F344139

General Info

Members Datasets Scaffolds Average Seq Length
231 131 210 161

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10643438|Ga0207678_106434382
Length 176
Sequence LVCNPEADGARRCAPTRQKAPAGTPATVALTAAGIPFTAHPYEHDPSAPSFGLEAAEALGVEPDRVFKTLLADTDLGLVVGVVPVTGMLDLKALAAAVGAKRATMADPAVAERRTGYVVGGISPIGQKTRHTTVVDETAQLFDTVFVSGGKRGFDVELSPADLLRAIDGTFGAIAK

Samples

Sample ID Description Type Environment
1 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
7 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
8 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
9 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
10 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
11 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
12 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
13 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
14 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
15 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
16 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
17 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
18 2928153084 Leifsonia sp. 563 Isolate Unclassified
19 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
20 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
21 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
74 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
75 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
76 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
77 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
78 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
79 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.18
Metatranscriptomes 1.73
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.02
Nodule 0.87
Rhizoplane 8.66
Rhizosphere 64.94
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10082591 3300002067 Bacteria 921
2 rootH1_10002927 3300003316 Bacteria 1615
3 rootH1_10162118 3300003316 Bacteria 1163
4 Ga0006562J51391_1113648 3300003578 Bacteria 5621
5 Ga0006562J51391_1113649 3300003578 Bacteria 1740
6 Ga0055539_1000058 3300003752 Bacteria 149354
7 Ga0055539_1019527 3300003752 Bacteria 811
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000180 3300003759 Bacteria 78601
10 Ga0055541_1001969 3300003841 Bacteria 4238
11 Ga0065714_10081438 3300005288 Bacteria 2373
12 Ga0065714_10118402 3300005288 Bacteria 1379
13 Ga0070658_10131529 3300005327 Bacteria 2086
14 Ga0070682_100894301 3300005337 Bacteria 729
15 Ga0070659_100026624 3300005366 Bacteria 4451
16 Ga0070709_10228714 3300005434 Bacteria 1330
17 Ga0070714_100272806 3300005435 Bacteria 1569
18 Ga0070663_100130680 3300005455 Bacteria 1906
19 Ga0070663_101065921 3300005455 Bacteria 705
20 Ga0068853_100202410 3300005539 Bacteria 1807
21 Ga0068855_100769476 3300005563 Bacteria 1025
22 Ga0068856_100814530 3300005614 Bacteria 953
23 Ga0075365_10117036 3300006038 Bacteria 1835
24 Ga0075367_10004997 3300006178 Bacteria 6541
25 Ga0105245_10332467 3300009098 Bacteria 1500
26 Ga0105243_10050624 3300009148 Bacteria 3283
27 Ga0157369_10349016 3300013105 Bacteria 1537
28 Ga0157369_10774052 3300013105 Bacteria 987
29 Ga0157375_10345163 3300013308 Bacteria 1654
30 Ga0157375_10934350 3300013308 Bacteria 1010
31 Ga0157380_10100226 3300014326 Bacteria 2411
32 Ga0157377_10380831 3300014745 Bacteria 955
33 Ga0206354_10619715 3300020081 Bacteria 831
