F344042

General Info

Members Datasets Scaffolds Average Seq Length
231 157 462 386

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10006439|Ga0157378_100064393
Length 427
Sequence LSNECPKKRNSEIKRCYYCWPEKNNRVCQHDKRVAHLSTSKDDVMKIILLLSTVMMGVCGTVSYKEDAGKTLRRQLLKQASAAMQQLPITVTSNYCVRSAGGRHDFYSEGDYWWPNPVSADSPYVQKDGLTNPENFVAHRHAMIRLSQLTAALASAYSITGNEAYVQKAIPHYRAWFIDTATMMNPHLQYAQAIRGRFTGRSIGVIDGIQLMEAIQSLAVMEKAKCMDTALVTGVKQWVARLLQWLTTHPYGKDEMNAQNNHGTCWVMQVAVFARFTGNKELMQFCRDRYKNILLPNQMAIDGSFPLELKRTKPYGYSIFNLDAMATICQVLSVPGDNLWEYKTADGKSIRKGIDYLFPFVAKKKSWPFEHDVMHWTEWPVAQSFLIFGANAFDRQDWFSTWQRLDHAPSDDEIIRNWPVRNPLIWM

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
131 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
141 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
146 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 2738543023 Pedobacter sp. OK628 Isolate Unclassified
149 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
150 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
151 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
152 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
153 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
154 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
155 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
156 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
157 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 0
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 0
Rhizoplane 0.43
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10006439 3300013297 Bacteria 10265
2 SwRhRL2b_contig_172026 2162886007 Bacteria 9283
3 rootH1_10015458 3300003316 Bacteria 1599
4 rootH1_10114984 3300003323 Bacteria 5341
5 rootH1_10213251 3300003323 Bacteria 4651
6 Ga0065714_10013506 3300005288 Bacteria 3733
7 Ga0065714_10078907 3300005288 Bacteria 2559
8 Ga0065714_10080568 3300005288 Bacteria 2431
9 Ga0065704_10000214 3300005289 Bacteria 119751
10 Ga0065704_10071815 3300005289 Bacteria 9864
11 Ga0070658_10001900 3300005327 Bacteria 17641
12 Ga0070683_100000006 3300005329 Bacteria 361071
13 Ga0070683_100051520 3300005329 Bacteria 3812
14 Ga0070666_10000080 3300005335 Bacteria 69160
15 Ga0068868_100009722 3300005338 Bacteria 6937
16 Ga0070660_100019538 3300005339 Bacteria 4967
17 Ga0070689_100110789 3300005340 Bacteria 2183
18 Ga0070673_100068882 3300005364 Bacteria 2834
19 Ga0070659_100000221 3300005366 Bacteria 44165
20 Ga0070659_100000436 3300005366 Bacteria 31452
21 Ga0070667_100013065 3300005367 Bacteria 6864
22 Ga0070667_100028261 3300005367 Bacteria 4668
23 Ga0070709_10011616 3300005434 Bacteria 4914
24 Ga0070681_10046760 3300005458 Bacteria 4325
25 Ga0070679_100036538 3300005530 Bacteria 4874
26 Ga0070684_100000063 3300005535 Bacteria 70046
27 Ga0070684_100028026 3300005535 Bacteria 4762
28 Ga0070672_100043315 3300005543 Bacteria 3470
29 Ga0068855_100005863 3300005563 Bacteria 14992
30 Ga0068855_100038644 3300005563 Bacteria 5670
31 Ga0068857_100002570 3300005577 Bacteria 14862
32 Ga0068857_100029395 3300005577 Bacteria 4850
33 Ga0068857_100087164 3300005577 Bacteria 2792
34 Ga0068856_100117596 3300005614 Bacteria 2659
35 Ga0068852_100002457 3300005616 Bacteria 12763
36 Ga0068852_100010359 3300005616 Bacteria 6964
