga0501045_0071768
438 nmdc:mga03n38_5227_c1
439 nmdc:mga03n38_68891_c1
440 nmdc:mga00v17_24276_c1
441 nmdc:mga00v17_38764_c1
442 nmdc:mga00v17_4738_c1
443 nmdc:mga00v17_70579_c1
444 nmdc:mga0yw44_121525_c1
445 nmdc:mga06z11_49027_c1
446 nmdc:mga04h51_2103_c1
447 nmdc:mga08y16_15531_c1
448 nmdc:mga0sz30_1548_c1
449 Ga0495655_0020691
450 Ga0495619_0027749
451 Ga0501084_0305578
452 Ga0501082_0098199
453 Ga0466962_0071991
454 Ga0530510_0063197
455 2904768272
456 2548695954
457 2904775406
458 2908815581
459 2919421596
460 2919434846
461 2939582906
462 2996225400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

62

305

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7o-assembly4.cif.gz_D crystal structure of hpce 0.8782 64 311
3v77-assembly1.cif.gz_A crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica 0.8704 67 309
3r6o-assembly1.cif.gz_A-2 crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7-dioateisomerase from mycobacterium abscessus 0.8673 1 312
2dfu-assembly2.cif.gz_C crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8 0.8639 1 311
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.8629 63 312
ID Description Score Start End Superfamily
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9022 92 312 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9019 67 311 3.90.850.10
1gttA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8939 64 311 3.90.850.10
3r6oA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8891 67 312 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8808 45 310 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A0H2ZZT7-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9742 1 312 GO:0016853
GO:0044281
AF-A0A0H2ZZT7-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9712 1 312 GO:0016853
GO:0044281
AF-A0A1N0QX00-F1-model_v4 deleted 0.9649 50 295
AF-A0A7G1IG53-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.962 185 310 GO:0003824
GO:0046872
AF-A0A0B5ILB5-F1-model_v4 Fumarylacetoacetase 0.961 1 312 GO:0003824
GO:0044281

Map