F344571

General Info

Members Datasets Scaffolds Average Seq Length
231 175 462 172

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2875391855|2875392622
Length 199
Sequence TPPPIRPRRSRVRRFLPLALAAWLVLEIWLLTVVASATNGLTVLLLLVAGAVLGTVVIKRAGRRAFKNLTETLQQMPGQPGATEAPQVAGGKGSRGNGLLMLGGLLLLIPGLISDAAGLLLLVPPVRTLISRRAEQSLERRMRAASPGSFSDAFQQARIHRPDGKVVQGEVIREDGTRPPSGPSGPDDDPRGPRPPLTP

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
5 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
6 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
7 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
8 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
9 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
10 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
11 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
12 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
13 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
14 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
15 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
18 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
19 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
20 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
24 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
25 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
26 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
27 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
28 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
29 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
32 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
33 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
34 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
38 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
39 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
40 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
41 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
42 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
43 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
44 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
45 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
46 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
47 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
48 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
49 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
52 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
53 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
56 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
57 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
58 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
59 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
64 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
65 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
101 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
105 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
106 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
116 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
119 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
120 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
121 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
122 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
123 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
124 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
125 2643221548 Streptomyces sp. Root55 Isolate Unclassified
126 2643221578 Streptomyces sp. Root63 Isolate Unclassified
127 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