37 Ga0068859_100000101 3300005617 Bacteria 79768
38 Ga0068859_100150222 3300005617 Bacteria 2405
39 Ga0068859_100305200 3300005617 Unclassified 1685
40 Ga0068859_100375022 3300005617 Bacteria 1518
41 Ga0068859_100394203 3300005617 Bacteria 1480
42 Ga0068864_100008137 3300005618 Bacteria 8647
43 Ga0068863_100069284 3300005841 Bacteria 3336
44 Ga0068860_100012239 3300005843 Bacteria 8455
45 Ga0068860_100016882 3300005843 Bacteria 7116
46 Ga0070717_10004610 3300006028 Bacteria 9987
47 Ga0070717_10107425 3300006028 Bacteria 2377
48 Ga0075365_10077013 3300006038 Bacteria 2253
49 Ga0075364_10070505 3300006051 Bacteria 2301
50 Ga0097621_100054987 3300006237 Bacteria 3249
51 Ga0068871_100025248 3300006358 Bacteria 4620
52 Ga0075433_10144244 3300006852 Unclassified 2117
53 Ga0075436_100001688 3300006914 Bacteria 15097
54 Ga0075436_100034703 3300006914 Bacteria 3479
55 Ga0097620_100000101 3300006931 Bacteria 79768
56 Ga0097620_100150226 3300006931 Bacteria 2405
57 Ga0097620_100305197 3300006931 Unclassified 1685
58 Ga0097620_100375031 3300006931 Bacteria 1518
59 Ga0097620_100394183 3300006931 Bacteria 1480
60 Ga0105240_10003870 3300009093 Bacteria 23121
61 Ga0105240_10229450 3300009093 Bacteria 2159
62 Ga0105245_10066570 3300009098 Bacteria 3261
63 Ga0105247_10001988 3300009101 Bacteria 14195
64 Ga0114129_10081560 3300009147 Bacteria 4496
65 Ga0114129_10156302 3300009147 Bacteria 3118
66 Ga0114129_10260342 3300009147 Unclassified 2325
67 Ga0105241_10001106 3300009174 Bacteria 20531
68 Ga0105241_10151235 3300009174 Unclassified 1899
69 Ga0105242_10287155 3300009176 Bacteria 1497
70 Ga0105248_10077097 3300009177 Bacteria 3747
71 Ga0105248_10131996 3300009177 Bacteria 2818
72 Ga0105237_10002074 3300009545 Bacteria 25376
73 Ga0105237_10002137 3300009545 Bacteria 24887
74 Ga0105237_10094283 3300009545 Bacteria 2982
75 Ga0105249_10003213 3300009553 Bacteria 14146
76 Ga0105239_10000679 3300010375 Bacteria 48522
77 Ga0105239_10001893 3300010375 Bacteria 27361
78 Ga0105239_10001902 3300010375 Bacteria 27221
79 Ga0105239_10108139 3300010375 Bacteria 3081
80 Ga0105239_10242212 3300010375 Bacteria 2024
81 Ga0105246_10008008 3300011119 Bacteria 6486
82 Ga0157373_10014148 3300013100 Bacteria 5850
83 Ga0157371_10000617 3300013102 Bacteria 42318
84 Ga0157371_10001763 3300013102 Bacteria 21923
85 Ga0157371_10033426 3300013102 Bacteria 3695
86 Ga0157370_10002723 3300013104 Bacteria 21143
87 Ga0157370_10100733 3300013104 Bacteria 2706
88 Ga0157370_10290402 3300013104 Unclassified 1510
89 Ga0157369_10000004 3300013105 Bacteria 479764
90 Ga0157369_10039177 3300013105 Bacteria 5180
91 Ga0157369_10041638 3300013105 Bacteria 5013
92 Ga0157369_10055313 3300013105 Bacteria 4284
93 Ga0157374_10121619 3300013296 Bacteria 2520
94 Ga0163162_10007527 3300013306 Bacteria 10605
95 Ga0157372_10000056 3300013307 Bacteria 125982
96 Ga0157372_10000508 3300013307 Bacteria 42774
97 Ga0157372_10013003 3300013307 Bacteria 8881
98 Ga0157372_10102006 3300013307 Bacteria 3277
99 Ga0157372_10156393 3300013307 Bacteria 2633
100 Ga0157375_10063926 3300013308 Bacteria 3663
101 Ga0157375_10107091 3300013308 Bacteria 2888
102 Ga0163163_10160754 3300014325 Bacteria 2292
103 Ga0157380_10033463 3300014326 Bacteria 3958
104 Ga0157376_10001024 3300014969 Bacteria 18251
105 Ga0157376_10019829 3300014969 Bacteria 5190
