F343994

General Info

Members Datasets Scaffolds Average Seq Length
231 126 462 344

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10591773|Ga0114129_105917732
Length 375
Sequence MNGLSASERSRPDGANQKARAMDRRDALKTLVALFAPSPVVAAAPSVSTLIGTGSAGYSDRQVNNPYGLVIGPDGALYFCDLDNQRIRRFDLRTRRTQTVAGNGQKAYSGDGALATAASLNMPHEIQFDSAGHLYIAERDNHVIRKVDAKTGIISTFAGTGSAGFSGDGGPASSAQLREPHSIAVDPSRRFLLICDIGNHRIRRVGFDTGVIDTFGGTGERQPTTDGAPLRGTPLNGPRTIAFDSAGDLYLALREGNAIYRVDGKSVSLRHVAGTGEQGYSGDGGQARLARLAGPKGLAWWRDSLYVADTENHVIRRIELKTGIIRTVLGTGQRGDGPEPDPRRCALARPHGVLVDSRGVLYVGDSESHRIRTVN

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 4.33
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 16.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10591773 3300009147 Bacteria 1438
2 Ga0065712_10000916 3300005290 Bacteria 25216
3 Ga0065712_10080061 3300005290 Unclassified 3150
4 Ga0065712_10084188 3300005290 Unclassified 2784
5 Ga0065715_10000278 3300005293 Bacteria 24361
6 Ga0065715_10101339 3300005293 Unclassified 3211
7 Ga0070676_10046844 3300005328 Unclassified 2523
8 Ga0070670_100001347 3300005331 Bacteria 19652
9 Ga0070670_100003450 3300005331 Bacteria 13121
10 Ga0070689_100273715 3300005340 Bacteria 1399
11 Ga0070668_100070948 3300005347 Bacteria 2713
12 Ga0070669_100001341 3300005353 Bacteria 17730
13 Ga0070669_100069484 3300005353 Unclassified 2601
14 Ga0070675_100026039 3300005354 Bacteria 4691
15 Ga0070675_100112708 3300005354 Bacteria 2303
16 Ga0070675_100339502 3300005354 Bacteria 1330
17 Ga0070675_100353776 3300005354 Unclassified 1303
18 Ga0070674_100029740 3300005356 Bacteria 3604
19 Ga0070674_100128482 3300005356 Bacteria 1886
20 Ga0070673_100005180 3300005364 Bacteria 8326
21 Ga0070673_100063202 3300005364 Bacteria 2945
22 Ga0070673_100199865 3300005364 Bacteria 1721
23 Ga0070673_100217532 3300005364 Bacteria 1652
24 Ga0070688_100003427 3300005365 Bacteria 8152
25 Ga0070688_100019847 3300005365 Bacteria 3899
26 Ga0070701_10021995 3300005438 Bacteria 3052
27 Ga0070701_10142772 3300005438 Bacteria 1371
28 Ga0070705_100050529 3300005440 Bacteria 2419
29 Ga0070705_100089665 3300005440 Unclassified 1912
30 Ga0070700_100062605 3300005441 Bacteria 2351
31 Ga0070694_100001731 3300005444 Bacteria 12866
32 Ga0070663_100147502 3300005455 Bacteria 1801
33 Ga0070662_100088760 3300005457 Bacteria 2318
34 Ga0070662_100132543 3300005457 Bacteria 1923
35 Ga0070662_100191091 3300005457 Unclassified 1619
36 Ga0068867_100170977 3300005459 Bacteria 1721
37 Ga0068867_100176847 3300005459 Bacteria 1694
38 Ga0070685_10049490 3300005466 Bacteria 2424
39 Ga0070685_10062617 3300005466 Bacteria 2182
40 Ga0070699_100002390 3300005518 Bacteria 16837
41 Ga0070699_100095820 3300005518 Bacteria 2599
42 Ga0070699_100381938 3300005518 Unclassified 1272
43 Ga0070697_100161523 3300005536 Bacteria 1893
44 Ga0070672_100022898 3300005543 Bacteria 4597
45 Ga0070672_100187921 3300005543 Bacteria 1724
46 Ga0070686_100052877 3300005544 Bacteria 2591
47 Ga0070665_100008408 3300005548 Bacteria 10440
48 Ga0070704_100005375 3300005549 Bacteria 7461
49 Ga0070704_100079027 3300005549 Unclassified 2415
50 Ga0070664_100214268 3300005564 Bacteria 1721
51 Ga0068857_100033837 3300005577 Unclassified 4520
52 Ga0070702_100106061 3300005615 Bacteria 1733
53 Ga0068859_100017628 3300005617 Bacteria 7179
54 Ga0068859_100138737 3300005617 Bacteria 2505
55 Ga0068859_100291784 3300005617 Bacteria 1724
56 Ga0068864_100049537 3300005618 Unclassified 3615