34 Ga0206353_12065375 3300020082 Bacteria 3969
35 Ga0209566_100026 3300025225 Bacteria 367457
36 Ga0209674_100001 3300025226 Bacteria 4013750
37 Ga0209563_100001 3300025230 Bacteria 4013775
38 Ga0209563_100320 3300025230 Bacteria 19012
39 Ga0209677_100001 3300025253 Bacteria 4013787
40 Ga0209677_100375 3300025253 Bacteria 27361
41 Ga0209455_1003580 3300025272 Bacteria 5423
42 Ga0207705_10000213 3300025909 Bacteria 58174
43 Ga0207705_10057212 3300025909 Bacteria 2813
44 Ga0207657_10313630 3300025919 Bacteria 1241
45 Ga0207664_10249066 3300025929 Bacteria 1550
46 Ga0207690_10062300 3300025932 Bacteria 2539
47 Ga0207709_10077434 3300025935 Bacteria 2132
48 Ga0207669_10263861 3300025937 Bacteria 1290
49 Ga0207667_10793355 3300025949 Bacteria 944
50 Ga0207639_10192166 3300026041 Bacteria 1744
51 Ga0207678_10073500 3300026067 Bacteria 2930
52 Ga0207678_10643438 3300026067 Bacteria 931
53 Ga0207675_100618713 3300026118 Bacteria 1087
54 Ga0207683_10531236 3300026121 Bacteria 1087
55 Ga0207698_10820567 3300026142 Bacteria 933
56 Ga0307515_10354008 3300028794 Bacteria 1113
57 Ga0307514_10008510 3300031649 Bacteria 8727
58 Ga0395899_0002884 3300037312 Bacteria 13810
59 Ga0395899_0009213 3300037312 Bacteria 7581
60 Ga0395899_0059132 3300037312 Bacteria 2825
61 Ga0395899_0307139 3300037312 Bacteria 1072
62 Ga0395899_0409307 3300037312 Bacteria 896
63 Ga0395900_0016648 3300037418 Bacteria 7499
64 Ga0395900_0061997 3300037418 Bacteria 3844
65 Ga0395900_0069301 3300037418 Bacteria 3625
66 Ga0395900_0537289 3300037418 Bacteria 1115
67 Ga0395898_0003520 3300037466 Bacteria 17455
68 Ga0395898_0006250 3300037466 Bacteria 12746
69 Ga0395898_0084313 3300037466 Bacteria 3063
70 Ga0395898_0180757 3300037466 Bacteria 2016
71 Ga0395898_0181199 3300037466 Bacteria 2013
72 Ga0395898_0407607 3300037466 Bacteria 1296
73 Ga0395898_1514397 3300037466 Bacteria 596
74 Ga0395905_0054690 3300037471 Bacteria 3735
75 Ga0395901_0030238 3300038443 Bacteria 5580
76 Ga0395901_0048970 3300038443 Bacteria 4389
77 Ga0395901_0066459 3300038443 Bacteria 3756
78 Ga0395901_0116378 3300038443 Bacteria 2808
79 Ga0395901_0160914 3300038443 Bacteria 2358
80 Ga0395901_0172398 3300038443 Bacteria 2270
81 Ga0395901_0175535 3300038443 Bacteria 2247
82 Ga0395901_0270235 3300038443 Bacteria 1768
83 Ga0395901_0322999 3300038443 Bacteria 1597
84 Ga0451789_0024979 3300041443 Bacteria 796
85 Ga0451791_1344215 3300041451 Bacteria 1151
86 Ga0451793_1851569 3300041452 Bacteria 2347
87 Ga0451806_120294 3300041462 Bacteria 643
88 Ga0451804_0658205 3300041463 Bacteria 611
89 Ga0451833_1279212 3300041491 Bacteria 913
90 Ga0451855_1103310 3300041511 Bacteria 527
91 Ga0451855_1591033 3300041511 Bacteria 557
92 Ga0466969_0165735 3300044656 Bacteria 1014
93 Ga0466969_0195048 3300044656 Bacteria 925
94 Ga0466972_0019107 3300044658 Bacteria 3427
95 Ga0466972_0024528 3300044658 Bacteria 2992
96 Ga0466972_0133748 3300044658 Bacteria 1168
97 Ga0466972_0143358 3300044658 Bacteria 1124
98 Ga0466972_0181263 3300044658 Bacteria 987
99 Ga0466972_0273493 3300044658 Bacteria 789
100 Ga0466966_0082118 3300044684 Bacteria 2006
101 Ga0466966_0083850 3300044684 Bacteria 1983
102 Ga0466966_0133164 3300044684 Bacteria 1521
103 Ga0466966_0323560 3300044684 Bacteria 926
104 Ga0466961_0024988 3300044693 Bacteria 3844
105 Ga0466961_0102149 3300044693 Bacteria 1806
106 Ga0466961_0390034 3300044693 Bacteria 845
107 Ga0466971_0027947 3300044719 Bacteria 2525