106 Ga0157376_10124251 3300014969 Unclassified 2292
107 Ga0182006_1005015 3300015261 Bacteria 6372
108 Ga0213874_10015210 3300021377 Bacteria 2026
109 Ga0213876_10004267 3300021384 Bacteria 8017
110 Ga0209437_100041 3300025233 Bacteria 444465
111 Ga0209026_1000899 3300025250 Bacteria 15331
112 Ga0209026_1007907 3300025250 Bacteria 2301
113 Ga0209233_1000976 3300025261 Bacteria 12293
114 Ga0207710_10020808 3300025900 Bacteria 2807
115 Ga0207647_10002370 3300025904 Bacteria 14319
116 Ga0207647_10022501 3300025904 Bacteria 4184
117 Ga0207699_10005906 3300025906 Bacteria 5891
118 Ga0207705_10037831 3300025909 Bacteria 3453
119 Ga0207654_10003081 3300025911 Bacteria 8447
120 Ga0207695_10072881 3300025913 Bacteria 3502
121 Ga0207671_10001196 3300025914 Bacteria 30816
122 Ga0207671_10001805 3300025914 Bacteria 23920
123 Ga0207657_10033482 3300025919 Bacteria 4632
124 Ga0207657_10047490 3300025919 Bacteria 3753
125 Ga0207652_10046868 3300025921 Bacteria 3690
126 Ga0207646_10046534 3300025922 Bacteria 3892
127 Ga0207644_10031118 3300025931 Bacteria 3716
128 Ga0207690_10000244 3300025932 Bacteria 39487
129 Ga0207690_10019049 3300025932 Bacteria 4217
130 Ga0207691_10103176 3300025940 Bacteria 2543
131 Ga0207711_10183420 3300025941 Bacteria 1904
132 Ga0207689_10002388 3300025942 Bacteria 17532
133 Ga0207661_10000011 3300025944 Bacteria 361200
134 Ga0207667_10004106 3300025949 Bacteria 17891
135 Ga0207667_10029633 3300025949 Bacteria 5933
136 Ga0207667_10044453 3300025949 Bacteria 4706
137 Ga0207651_10039441 3300025960 Bacteria 3115
138 Ga0207658_10054142 3300025986 Bacteria 2967
139 Ga0207641_10000053 3300026088 Bacteria 173468
140 Ga0207641_10057125 3300026088 Bacteria 3319
141 Ga0207676_10013201 3300026095 Bacteria 5932
142 Ga0207674_10008226 3300026116 Bacteria 12084
143 Ga0207674_10042035 3300026116 Bacteria 4723
144 Ga0207698_10010934 3300026142 Bacteria 5862
145 Ga0268264_10004646 3300028381 Bacteria 11667
146 Ga0268264_10012052 3300028381 Bacteria 7118
147 Ga0307517_10000129 3300028786 Bacteria 114359
148 Ga0307515_10000251 3300028794 Bacteria 132970
149 Ga0307515_10036828 3300028794 Bacteria 7897
150 Ga0265316_10032270 3300031344 Bacteria 4274
151 Ga0307509_10041982 3300031507 Bacteria 4959
152 Ga0307408_100014270 3300031548 Bacteria 5278
153 Ga0307408_100044237 3300031548 Bacteria 3172
154 Ga0307412_10000026 3300031911 Bacteria 228930
155 Ga0307414_10004016 3300032004 Bacteria 7943
156 Ga0307414_10098017 3300032004 Bacteria 2198
157 Ga0373947_0059811 3300035725 Unclassified 2311
158 Ga0436365_0266556 3300039437 Bacteria 4994
159 Ga0436365_1576427 3300039437 Bacteria 11885
160 Ga0436363_0156141 3300039450 Plasmid 3937
161 Ga0436363_1604883 3300039450 Bacteria 10596
162 Ga0466969_0000151 3300044656 Bacteria 37632
163 Ga0466972_0000558 3300044658 Bacteria 18208
164 Ga0453683_0011221 3300044673 Bacteria 5917
165 Ga0466966_0000113 3300044684 Bacteria 49984
166 Ga0466959_0000015 3300045049 Bacteria 149242
167 Ga0466959_0029814 3300045049 Bacteria 4042
168 Ga0451576_0011399 3300045051 Bacteria 10104
169 Ga0451576_0040611 3300045051 Bacteria 4923
170 Ga0495638_0036886 3300046460 Bacteria 3112
171 Ga0495651_0061848 3300046462 Bacteria 2866
172 Ga0495653_0120051 3300046463 Bacteria 1875