128 2643221647 Streptomyces sp. Root369 Isolate Unclassified
129 2643221670 Streptomyces sp. Root431 Isolate Unclassified
130 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
131 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
132 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
133 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
134 2643221714 Streptomyces sp. Root264 Isolate Unclassified
135 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
136 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
137 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
138 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
139 2808606448 Streptomyces sp. 193411 Isolate Unclassified
140 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
141 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
142 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
143 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
144 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
145 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
146 2862574272 Streptomyces sp. AcE210 Isolate Nodule
147 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
148 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
149 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
150 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
151 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
152 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
153 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
154 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
155 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
156 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
157 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
158 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
159 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
160 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
161 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
162 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
163 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
164 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
165 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
166 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
167 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
168 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
169 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
170 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
171 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
172 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
173 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
174 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
175 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.59
Metatranscriptomes 1.73
Isolates 24.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 1.3
Rhizoplane 0.87
Rhizosphere 74.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10089928 3300003322 Bacteria 2261
2 rootH1_10052710 3300003323 Bacteria 2180
3 rootH1_10057752 3300003323 Bacteria 3843
4 Ga0006562J51391_1102868 3300003578 Bacteria 2040
5 Ga0006562J51391_1102869 3300003578 Bacteria 1567
6 Ga0075363_100026941 3300006048 Bacteria 2944
7 Ga0099826_10061147 3300006948 Bacteria 2449
8 Ga0105251_10027501 3300009011 Bacteria 2883
9 Ga0105250_10041197 3300009092 Bacteria 1852
10 Ga0183367_1017 3300015688 Bacteria 126691
11 Ga0209758_1003531 3300025297 Bacteria 14099
12 Ga0207426_1013430 3300025302 Bacteria 3035
13 Ga0209282_1048740 3300027666 Bacteria 2449
14 Ga0307517_10008471 3300028786 Bacteria 14757
15 Ga0307515_10009395 3300028794 Bacteria 18921