108 Ga0466968_0027236 3300044735 Bacteria 2351
109 Ga0466968_0307273 3300044735 Bacteria 764
110 Ga0466970_0035644 3300044765 Bacteria 2635
111 Ga0466970_0097393 3300044765 Bacteria 1600
112 Ga0466970_0729623 3300044765 Bacteria 578
113 Ga0466957_0030467 3300044842 Bacteria 3221
114 Ga0466957_0041350 3300044842 Bacteria 2788
115 Ga0466957_1034850 3300044842 Bacteria 591
116 Ga0466960_0083108 3300044901 Bacteria 1617
117 Ga0466960_0397015 3300044901 Bacteria 794
118 Ga0466959_0119214 3300045049 Bacteria 1877
119 Ga0466959_0147162 3300045049 Bacteria 1662
120 Ga0466959_0708373 3300045049 Bacteria 675
121 Ga0495680_0342069 3300047322 Bacteria 1043
122 Ga0496100_0788261 3300048903 Bacteria 744
123 Ga0496104_0394164 3300048907 Bacteria 1297
124 Ga0496104_0404801 3300048907 Bacteria 1277
125 Ga0496108_0250437 3300048911 Bacteria 1541
126 Ga0496109_0177646 3300048912 Bacteria 1999
127 Ga0496109_0928378 3300048912 Bacteria 808
128 Ga0496110_0009093 3300048913 Bacteria 8018
129 Ga0496111_0538096 3300048914 Bacteria 858
130 Ga0496112_0179480 3300048915 Bacteria 2081
131 Ga0496112_0194196 3300048915 Bacteria 1991
132 Ga0496113_0089841 3300048916 Bacteria 2365
133 Ga0496113_0292822 3300048916 Bacteria 1303
134 Ga0496113_0330903 3300048916 Bacteria 1221
135 Ga0496114_0234186 3300048917 Bacteria 1614
136 Ga0496114_0415737 3300048917 Bacteria 1191
137 Ga0496117_0057270 3300048920 Bacteria 2708
138 Ga0496120_0111558 3300048923 Bacteria 1428
139 Ga0496120_0201739 3300048923 Bacteria 962
140 Ga0496121_0130169 3300048924 Bacteria 1885
141 Ga0496122_0026383 3300048925 Bacteria 5010
142 Ga0496123_0000533 3300048926 Bacteria 65458
143 Ga0501031_0055470 3300049568 Bacteria 2582
144 Ga0501031_0784653 3300049568 Bacteria 611
145 Ga0501032_0032424 3300049569 Bacteria 3580
146 Ga0501032_0094245 3300049569 Bacteria 1985
147 Ga0501032_0215748 3300049569 Bacteria 1250
148 Ga0501033_0022341 3300049570 Bacteria 4773
149 Ga0501033_0045035 3300049570 Bacteria 3284
150 Ga0501033_0132978 3300049570 Bacteria 1801
151 Ga0501034_0020053 3300049571 Bacteria 6828
152 Ga0501034_0027953 3300049571 Bacteria 5735
153 Ga0501034_0082523 3300049571 Bacteria 3216
154 Ga0501034_0350359 3300049571 Bacteria 1405
155 Ga0501034_0626125 3300049571 Bacteria 979
156 Ga0501034_0905939 3300049571 Bacteria 769
157 Ga0501036_0141892 3300049572 Bacteria 2027
158 Ga0501036_0372521 3300049572 Bacteria 1192
159 Ga0501037_0073382 3300049573 Bacteria 2488
160 Ga0501037_0599716 3300049573 Bacteria 740
161 Ga0501038_0175521 3300049574 Bacteria 1732
162 Ga0501038_0204183 3300049574 Bacteria 1584
163 Ga0501039_0154458 3300049575 Bacteria 1803
164 Ga0501040_0185030 3300049576 Bacteria 1477
165 Ga0501042_0110275 3300049578 Bacteria 1982
166 Ga0501043_0013159 3300049579 Bacteria 6471
167 Ga0501043_0249526 3300049579 Bacteria 1367
168 Ga0501043_0436367 3300049579 Unclassified 986
169 Ga0501043_0755508 3300049579 Bacteria 707
170 Ga0501046_0088280 3300049580 Bacteria 2388
171 Ga0501046_0512190 3300049580 Unclassified 858
172 Ga0501047_0021954 3300049581 Bacteria 6130
173 Ga0501047_0030616 3300049581 Bacteria 5187
174 Ga0501047_0199276 3300049581 Bacteria 1863
175 Ga0501047_0230570 3300049581 Bacteria 1705
176 Ga0501048_0030282 3300049582 Bacteria 3916
177 Ga0501067_0078579 3300049583 Bacteria 1829
178 Ga0501067_0218260 3300049583 Bacteria 1062
179 Ga0501070_0120746 3300049586 Bacteria 2166