57 Ga0068870_10076706 3300005840 Bacteria 1836
58 Ga0068858_100036444 3300005842 Bacteria 4561
59 Ga0068858_100176298 3300005842 Bacteria 2017
60 Ga0068860_100513306 3300005843 Bacteria 1198
61 Ga0068862_100009172 3300005844 Bacteria 8194
62 Ga0068862_100034421 3300005844 Bacteria 4286
63 Ga0068862_100040012 3300005844 Bacteria 3983
64 Ga0068862_100047708 3300005844 Bacteria 3656
65 Ga0075365_10009460 3300006038 Bacteria 5604
66 Ga0075364_10040313 3300006051 Bacteria 3028
67 Ga0075364_10170600 3300006051 Unclassified 1471
68 Ga0075367_10010780 3300006178 Unclassified 4813
69 Ga0075366_10002230 3300006195 Bacteria 9895
70 Ga0075366_10004485 3300006195 Bacteria 7490
71 Ga0097621_100037716 3300006237 Bacteria 3875
72 Ga0075370_10008458 3300006353 Bacteria 5296
73 Ga0068871_100010195 3300006358 Bacteria 6843
74 Ga0075428_100000108 3300006844 Bacteria 70319
75 Ga0075428_100209836 3300006844 Bacteria 2104
76 Ga0075428_100276809 3300006844 Bacteria 1805
77 Ga0075430_100016537 3300006846 Bacteria 6282
78 Ga0075430_100066923 3300006846 Bacteria 3016
79 Ga0075431_100019991 3300006847 Bacteria 6837
80 Ga0075431_100028243 3300006847 Bacteria 5761
81 Ga0075431_100301707 3300006847 Bacteria 1618
82 Ga0075433_10065817 3300006852 Bacteria 3179
83 Ga0075433_10074656 3300006852 Bacteria 2984
84 Ga0075433_10446887 3300006852 Bacteria 1140
85 Ga0075434_100001752 3300006871 Bacteria 18644
86 Ga0075429_100022940 3300006880 Bacteria 5411
87 Ga0075429_100079462 3300006880 Bacteria 2859
88 Ga0075429_100135315 3300006880 Bacteria 2157
89 Ga0075429_100166691 3300006880 Bacteria 1930
90 Ga0075429_100302472 3300006880 Unclassified 1400
91 Ga0075436_100040497 3300006914 Bacteria 3215
92 Ga0097620_100017629 3300006931 Bacteria 7179
93 Ga0097620_100138735 3300006931 Bacteria 2505
94 Ga0097620_100291820 3300006931 Bacteria 1724
95 Ga0075435_100256222 3300007076 Bacteria 1490
96 Ga0111539_10000001 3300009094 Bacteria 1035431
97 Ga0111539_10001097 3300009094 Bacteria 35758
98 Ga0111539_10003911 3300009094 Bacteria 19589
99 Ga0111539_10009320 3300009094 Bacteria 12399
100 Ga0111539_10022759 3300009094 Bacteria 7697
101 Ga0111539_10104118 3300009094 Bacteria 3330
102 Ga0111539_10492268 3300009094 Bacteria 1428
103 Ga0105245_10104739 3300009098 Bacteria 2623
104 Ga0114129_10010669 3300009147 Bacteria 13102
105 Ga0114129_10013860 3300009147 Bacteria 11487
106 Ga0114129_10031425 3300009147 Bacteria 7505
107 Ga0114129_10056996 3300009147 Bacteria 5470
108 Ga0114129_10060399 3300009147 Bacteria 5300
109 Ga0114129_10089650 3300009147 Bacteria 4263
110 Ga0114129_10226388 3300009147 Bacteria 2520
111 Ga0114129_10304073 3300009147 Bacteria 2124
112 Ga0114129_10331911 3300009147 Bacteria 2019
113 Ga0105243_10079997 3300009148 Bacteria 2665
114 Ga0105242_10156922 3300009176 Bacteria 1989
115 Ga0105242_10223815 3300009176 Bacteria 1683
116 Ga0105248_10328748 3300009177 Bacteria 1722
117 Ga0105249_10000452 3300009553 Bacteria 38667
118 Ga0105249_10005293 3300009553 Bacteria 11141
119 Ga0105249_10021294 3300009553 Bacteria 5805
120 Ga0105249_10077462 3300009553 Bacteria 3083
121 Ga0105249_10161187 3300009553 Bacteria 2168
122 Ga0105239_10149876 3300010375 Bacteria 2603
123 Ga0163163_10292972 3300014325 Bacteria 1680
124 Ga0157380_10047782 3300014326 Unclassified 3368
125 Ga0157380_10162949 3300014326 Bacteria 1940
126 Ga0157380_10317711 3300014326 Bacteria 1442
127 Ga0157376_10010734 3300014969 Bacteria 6718