16 Ga0307515_10140063 3300028794 Bacteria 2601
17 Ga0307511_10037677 3300030521 Bacteria 4170
18 Ga0307511_10046036 3300030521 Bacteria 3595
19 Ga0307512_10021907 3300030522 Bacteria 5753
20 Ga0307513_10052390 3300031456 Bacteria 4395
21 Ga0307509_10039620 3300031507 Bacteria 5131
22 Ga0307509_10280386 3300031507 Bacteria 1428
23 Ga0307508_10185360 3300031616 Bacteria 1683
24 Ga0307508_10220519 3300031616 Bacteria 1496
25 Ga0307514_10015345 3300031649 Bacteria 6324
26 Ga0307514_10119000 3300031649 Bacteria 1848
27 Ga0307514_10194065 3300031649 Bacteria 1288
28 Ga0307518_10393633 3300031838 Bacteria 777
29 Ga0307507_10061944 3300033179 Bacteria 3479
30 Ga0307510_10187583 3300033180 Bacteria 1620
31 Ga0395898_0205875 3300037466 Bacteria 1877
32 Ga0439436_0000997 3300041404 Bacteria 7881
33 Ga0439439_0013511 3300041406 Bacteria 1979
34 Ga0451845_0871650 3300041501 Bacteria 1059
35 Ga0451853_1602256 3300041512 Bacteria 1968
36 Ga0439433_0005340 3300041999 Bacteria 2758
37 Ga0439442_019392 3300042002 Bacteria 1407
38 Ga0439449_0176041 3300042007 Bacteria 799
39 Ga0439457_022210 3300042014 Bacteria 1404
40 Ga0450903_000014 3300042138 Bacteria 34118
41 Ga0439458_0003690 3300042157 Bacteria 3553
42 Ga0439458_0005624 3300042157 Bacteria 2813
43 Ga0466972_0002210 3300044658 Bacteria 9550
44 Ga0466965_0167773 3300044683 Bacteria 1153
45 Ga0466966_0005225 3300044684 Bacteria 8534
46 Ga0466961_0056479 3300044693 Bacteria 2501
47 Ga0466961_0412515 3300044693 Bacteria 819
48 Ga0466960_0015448 3300044901 Bacteria 3291
49 Ga0495627_131048 3300046453 Bacteria 705
50 Ga0495592_0015885 3300046454 Bacteria 5711
51 Ga0495592_0019855 3300046454 Bacteria 5109
52 Ga0495603_0003385 3300046455 Bacteria 9496
53 Ga0495603_0042449 3300046455 Bacteria 2718
54 Ga0495603_0305920 3300046455 Bacteria 913
55 Ga0495590_0010403 3300046457 Bacteria 3500
56 Ga0495629_0012169 3300046459 Bacteria 6234
57 Ga0495629_0020802 3300046459 Bacteria 4684
58 Ga0495629_0081444 3300046459 Bacteria 2259
59 Ga0495629_0212292 3300046459 Bacteria 1336
60 Ga0495629_0287001 3300046459 Bacteria 1128
61 Ga0495638_0426422 3300046460 Bacteria 682
62 Ga0495651_0008570 3300046462 Bacteria 7836
63 Ga0495651_0067958 3300046462 Bacteria 2717
64 Ga0495605_0004741 3300046474 Bacteria 7952
65 Ga0495662_0017790 3300046476 Bacteria 3441
66 Ga0495662_0116448 3300046476 Bacteria 1310
67 Ga0495664_0000301 3300046477 Bacteria 23691
68 Ga0495664_0095320 3300046477 Bacteria 1791
69 Ga0495584_0245138 3300046491 Bacteria 911
70 Ga0495585_0189608 3300046492 Bacteria 1052
71 Ga0495585_0320341 3300046492 Bacteria 758
72 Ga0495583_0065909 3300046506 Bacteria 1603
73 Ga0495583_0132402 3300046506 Bacteria 1042
74 Ga0495606_0006736 3300046507 Bacteria 10515
75 Ga0495620_0045530 3300046515 Bacteria 1898
76 Ga0495620_0110039 3300046515 Bacteria 1092
77 Ga0495628_0173594 3300046516 Bacteria 1633
78 Ga0495630_0021260 3300046517 Bacteria 4791
79 Ga0495631_0004943 3300046518 Bacteria 7024
80 Ga0495643_0001437 3300046522 Bacteria 21986
81 Ga0495644_0221410 3300046523 Bacteria 732
82 Ga0495648_0098666 3300046524 Bacteria 1617
83 Ga0495648_0139371 3300046524 Bacteria 1278
84 Ga0495666_0033774 3300046526 Bacteria 2497
85 Ga0495666_0238536 3300046526 Bacteria 830
86 Ga0495652_0010908 3300046529 Bacteria 8232
87 Ga0495654_0117599 3300046530 Bacteria 1206
88 Ga0495587_0001666 3300046536 Bacteria 14832
89 Ga0495609_0028621 3300046538 Bacteria 2542
90 Ga0495597_0020739 3300046542 Bacteria 3058
91 Ga0495645_0011510 3300046543 Bacteria 6227
92 Ga0495622_0002415 3300046557 Bacteria 9079
93 Ga0495633_0009359 3300046558 Bacteria 5418
94 Ga0495667_0072804 3300046559 Bacteria 2239
95 Ga0495667_0424719 3300046559 Bacteria 836