173 Ga0495580_0000779 3300046472 Bacteria 27448
174 Ga0495662_0113991 3300046476 Bacteria 1325
175 Ga0495664_0024190 3300046477 Bacteria 3528
176 Ga0495596_0026737 3300046500 Bacteria 2324
177 Ga0495606_0004356 3300046507 Bacteria 14200
178 Ga0495628_0111407 3300046516 Unclassified 2104
179 Ga0495645_0023999 3300046543 Bacteria 4420
180 Ga0495645_0027954 3300046543 Bacteria 4097
181 Ga0495634_0029684 3300046642 Bacteria 3784
182 Ga0495625_0014994 3300046660 Bacteria 6158
183 Ga0495625_0029735 3300046660 Bacteria 4083
184 Ga0495635_0203311 3300046663 Bacteria 1343
185 Ga0495661_0001807 3300046665 Bacteria 17155
186 Ga0495599_0008171 3300046678 Bacteria 6356
187 Ga0495599_0020903 3300046678 Bacteria 4080
188 Ga0495623_0034302 3300046679 Bacteria 3255
189 Ga0495646_0052750 3300046680 Bacteria 2455
190 Ga0495604_0083988 3300047317 Bacteria 2379
191 Ga0495674_0257483 3300047319 Bacteria 1434
192 Ga0495680_0065162 3300047322 Bacteria 2791
193 Ga0495683_0007822 3300047323 Bacteria 5735
194 Ga0495686_0000454 3300047472 Bacteria 61738
195 Ga0496112_0214644 3300048915 Bacteria 1881
196 Ga0496121_0000054 3300048924 Bacteria 307236
197 Ga0501034_0040941 3300049571 Bacteria 4688
198 Ga0501257_007032 3300049686 Bacteria 2508
199 Ga0501264_001168 3300049761 Bacteria 3062
200 Ga0501044_0012507 3300049823 Bacteria 9190
201 nmdc:mga00v17_68802_c1 3300050491 Bacteria 2189
202 nmdc:mga0k408_934_c1 3300050493 Bacteria 13321
203 nmdc:mga05p37_105688_c2 3300050507 Bacteria 3145
204 nmdc:mga05p37_26887_c1 3300050507 Bacteria 7001
205 nmdc:mga05p37_3198_c1 3300050507 Bacteria 19062
206 nmdc:mga05p37_95192_c1 3300050507 Bacteria 3669
207 nmdc:mga08x19_33626_c1 3300050514 Archaea 3236
208 nmdc:mga08x19_35659_c1 3300050514 Bacteria 3148
209 Ga0500583_0000028 3300053092 Bacteria 108276
210 Ga0500651_0000983 3300053093 Bacteria 14036
211 Ga0500608_001566 3300053122 Bacteria 8207
212 Ga0500617_009918 3300053124 Unclassified 3920
213 Ga0500655_013051 3300053133 Bacteria 1514
214 Ga0500658_0058163 3300053134 Unclassified 1600
215 Ga0500588_0017979 3300053146 Unclassified 1855
216 Ga0500622_0001957 3300053156 Bacteria 15521
217 Ga0500622_0002782 3300053156 Bacteria 12296
218 Ga0500622_0024573 3300053156 Bacteria 3186
219 Ga0500611_000066 3300053727 Bacteria 42948
220 Ga0500661_013688 3300055283 Bacteria 1462
221 Ga0501082_0005658 3300060353 Bacteria 10845
222 2739300055 2738543023 Bacteria 6767879
223 2776614062 2775506987 Bacteria 5373360
224 2842725865 2842722452 Bacteria 6263924
225 2852628776 2852627209 Bacteria 5896285
226 2884795997 2884791551 Bacteria 8511252
227 2919186385 2919186247 Bacteria 6244071
228 2919439152 2919437846 Bacteria 6199444
229 2939666345 2939664404 Bacteria 6364494
230 2954018314 2954016120 Bacteria 6446024
231 2977232929 2977232053 Bacteria 5485925
232 Ga0157378_10006439
233 SwRhRL2b_contig_172026
234 rootH1_10015458
235 rootH1_10114984
236 rootH1_10213251
237 Ga0065714_10013506
238 Ga0065714_10078907
239 Ga0065714_10080568
240 Ga0065704_10000214
241 Ga0065704_10071815
242 Ga0070658_10001900
243 Ga0070683_100000006
244 Ga0070683_100051520
245 Ga0070666_10000080
246 Ga0068868_100009722
247 Ga0070660_100019538
248 Ga0070689_100110789
249 Ga0070673_100068882
250 Ga0070659_100000221
251 Ga0070659_100000436
252 Ga0070667_100013065