180 Ga0501070_0514048 3300049586 Bacteria 961
181 Ga0501035_0007776 3300049822 Bacteria 10016
182 Ga0501035_0056309 3300049822 Bacteria 3508
183 Ga0501044_0009728 3300049823 Bacteria 10460
184 Ga0501044_0019561 3300049823 Bacteria 7239
185 Ga0501044_0107953 3300049823 Bacteria 2794
186 Ga0501044_0156048 3300049823 Bacteria 2262
187 Ga0501044_0594896 3300049823 Bacteria 1000
188 nmdc:mga03n38_469538_c1 3300050490 Bacteria 702
189 nmdc:mga0yw44_194052_c1 3300050492 Bacteria 1340
190 nmdc:mga06z11_132531_c1 3300050494 Bacteria 1401
191 Ga0500650_0127276 3300053098 Bacteria 1185
192 Ga0500559_0000063 3300053136 Bacteria 87005
193 Ga0500559_0002023 3300053136 Bacteria 10852
194 Ga0500559_0036140 3300053136 Bacteria 2135
195 Ga0500559_0139363 3300053136 Bacteria 1135
196 Ga0500568_0128280 3300053139 Bacteria 943
197 Ga0500573_0000001 3300053140 Bacteria 436394
198 Ga0500573_0018046 3300053140 Bacteria 4020
199 Ga0500573_0025902 3300053140 Bacteria 3372
200 Ga0500573_0041501 3300053140 Bacteria 2656
201 Ga0500573_0061160 3300053140 Bacteria 2157
202 Ga0500573_0091103 3300053140 Bacteria 1722
203 Ga0500573_0400139 3300053140 Bacteria 650
204 Ga0500577_0087983 3300053142 Bacteria 1250
205 Ga0500577_0168991 3300053142 Bacteria 934
206 Ga0500577_0278985 3300053142 Bacteria 728
207 Ga0500577_0302695 3300053142 Bacteria 698
208 Ga0500616_0000027 3300053153 Bacteria 441053
209 Ga0500616_0000543 3300053153 Bacteria 47141
210 Ga0500616_0003629 3300053153 Bacteria 11608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0409307 Ga0395899_0409307_265_708 142
2 3300037466 Ga0395898_0084313 Ga0395898_0084313_1257_1700 142
3 3300041463 Ga0451804_0658205 Ga0451804_0658205_14_445 142
4 3300044656 Ga0466969_0195048 Ga0466969_0195048_93_536 142
5 3300044693 Ga0466961_0390034 Ga0466961_0390034_65_508 142
6 3300047322 Ga0495680_0342069 Ga0495680_0342069_263_733 145
7 3300048917 Ga0496114_0415737 Ga0496114_0415737_641_1111 145
8 iso_pu_bacteria 2524023228 2524534783 145
9 iso_pu_bacteria 2728368998 2728752958 145
10 iso_pu_bacteria 2895660088 2895661616 145
11 3300049573 Ga0501037_0599716 Ga0501037_0599716_268_717 149
12 3300005337 Ga0070682_100894301 Ga0070682_1008943011 153
13 iso_pu_bacteria 2904430863 2904433703 154
14 3300026118 Ga0207675_100618713 Ga0207675_1006187131 155
15 3300003316 rootH1_10002927 rootH1_100029273 156
16 3300005288 Ga0065714_10081438 Ga0065714_100814382 156
17 3300005434 Ga0070709_10228714 Ga0070709_102287141 156
18 3300041511 Ga0451855_1103310 Ga0451855_1103310_29_502 156
19 3300048914 Ga0496111_0538096 Ga0496111_0538096_25_495 156
20 3300048923 Ga0496120_0201739 Ga0496120_0201739_124_597 156
21 3300048924 Ga0496121_0130169 Ga0496121_0130169_445_924 156
22 3300048925 Ga0496122_0026383 Ga0496122_0026383_3381_3854 156
23 3300048926 Ga0496123_0000533 Ga0496123_0000533_61575_62048 156
24 3300049568 Ga0501031_0055470 Ga0501031_0055470_242_712 156
25 3300049568 Ga0501031_0784653 Ga0501031_0784653_23_502 156
26 3300049569 Ga0501032_0032424 Ga0501032_0032424_2552_3022 156
27 3300049569 Ga0501032_0094245 Ga0501032_0094245_49_528 156
28 3300049570 Ga0501033_0132978 Ga0501033_0132978_1047_1517 156
29 3300049571 Ga0501034_0020053 Ga0501034_0020053_4876_5349 156
30 3300049571 Ga0501034_0082523 Ga0501034_0082523_2461_2940 156
31 3300049571 Ga0501034_0350359 Ga0501034_0350359_768_1241 156
32 3300049571 Ga0501034_0626125 Ga0501034_0626125_329_802 156