96 Ga0495668_0018178 3300046616 Bacteria 4065
97 Ga0495634_0004945 3300046642 Bacteria 10302
98 Ga0495611_0014917 3300046648 Bacteria 3319
99 Ga0495625_0043187 3300046660 Bacteria 3271
100 Ga0495625_0053501 3300046660 Bacteria 2886
101 Ga0495625_0113264 3300046660 Bacteria 1852
102 Ga0495635_0000756 3300046663 Bacteria 20996
103 Ga0495635_0102177 3300046663 Bacteria 1959
104 Ga0495661_0019156 3300046665 Bacteria 4490
105 Ga0495588_0038889 3300046674 Bacteria 2421
106 Ga0495588_0040943 3300046674 Bacteria 2365
107 Ga0495588_0180129 3300046674 Bacteria 1117
108 Ga0495657_0001171 3300046675 Bacteria 22959
109 Ga0495657_0003160 3300046675 Bacteria 13581
110 Ga0495657_0128875 3300046675 Bacteria 1586
111 Ga0495657_0281773 3300046675 Bacteria 994
112 Ga0495646_0003059 3300046680 Bacteria 10365
113 Ga0495646_0184393 3300046680 Bacteria 1143
114 Ga0495613_0004281 3300046689 Bacteria 10691
115 Ga0495613_0115601 3300046689 Bacteria 1930
116 Ga0495613_0373210 3300046689 Bacteria 976
117 Ga0495671_0022010 3300046692 Bacteria 3343
118 Ga0495671_0043714 3300046692 Bacteria 2249
119 Ga0495649_0015923 3300046694 Bacteria 4270
120 Ga0495589_0043687 3300046794 Bacteria 2229
121 Ga0495600_0413149 3300046809 Bacteria 838
122 Ga0495660_0185090 3300046810 Bacteria 1004
123 Ga0495581_0053986 3300047315 Bacteria 2320
124 Ga0495604_0025528 3300047317 Bacteria 4708
125 Ga0495604_0111022 3300047317 Bacteria 1999
126 Ga0495636_0005508 3300047318 Bacteria 4969
127 Ga0495636_0006017 3300047318 Bacteria 4760
128 Ga0495636_0006557 3300047318 Bacteria 4574
129 Ga0495636_0166771 3300047318 Bacteria 994
130 Ga0495674_0084986 3300047319 Bacteria 2711
131 Ga0495674_0142393 3300047319 Bacteria 2015
132 Ga0495676_0006334 3300047321 Bacteria 10899
133 Ga0495676_0007217 3300047321 Bacteria 10194
134 Ga0495676_0107070 3300047321 Bacteria 2058
135 Ga0495680_0027717 3300047322 Bacteria 4649
136 Ga0495683_0195320 3300047323 Bacteria 915
137 Ga0495687_008131 3300047443 Bacteria 6052
138 Ga0495687_009032 3300047443 Bacteria 5621
139 Ga0495687_067753 3300047443 Bacteria 1443
140 Ga0495687_076910 3300047443 Bacteria 1319
141 Ga0495675_0009257 3300047444 Bacteria 6127
142 Ga0495675_0267332 3300047444 Bacteria 1023
143 Ga0495677_0007067 3300047445 Bacteria 4203
144 Ga0495685_052924 3300047447 Bacteria 1374
145 Ga0495685_226979 3300047447 Bacteria 595
146 Ga0495681_0007946 3300047470 Bacteria 6699
147 Ga0495681_0064993 3300047470 Bacteria 1669
148 Ga0495684_0018676 3300047471 Bacteria 5342
149 Ga0495684_0163917 3300047471 Bacteria 1657
150 Ga0495593_0021576 3300047673 Bacteria 3594
151 Ga0495593_0168216 3300047673 Bacteria 1105
152 Ga0495602_0171140 3300048088 Bacteria 1686
153 Ga0495602_0357112 3300048088 Bacteria 1053
154 Ga0495614_0131068 3300048089 Bacteria 1109
155 Ga0495614_0200080 3300048089 Bacteria 903
156 Ga0495626_0014277 3300048091 Bacteria 4102
157 Ga0496109_0145514 3300048912 Bacteria 2217
158 Ga0496109_0635104 3300048912 Bacteria 1005
159 Ga0501309_056567 3300049129 Bacteria 625
160 Ga0495678_024644 3300049459 Bacteria 2595
161 Ga0495682_0122217 3300049460 Bacteria 932
162 Ga0501323_024009 3300049539 Bacteria 822
163 Ga0501033_0286742 3300049570 Bacteria 1161
164 Ga0501034_0038283 3300049571 Bacteria 4857
165 Ga0501036_0005689 3300049572 Bacteria 10114
166 Ga0501038_0071305 3300049574 Bacteria 2947
167 Ga0501070_0372163 3300049586 Bacteria 1158
168 nmdc:mga03n38_69967_c1 3300050490 Bacteria 1622
169 Ga0495612_0041308 3300053078 Bacteria 1881
170 Ga0495619_0111737 3300053085 Bacteria 1868
171 Ga0500640_010104 3300053095 Bacteria 3800
172 Ga0500560_003180 3300053107 Bacteria 3279
173 Ga0500573_0194049 3300053140 Bacteria 1083