253 Ga0070667_100028261
254 Ga0070709_10011616
255 Ga0070681_10046760
256 Ga0070679_100036538
257 Ga0070684_100000063
258 Ga0070684_100028026
259 Ga0070672_100043315
260 Ga0068855_100005863
261 Ga0068855_100038644
262 Ga0068857_100002570
263 Ga0068857_100029395
264 Ga0068857_100087164
265 Ga0068856_100117596
266 Ga0068852_100002457
267 Ga0068852_100010359
268 Ga0068859_100000101
269 Ga0068859_100150222
270 Ga0068859_100305200
271 Ga0068859_100375022
272 Ga0068859_100394203
273 Ga0068864_100008137
274 Ga0068863_100069284
275 Ga0068860_100012239
276 Ga0068860_100016882
277 Ga0070717_10004610
278 Ga0070717_10107425
279 Ga0075365_10077013
280 Ga0075364_10070505
281 Ga0097621_100054987
282 Ga0068871_100025248
283 Ga0075433_10144244
284 Ga0075436_100001688
285 Ga0075436_100034703
286 Ga0097620_100000101
287 Ga0097620_100150226
288 Ga0097620_100305197
289 Ga0097620_100375031
290 Ga0097620_100394183
291 Ga0105240_10003870
292 Ga0105240_10229450
293 Ga0105245_10066570
294 Ga0105247_10001988
295 Ga0114129_10081560
296 Ga0114129_10156302
297 Ga0114129_10260342
298 Ga0105241_10001106
299 Ga0105241_10151235
300 Ga0105242_10287155
301 Ga0105248_10077097
302 Ga0105248_10131996
303 Ga0105237_10002074
304 Ga0105237_10002137
305 Ga0105237_10094283
306 Ga0105249_10003213
307 Ga0105239_10000679
308 Ga0105239_10001893
309 Ga0105239_10001902
310 Ga0105239_10108139
311 Ga0105239_10242212
312 Ga0105246_10008008
313 Ga0157373_10014148
314 Ga0157371_10000617
315 Ga0157371_10001763
316 Ga0157371_10033426
317 Ga0157370_10002723
318 Ga0157370_10100733
319 Ga0157370_10290402
320 Ga0157369_10000004
321 Ga0157369_10039177
322 Ga0157369_10041638
323 Ga0157369_10055313
324 Ga0157374_10121619
325 Ga0163162_10007527
326 Ga0157372_10000056
327 Ga0157372_10000508
328 Ga0157372_10013003
329 Ga0157372_10102006
330 Ga0157372_10156393
331 Ga0157375_10063926
332 Ga0157375_10107091
333 Ga0163163_10160754
334 Ga0157380_10033463
335 Ga0157376_10001024
336 Ga0157376_10019829
337 Ga0157376_10124251
338 Ga0182006_1005015
339 Ga0213874_10015210
340 Ga0213876_10004267
341 Ga0209437_100041
342 Ga0209026_1000899
343 Ga0209026_1007907
344 Ga0209233_1000976
345 Ga0207710_10020808
346 Ga0207647_10002370
347 Ga0207647_10022501
348 Ga0207699_10005906
349 Ga0207705_10037831
350 Ga0207654_10003081
351 Ga0207695_10072881
352 Ga0207671_10001196
353 Ga0207671_10001805
354 Ga0207657_10033482
355 Ga0207657_10047490
356 Ga0207652_10046868
357 Ga0207646_10046534
358 Ga0207644_10031118
359 Ga0207690_10000244
360 Ga0207690_10019049
361 Ga0207691_10103176
362 Ga0207711_10183420
363 Ga0207689_10002388
364 Ga0207661_10000011
365 Ga0207667_10004106
366 Ga0207667_10029633
367 Ga0207667_10044453
368 Ga0207651_10039441
369 Ga0207658_10054142
370 Ga0207641_10000053
371 Ga0207641_10057125
372 Ga0207676_10013201
373 Ga0207674_10008226
374 Ga0207674_10042035
375 Ga0207698_10010934
376 Ga0268264_10004646
377 Ga0268264_10012052
378 Ga0307517_10000129
379 Ga0307515_10000251
380 Ga0307515_10036828
381 Ga0265316_10032270
382 Ga0307509_10041982
383 Ga0307408_100014270
384 Ga0307408_100044237
385 Ga0307412_10000026
386 Ga0307414_10004016
387 Ga0307414_10098017
388 Ga0373947_0059811
389 Ga0436365_0266556
390 Ga0436365_1576427
391 Ga0436363_0156141
392 Ga0436363_1604883
393 Ga0466969_0000151
394 Ga0466972_0000558