33 3300049571 Ga0501034_0905939 Ga0501034_0905939_93_566 156
34 3300049572 Ga0501036_0372521 Ga0501036_0372521_194_664 156
35 3300049573 Ga0501037_0073382 Ga0501037_0073382_1941_2420 156
36 3300049574 Ga0501038_0204183 Ga0501038_0204183_501_971 156
37 3300049575 Ga0501039_0154458 Ga0501039_0154458_1221_1691 156
38 3300049579 Ga0501043_0249526 Ga0501043_0249526_514_993 156
39 3300049579 Ga0501043_0755508 Ga0501043_0755508_200_670 156
40 3300049580 Ga0501046_0088280 Ga0501046_0088280_1837_2316 156
41 3300049581 Ga0501047_0021954 Ga0501047_0021954_929_1408 156
42 3300049583 Ga0501067_0078579 Ga0501067_0078579_382_855 156
43 3300049822 Ga0501035_0056309 Ga0501035_0056309_877_1356 156
44 3300049823 Ga0501044_0009728 Ga0501044_0009728_2347_2826 156
45 3300049823 Ga0501044_0594896 Ga0501044_0594896_429_902 156
46 3300053136 Ga0500559_0000063 Ga0500559_0000063_67027_67500 156
47 3300053136 Ga0500559_0002023 Ga0500559_0002023_1687_2160 156
48 3300053139 Ga0500568_0128280 Ga0500568_0128280_16_489 156
49 3300053140 Ga0500573_0000001 Ga0500573_0000001_391818_392288 156
50 3300053153 Ga0500616_0000543 Ga0500616_0000543_43462_43935 156
51 iso_pu_bacteria 2966921586 2966922210 156
52 3300003316 rootH1_10162118 rootH1_101621182 157
53 3300005366 Ga0070659_100026624 Ga0070659_1000266244 157
54 3300005455 Ga0070663_100130680 Ga0070663_1001306802 157
55 3300005539 Ga0068853_100202410 Ga0068853_1002024102 157
56 3300025909 Ga0207705_10000213 Ga0207705_100002139 157
57 3300025919 Ga0207657_10313630 Ga0207657_103136302 157
58 3300025932 Ga0207690_10062300 Ga0207690_100623002 157
59 3300025949 Ga0207667_10793355 Ga0207667_107933552 157
60 3300026041 Ga0207639_10192166 Ga0207639_101921662 157
61 3300026067 Ga0207678_10073500 Ga0207678_100735003 157
62 3300028794 Ga0307515_10354008 Ga0307515_103540082 157
63 3300031649 Ga0307514_10008510 Ga0307514_100085106 157
64 3300041462 Ga0451806_120294 Ga0451806_120294_90_563 157
65 3300048923 Ga0496120_0111558 Ga0496120_0111558_722_1198 157
66 3300053136 Ga0500559_0036140 Ga0500559_0036140_1165_1644 157
67 3300053136 Ga0500559_0139363 Ga0500559_0139363_51_530 157
68 3300053140 Ga0500573_0018046 Ga0500573_0018046_3525_3998 157
69 3300053140 Ga0500573_0091103 Ga0500573_0091103_465_944 157
70 3300053140 Ga0500573_0400139 Ga0500573_0400139_35_508 157
71 3300053142 Ga0500577_0278985 Ga0500577_0278985_29_502 157
72 3300053153 Ga0500616_0003629 Ga0500616_0003629_6596_7102 157
73 iso_pu_bacteria 2643221572 2643875532 157
74 iso_pu_bacteria 2643221669 2644382587 157
75 iso_pu_bacteria 2939660829 2939662629 157
76 3300005563 Ga0068855_100769476 Ga0068855_1007694762 158
77 3300038443 Ga0395901_0116378 Ga0395901_0116378_876_1352 158
78 3300044684 Ga0466966_0082118 Ga0466966_0082118_1498_1974 158
79 iso_pu_bacteria 2811994882 2812374928 158
80 iso_pu_bacteria 2818991469 2819729535 158
81 iso_pu_bacteria 2844841374 2844842147 158
82 iso_pu_bacteria 2870622029 2870624207 158
83 iso_pu_bacteria 2919055335 2919057793 158
84 iso_pu_bacteria 2919523602 2919524194 158
85 iso_pu_bacteria 2928153084 2928155638 158
86 iso_pu_bacteria 2939657138 2939658680 158
87 iso_pu_bacteria 2643221649 2644277077 159
88 iso_pu_bacteria 2818991462 2819691685 159
89 iso_pu_bacteria 2844852863 2844854283 159
90 iso_pu_bacteria 2919051321 2919051551 159
91 3300037418 Ga0395900_0016648 Ga0395900_0016648_3375_3857 160