174 Ga0500624_001182 3300053157 Bacteria 4741
175 2875392622 2875391855 Bacteria 7600475
176 2547406451 2547132111 Bacteria 8013147
177 2554259620 2554235005 Bacteria 6457341
178 2585300927 2582581312 Bacteria 7308206
179 2585303444 2582581313 Bacteria 10042643
180 2616906185 2616644941 Bacteria 8510691
181 2643760309 2643221548 Bacteria 8053412
182 2643904416 2643221578 Bacteria 9213798
183 2643946654 2643221587 Bacteria 7586415
184 2644267937 2643221647 Bacteria 10741251
185 2644389003 2643221670 Bacteria 6497041
186 2644406316 2643221673 Bacteria 9196637
187 2644434458 2643221677 Bacteria 7584031
188 2644443612 2643221678 Bacteria 9540101
189 2644459994 2643221682 Bacteria 6743283
190 2644632459 2643221714 Bacteria 9015452
191 2784586673 2784132148 Bacteria 8627943
192 2785367070 2784746768 Bacteria 10036182
193 2786668109 2786546132 Bacteria 10419719
194 2808847574 2808606359 Bacteria 9866990
195 2809230203 2808606448 Bacteria 8656184
196 2812360392 2811994879 Bacteria 9313447
197 2812482491 2811994917 Bacteria 7761064
198 2819699815 2818991463 Bacteria 7948711
199 2852637637 2852635781 Bacteria 8251373
200 2862289744 2862281513 Bacteria 9621493
201 2862510346 2862507626 Bacteria 9425308
202 2862583796 2862574272 Bacteria 10567477
203 2873157755 2873151551 Bacteria 8625867
204 2877683476 2877676314 Bacteria 9512378
205 2912722582 2912715099 Bacteria 9460473
206 2912726268 2912723979 Bacteria 8557534
207 2912758763 2912757875 Bacteria 7940295
208 2918502441 2918501144 Bacteria 8668083
209 2919472270 2919468124 Bacteria 9133025
210 2946052094 2946045630 Bacteria 8527308
211 2946065497 2946064051 Bacteria 8957905
212 2946073851 2946072368 Bacteria 8999607
213 2947231913 2947224130 Bacteria 9938529
214 2954011155 2954002825 Bacteria 9173742
215 2954388729 2954380949 Bacteria 10050426
216 2954674397 2954673503 Bacteria 9685905
217 2954689734 2954682443 Bacteria 9862841
218 2954699517 2954691527 Bacteria 10720516
219 2954702701 2954701450 Bacteria 10834262
220 2954718456 2954711539 Bacteria 10867210
221 2954728426 2954721474 Bacteria 10456478
222 2954733383 2954731030 Bacteria 10243860
223 2954747322 2954740390 Bacteria 10229294
224 2954752266 2954749733 Bacteria 10366972
225 2954766438 2954759201 Bacteria 9358192
226 2966604512 2966598605 Bacteria 7676064
227 3006487439 3006486233 Bacteria 8157040
228 3006495074 3006493962 Bacteria 8825450
229 8008580826 8008574985 Bacteria 7815457
230 8023625319 8023623736 Bacteria 8593882
231 8025535397 8025530807 Bacteria 8495698
232 rootL2_10089928
233 rootH1_10052710
234 rootH1_10057752
235 Ga0006562J51391_1102868
236 Ga0006562J51391_1102869
237 Ga0075363_100026941
238 Ga0099826_10061147
239 Ga0105251_10027501
240 Ga0105250_10041197
241 Ga0183367_1017
242 Ga0209758_1003531
243 Ga0207426_1013430
244 Ga0209282_1048740
245 Ga0307517_10008471
246 Ga0307515_10009395
247 Ga0307515_10140063
248 Ga0307511_10037677
249 Ga0307511_10046036
250 Ga0307512_10021907
251 Ga0307513_10052390
252 Ga0307509_10039620
253 Ga0307509_10280386
254 Ga0307508_10185360
255 Ga0307508_10220519
256 Ga0307514_10015345
257 Ga0307514_10119000
258 Ga0307514_10194065
259 Ga0307518_10393633
260 Ga0307507_10061944
261 Ga0307510_10187583
262 Ga0395898_0205875
263 Ga0439436_0000997
264 Ga0439439_0013511
265 Ga0451845_0871650
266 Ga0451853_1602256
267 Ga0439433_0005340
268 Ga0439442_019392
269 Ga0439449_0176041
270 Ga0439457_022210
271 Ga0450903_000014
272 Ga0439458_0003690
273 Ga0439458_0005624
274 Ga0466972_0002210
275 Ga0466965_0167773
276 Ga0466966_0005225
277 Ga0466961_0056479
278 Ga0466961_0412515
279 Ga0466960_0015448
280 Ga0495627_131048
281 Ga0495592_0015885
282 Ga0495592_0019855
283 Ga0495603_0003385