395 Ga0453683_0011221
396 Ga0466966_0000113
397 Ga0466959_0000015
398 Ga0466959_0029814
399 Ga0451576_0011399
400 Ga0451576_0040611
401 Ga0495638_0036886
402 Ga0495651_0061848
403 Ga0495653_0120051
404 Ga0495580_0000779
405 Ga0495662_0113991
406 Ga0495664_0024190
407 Ga0495596_0026737
408 Ga0495606_0004356
409 Ga0495628_0111407
410 Ga0495645_0023999
411 Ga0495645_0027954
412 Ga0495634_0029684
413 Ga0495625_0014994
414 Ga0495625_0029735
415 Ga0495635_0203311
416 Ga0495661_0001807
417 Ga0495599_0008171
418 Ga0495599_0020903
419 Ga0495623_0034302
420 Ga0495646_0052750
421 Ga0495604_0083988
422 Ga0495674_0257483
423 Ga0495680_0065162
424 Ga0495683_0007822
425 Ga0495686_0000454
426 Ga0496112_0214644
427 Ga0496121_0000054
428 Ga0501034_0040941
429 Ga0501257_007032
430 Ga0501264_001168
431 Ga0501044_0012507
432 nmdc:mga00v17_68802_c1
433 nmdc:mga0k408_934_c1
434 nmdc:mga05p37_105688_c2
435 nmdc:mga05p37_26887_c1
436 nmdc:mga05p37_3198_c1
437 nmdc:mga05p37_95192_c1
438 nmdc:mga08x19_33626_c1
439 nmdc:mga08x19_35659_c1
440 Ga0500583_0000028
441 Ga0500651_0000983
442 Ga0500608_001566
443 Ga0500617_009918
444 Ga0500655_013051
445 Ga0500658_0058163
446 Ga0500588_0017979
447 Ga0500622_0001957
448 Ga0500622_0002782
449 Ga0500622_0024573
450 Ga0500611_000066
451 Ga0500661_013688
452 Ga0501082_0005658
453 2739300055
454 2776614062
455 2842725865
456 2852628776
457 2884795997
458 2919186385
459 2919439152
460 2939666345
461 2954018314
462 2977232929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05426

Alginate_lyase

Alginate lyase

90

367

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bdq-assembly1.cif.gz_A crystal structure of bacteroides ovatus cp926 pl38 alginate lyase 0.8348 18 378
3nnb-assembly1.cif.gz_A crystal structure of an alginate lyase (bacova_01668) from bacteroides ovatus at 1.60 a resolution 0.8289 27 378
7xte-assembly1.cif.gz_A crystal structure of pl-5 family polysaccharide lyase panpl-n171l mutant from pandoraea apista in apo form at ph3.5 0.8037 90 316
3nnb-assembly1.cif.gz_A crystal structure of an alginate lyase (bacova_01668) from bacteroides ovatus at 1.60 a resolution 0.7686 27 378
7wxk-assembly1.cif.gz_A crystal structure of pl-5 family polysaccharide lyase panpl from pandoraea apista at ph4.5 in apo form 0.7657 36 316
ID Description Score Start End Superfamily
3nnbA01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Chondroitin AC/alginate lyase 0.8173 27 378 1.50.10.100
3nnbA01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Chondroitin AC/alginate lyase 0.7519 27 378 1.50.10.100
1x1iA01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Chondroitin AC/alginate lyase 0.6631 12 309 1.50.10.100
4f13B00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Chondroitin AC/alginate lyase 0.6588 29 379 1.50.10.100
4ozwA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Chondroitin AC/alginate lyase 0.6483 89 369 1.50.10.100
ID Description Score Start End GO Terms
AF-A0A4Q3B3C0-F1-model_v4 deleted 0.9934 289 378
AF-A0A7X8GSK7-F1-model_v4 Alginate lyase 0.9885 299 377 GO:0016829
AF-A0A522ANZ4-F1-model_v4 Alginate lyase 0.9861 183 379 GO:0016829
GO:0042597
AF-A0A2V7Q0E8-F1-model_v4 Alginate lyase 0.986 213 379 GO:0016829
GO:0042597
AF-A0A4Q3B3C0-F1-model_v4 deleted 0.9825 289 378

Map