92 3300038443 Ga0395901_0066459 Ga0395901_0066459_195_677 160
93 3300049570 Ga0501033_0045035 Ga0501033_0045035_1831_2328 160
94 3300049572 Ga0501036_0141892 Ga0501036_0141892_555_1052 160
95 3300049581 Ga0501047_0230570 Ga0501047_0230570_1189_1686 160
96 3300049823 Ga0501044_0156048 Ga0501044_0156048_1001_1498 160
97 3300053140 Ga0500573_0025902 Ga0500573_0025902_2163_2648 160
98 3300053142 Ga0500577_0302695 Ga0500577_0302695_203_688 160
99 iso_pu_bacteria 2585428094 2587863327 160
100 3300037466 Ga0395898_0006250 Ga0395898_0006250_5216_5725 161
101 3300037471 Ga0395905_0054690 Ga0395905_0054690_1912_2421 161
102 3300041443 Ga0451789_0024979 Ga0451789_0024979_138_635 161
103 3300041452 Ga0451793_1851569 Ga0451793_1851569_1802_2299 161
104 3300041511 Ga0451855_1591033 Ga0451855_1591033_13_504 161
105 3300053140 Ga0500573_0041501 Ga0500573_0041501_780_1274 161
106 3300053140 Ga0500573_0061160 Ga0500573_0061160_992_1486 161
107 3300002067 JGI24735J21928_10082591 JGI24735J21928_100825911 162
108 3300003578 Ga0006562J51391_1113648 Ga0006562J51391_11136484 162
109 3300003578 Ga0006562J51391_1113649 Ga0006562J51391_11136492 162
110 3300003752 Ga0055539_1000058 Ga0055539_100005897 162
111 3300003752 Ga0055539_1019527 Ga0055539_10195271 162
112 3300003756 Ga0055533_1000001 Ga0055533_1000001484 162
113 3300003759 Ga0055525_1000180 Ga0055525_100018017 162
114 3300003841 Ga0055541_1001969 Ga0055541_10019692 162
115 3300005288 Ga0065714_10118402 Ga0065714_101184022 162
116 3300005327 Ga0070658_10131529 Ga0070658_101315292 162
117 3300005435 Ga0070714_100272806 Ga0070714_1002728062 162
118 3300005455 Ga0070663_101065921 Ga0070663_1010659211 162
119 3300005614 Ga0068856_100814530 Ga0068856_1008145301 162
120 3300006038 Ga0075365_10117036 Ga0075365_101170362 162
121 3300006178 Ga0075367_10004997 Ga0075367_100049976 162
122 3300009098 Ga0105245_10332467 Ga0105245_103324671 162
123 3300009148 Ga0105243_10050624 Ga0105243_100506243 162
124 3300013105 Ga0157369_10349016 Ga0157369_103490162 162
125 3300013105 Ga0157369_10774052 Ga0157369_107740522 162
126 3300013308 Ga0157375_10345163 Ga0157375_103451632 162
127 3300013308 Ga0157375_10934350 Ga0157375_109343502 162
128 3300014326 Ga0157380_10100226 Ga0157380_101002264 162
129 3300014745 Ga0157377_10380831 Ga0157377_103808311 162
130 3300020081 Ga0206354_10619715 Ga0206354_106197152 162
131 3300020082 Ga0206353_12065375 Ga0206353_120653752 162
132 3300025225 Ga0209566_100026 Ga0209566_100026239 162
133 3300025226 Ga0209674_100001 Ga0209674_100001485 162
134 3300025230 Ga0209563_100001 Ga0209563_100001485 162
135 3300025230 Ga0209563_100320 Ga0209563_1003206 162
136 3300025253 Ga0209677_100001 Ga0209677_100001485 162
137 3300025253 Ga0209677_100375 Ga0209677_10037526 162
138 3300025272 Ga0209455_1003580 Ga0209455_10035802 162
139 3300025909 Ga0207705_10057212 Ga0207705_100572122 162
140 3300025929 Ga0207664_10249066 Ga0207664_102490662 162
141 3300025935 Ga0207709_10077434 Ga0207709_100774341 162
142 3300025937 Ga0207669_10263861 Ga0207669_102638612 162
143 3300026067 Ga0207678_10643438 Ga0207678_106434382 162
144 3300026121 Ga0207683_10531236 Ga0207683_105312362 162
145 3300026142 Ga0207698_10820567 Ga0207698_108205672 162
146 3300037312 Ga0395899_0002884 Ga0395899_0002884_9393_9881 162
147 3300037312 Ga0395899_0009213 Ga0395899_0009213_3598_4113 162
148 3300037312 Ga0395899_0059132 Ga0395899_0059132_1941_2456 162