284 Ga0495603_0042449
285 Ga0495603_0305920
286 Ga0495590_0010403
287 Ga0495629_0012169
288 Ga0495629_0020802
289 Ga0495629_0081444
290 Ga0495629_0212292
291 Ga0495629_0287001
292 Ga0495638_0426422
293 Ga0495651_0008570
294 Ga0495651_0067958
295 Ga0495605_0004741
296 Ga0495662_0017790
297 Ga0495662_0116448
298 Ga0495664_0000301
299 Ga0495664_0095320
300 Ga0495584_0245138
301 Ga0495585_0189608
302 Ga0495585_0320341
303 Ga0495583_0065909
304 Ga0495583_0132402
305 Ga0495606_0006736
306 Ga0495620_0045530
307 Ga0495620_0110039
308 Ga0495628_0173594
309 Ga0495630_0021260
310 Ga0495631_0004943
311 Ga0495643_0001437
312 Ga0495644_0221410
313 Ga0495648_0098666
314 Ga0495648_0139371
315 Ga0495666_0033774
316 Ga0495666_0238536
317 Ga0495652_0010908
318 Ga0495654_0117599
319 Ga0495587_0001666
320 Ga0495609_0028621
321 Ga0495597_0020739
322 Ga0495645_0011510
323 Ga0495622_0002415
324 Ga0495633_0009359
325 Ga0495667_0072804
326 Ga0495667_0424719
327 Ga0495668_0018178
328 Ga0495634_0004945
329 Ga0495611_0014917
330 Ga0495625_0043187
331 Ga0495625_0053501
332 Ga0495625_0113264
333 Ga0495635_0000756
334 Ga0495635_0102177
335 Ga0495661_0019156
336 Ga0495588_0038889
337 Ga0495588_0040943
338 Ga0495588_0180129
339 Ga0495657_0001171
340 Ga0495657_0003160
341 Ga0495657_0128875
342 Ga0495657_0281773
343 Ga0495646_0003059
344 Ga0495646_0184393
345 Ga0495613_0004281
346 Ga0495613_0115601
347 Ga0495613_0373210
348 Ga0495671_0022010
349 Ga0495671_0043714
350 Ga0495649_0015923
351 Ga0495589_0043687
352 Ga0495600_0413149
353 Ga0495660_0185090
354 Ga0495581_0053986
355 Ga0495604_0025528
356 Ga0495604_0111022
357 Ga0495636_0005508
358 Ga0495636_0006017
359 Ga0495636_0006557
360 Ga0495636_0166771
361 Ga0495674_0084986
362 Ga0495674_0142393
363 Ga0495676_0006334
364 Ga0495676_0007217
365 Ga0495676_0107070
366 Ga0495680_0027717
367 Ga0495683_0195320
368 Ga0495687_008131
369 Ga0495687_009032
370 Ga0495687_067753
371 Ga0495687_076910
372 Ga0495675_0009257
373 Ga0495675_0267332
374 Ga0495677_0007067
375 Ga0495685_052924
376 Ga0495685_226979
377 Ga0495681_0007946
378 Ga0495681_0064993
379 Ga0495684_0018676
380 Ga0495684_0163917
381 Ga0495593_0021576
382 Ga0495593_0168216
383 Ga0495602_0171140
384 Ga0495602_0357112
385 Ga0495614_0131068
386 Ga0495614_0200080
387 Ga0495626_0014277
388 Ga0496109_0145514
389 Ga0496109_0635104
390 Ga0501309_056567
391 Ga0495678_024644
392 Ga0495682_0122217
393 Ga0501323_024009
394 Ga0501033_0286742
395 Ga0501034_0038283
396 Ga0501036_0005689
397 Ga0501038_0071305
398 Ga0501070_0372163
399 nmdc:mga03n38_69967_c1
400 Ga0495612_0041308
401 Ga0495619_0111737
402 Ga0500640_010104
403 Ga0500560_003180
404 Ga0500573_0194049
405 Ga0500624_001182
406 2875392622
407 2547406451
408 2554259620
409 2585300927
410 2585303444
411 2616906185
412 2643760309
413 2643904416
414 2643946654
415 2644267937
416 2644389003
417 2644406316
418 2644434458
419 2644443612
420 2644459994
421 2644632459
422 2784586673
423 2785367070
424 2786668109
425 2808847574
426 2809230203
427 2812360392
428 2812482491
429 2819699815
430 2852637637
431 2862289744
432 2862510346
433 2862583796
434 2873157755
435 2877683476
436 2912722582
437 2912726268
438 2912758763
439 2918502441
440 2919472270
441 2946052094
442 2946065497
443 2946073851
444 2947231913
445 2954011155
446 2954388729
447 2954674397
448 2954689734
449 2954699517
450 2954702701
451 2954718456
452 2954728426
453 2954733383
454 2954747322
455 2954752266
456 2954766438
457 2966604512
458 3006487439
459 3006495074
460 8008580826
461 8023625319
462 8025535397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04186

FxsA

FxsA cytoplasmic membrane protein

18

137

0.87

Map