149 3300037312 Ga0395899_0307139 Ga0395899_0307139_305_820 162
150 3300037418 Ga0395900_0061997 Ga0395900_0061997_1287_1802 162
151 3300037418 Ga0395900_0069301 Ga0395900_0069301_1061_1576 162
152 3300037418 Ga0395900_0537289 Ga0395900_0537289_276_776 162
153 3300037466 Ga0395898_0003520 Ga0395898_0003520_5409_5924 162
154 3300037466 Ga0395898_0180757 Ga0395898_0180757_455_970 162
155 3300037466 Ga0395898_0181199 Ga0395898_0181199_1250_1750 162
156 3300037466 Ga0395898_0407607 Ga0395898_0407607_203_691 162
157 3300037466 Ga0395898_1514397 Ga0395898_1514397_19_534 162
158 3300038443 Ga0395901_0030238 Ga0395901_0030238_2013_2528 162
159 3300038443 Ga0395901_0048970 Ga0395901_0048970_2097_2597 162
160 3300038443 Ga0395901_0160914 Ga0395901_0160914_466_981 162
161 3300038443 Ga0395901_0172398 Ga0395901_0172398_1338_1826 162
162 3300038443 Ga0395901_0175535 Ga0395901_0175535_523_1038 162
163 3300038443 Ga0395901_0270235 Ga0395901_0270235_982_1482 162
164 3300038443 Ga0395901_0322999 Ga0395901_0322999_1075_1584 162
165 3300041451 Ga0451791_1344215 Ga0451791_1344215_244_738 162
166 3300041491 Ga0451833_1279212 Ga0451833_1279212_166_681 162
167 3300044656 Ga0466969_0165735 Ga0466969_0165735_211_699 162
168 3300044658 Ga0466972_0019107 Ga0466972_0019107_65_553 162
169 3300044658 Ga0466972_0024528 Ga0466972_0024528_1289_1777 162
170 3300044658 Ga0466972_0133748 Ga0466972_0133748_193_684 162
171 3300044658 Ga0466972_0143358 Ga0466972_0143358_129_617 162
172 3300044658 Ga0466972_0181263 Ga0466972_0181263_336_824 162
173 3300044658 Ga0466972_0273493 Ga0466972_0273493_77_592 162
174 3300044684 Ga0466966_0083850 Ga0466966_0083850_1038_1538 162
175 3300044684 Ga0466966_0133164 Ga0466966_0133164_593_1081 162
176 3300044684 Ga0466966_0323560 Ga0466966_0323560_147_635 162
177 3300044693 Ga0466961_0024988 Ga0466961_0024988_777_1265 162
178 3300044693 Ga0466961_0102149 Ga0466961_0102149_495_983 162
179 3300044719 Ga0466971_0027947 Ga0466971_0027947_1791_2279 162
180 3300044735 Ga0466968_0027236 Ga0466968_0027236_1439_1927 162
181 3300044735 Ga0466968_0307273 Ga0466968_0307273_63_551 162
182 3300044765 Ga0466970_0035644 Ga0466970_0035644_1586_2074 162
183 3300044765 Ga0466970_0097393 Ga0466970_0097393_107_595 162
184 3300044765 Ga0466970_0729623 Ga0466970_0729623_25_513 162
185 3300044842 Ga0466957_0030467 Ga0466957_0030467_372_860 162
186 3300044842 Ga0466957_0041350 Ga0466957_0041350_493_981 162
187 3300044842 Ga0466957_1034850 Ga0466957_1034850_74_565 162
188 3300044901 Ga0466960_0083108 Ga0466960_0083108_333_821 162
189 3300044901 Ga0466960_0397015 Ga0466960_0397015_177_692 162
190 3300045049 Ga0466959_0119214 Ga0466959_0119214_624_1112 162
191 3300045049 Ga0466959_0147162 Ga0466959_0147162_1088_1576 162
192 3300045049 Ga0466959_0708373 Ga0466959_0708373_38_529 162
193 3300048903 Ga0496100_0788261 Ga0496100_0788261_97_588 162
194 3300048907 Ga0496104_0394164 Ga0496104_0394164_200_691 162
195 3300048907 Ga0496104_0404801 Ga0496104_0404801_762_1262 162
196 3300048911 Ga0496108_0250437 Ga0496108_0250437_523_1014 162
197 3300048912 Ga0496109_0177646 Ga0496109_0177646_642_1133 162
198 3300048912 Ga0496109_0928378 Ga0496109_0928378_110_610 162
199 3300048913 Ga0496110_0009093 Ga0496110_0009093_6774_7274 162
200 3300048915 Ga0496112_0179480 Ga0496112_0179480_146_646 162
201 3300048915 Ga0496112_0194196 Ga0496112_0194196_1428_1928 162
202 3300048916 Ga0496113_0089841 Ga0496113_0089841_1166_1666 162
203 3300048916 Ga0496113_0292822 Ga0496113_0292822_528_1022 162
204 3300048916 Ga0496113_0330903 Ga0496113_0330903_178_669 162
205 3300048917 Ga0496114_0234186 Ga0496114_0234186_858_1349 162
206 3300048920 Ga0496117_0057270 Ga0496117_0057270_1792_2280 162
207 3300049569 Ga0501032_0215748 Ga0501032_0215748_15_512 162
208 3300049570 Ga0501033_0022341 Ga0501033_0022341_3877_4374 162
209 3300049571 Ga0501034_0027953 Ga0501034_0027953_1750_2247 162
210 3300049574 Ga0501038_0175521 Ga0501038_0175521_887_1384 162
211 3300049576 Ga0501040_0185030 Ga0501040_0185030_268_792 162
212 3300049578 Ga0501042_0110275 Ga0501042_0110275_773_1297 162
213 3300049579 Ga0501043_0013159 Ga0501043_0013159_4228_4725 162
214 3300049579 Ga0501043_0436367 Ga0501043_0436367_281_778 162
215 3300049580 Ga0501046_0512190 Ga0501046_0512190_282_779 162
216 3300049581 Ga0501047_0030616 Ga0501047_0030616_2887_3384 162
217 3300049581 Ga0501047_0199276 Ga0501047_0199276_1086_1583 162
218 3300049582 Ga0501048_0030282 Ga0501048_0030282_2539_3063 162
219 3300049583 Ga0501067_0218260 Ga0501067_0218260_19_516 162
220 3300049586 Ga0501070_0120746 Ga0501070_0120746_421_915 162
221 3300049586 Ga0501070_0514048 Ga0501070_0514048_343_840 162
222 3300049822 Ga0501035_0007776 Ga0501035_0007776_2456_2953 162
223 3300049823 Ga0501044_0019561 Ga0501044_0019561_3767_4264 162
224 3300049823 Ga0501044_0107953 Ga0501044_0107953_1818_2315 162
225 3300050490 nmdc:mga03n38_469538_c1 nmdc:mga03n38_469538_c1_101_589 162
226 3300050492 nmdc:mga0yw44_194052_c1 nmdc:mga0yw44_194052_c1_437_925 162
227 3300050494 nmdc:mga06z11_132531_c1 nmdc:mga06z11_132531_c1_158_646 162
228 3300053098 Ga0500650_0127276 Ga0500650_0127276_27_524 162
229 3300053142 Ga0500577_0087983 Ga0500577_0087983_710_1207 162
230 3300053142 Ga0500577_0168991 Ga0500577_0168991_407_904 162
231 3300053153 Ga0500616_0000027 Ga0500616_0000027_252119_252628 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

46

166

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9413 10 162
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9399 10 162
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9353 10 162
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9279 10 162
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9234 10 162
ID Description Score Start End Superfamily
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9368 10 162 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9247 10 162 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9097 1 160 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8988 1 160 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8826 10 162 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A0Q8V8P8-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9824 8 162 GO:0002161
GO:0006412
GO:0016829
AF-A0A0Q0UG09-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9815 9 162 GO:0002161
GO:0006412
GO:0016829
AF-A0A6G2UW32-F1-model_v4 Cys-tRNA(Pro) deacylase 0.9778 50 162 GO:0002161
GO:0006412
GO:0016829
AF-A0A2W2J163-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9776 9 162 GO:0002161
GO:0006412
GO:0016829
AF-A0A0L6CLR6-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9773 9 162 GO:0002161
GO:0006412
GO:0016829

Feature Viewer

pLDDT pTM Quality
93.47 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map