128 Ga0157376_10070056 3300014969 Bacteria 2975
129 Ga0207646_10127598 3300025922 Bacteria 2288
130 Ga0207681_10064785 3300025923 Bacteria 2524
131 Ga0207681_10285115 3300025923 Bacteria 1302
132 Ga0207650_10003316 3300025925 Bacteria 11086
133 Ga0207650_10185303 3300025925 Bacteria 1660
134 Ga0207659_10143925 3300025926 Unclassified 1854
135 Ga0207659_10329431 3300025926 Bacteria 1262
136 Ga0207687_10059054 3300025927 Bacteria 2701
137 Ga0207706_10087642 3300025933 Unclassified 2737
138 Ga0207706_10155743 3300025933 Bacteria 2009
139 Ga0207706_10346423 3300025933 Bacteria 1292
140 Ga0207686_10010996 3300025934 Bacteria 4940
141 Ga0207670_10128462 3300025936 Bacteria 1853
142 Ga0207669_10184642 3300025937 Unclassified 1499
143 Ga0207691_10115173 3300025940 Bacteria 2387
144 Ga0207691_10221897 3300025940 Bacteria 1639
145 Ga0207711_10427310 3300025941 Bacteria 1232
146 Ga0207679_10007102 3300025945 Bacteria 7096
147 Ga0207651_10003189 3300025960 Bacteria 8009
148 Ga0207668_10040796 3300025972 Bacteria 3134
149 Ga0207668_10241005 3300025972 Bacteria 1463
150 Ga0207678_10007430 3300026067 Bacteria 9702
151 Ga0207708_10059309 3300026075 Bacteria 2921
152 Ga0207708_10068697 3300026075 Bacteria 2712
153 Ga0207708_10433859 3300026075 Bacteria 1091
154 Ga0207641_10138771 3300026088 Unclassified 2191
155 Ga0207648_10010620 3300026089 Bacteria 8706
156 Ga0207648_10225719 3300026089 Bacteria 1665
157 Ga0207674_10051708 3300026116 Bacteria 4193
158 Ga0207675_100018579 3300026118 Bacteria 6486
159 Ga0207675_100049693 3300026118 Unclassified 3913
160 Ga0207683_10022516 3300026121 Bacteria 5408
161 Ga0207428_10000002 3300027907 Bacteria 854851
162 Ga0207428_10007177 3300027907 Bacteria 10187
163 Ga0207428_10025185 3300027907 Bacteria 4982
164 Ga0207428_10072516 3300027907 Unclassified 2703
165 Ga0268266_10015531 3300028379 Bacteria 6531
166 Ga0268265_10024867 3300028380 Bacteria 4243
167 Ga0268265_10038737 3300028380 Bacteria 3508
168 Ga0268265_10344526 3300028380 Unclassified 1358
169 Ga0268264_10454552 3300028381 Unclassified 1241
170 Ga0307408_100001432 3300031548 Bacteria 17746
171 Ga0265314_10001266 3300031711 Bacteria 28791
172 Ga0307406_10003775 3300031901 Bacteria 8242
173 Ga0307416_100034969 3300032002 Bacteria 3831
174 Ga0373943_0067996 3300035170 Bacteria 1798
175 Ga0373925_0181109 3300037068 Bacteria 1668
176 Ga0436365_1288767 3300039437 Bacteria 2985
177 Ga0439450_022809 3300042008 Bacteria 1354
178 Ga0451576_0046772 3300045051 Bacteria 4555
179 Ga0451576_0305512 3300045051 Bacteria 1664
180 Ga0495621_0062568 3300046539 Unclassified 1354
181 Ga0495658_0064613 3300046683 Unclassified 2109
182 Ga0496101_0026984 3300048904 Bacteria 3995
183 Ga0496102_0056303 3300048905 Bacteria 3587
184 Ga0496103_0119412 3300048906 Bacteria 1679
185 Ga0496104_0014429 3300048907 Bacteria 7138
186 Ga0496108_0011263 3300048911 Bacteria 7266
187 Ga0496109_0015431 3300048912 Bacteria 6658
188 Ga0496110_0011749 3300048913 Bacteria 7184
189 Ga0496111_0015835 3300048914 Bacteria 5185
190 Ga0496112_0001717 3300048915 Bacteria 17117
191 Ga0496113_0088556 3300048916 Bacteria 2381
192 Ga0501031_0104434 3300049568 Unclassified 1849
193 Ga0501036_0146075 3300049572 Unclassified 1995
194 Ga0501040_0178572 3300049576 Unclassified 1504
195 Ga0501072_0238697 3300049588 Bacteria 1447
196 Ga0501283_006612 3300049779 Bacteria 1629
197 Ga0501045_0102384 3300049824 Unclassified 2120
198 nmdc:mga03683_21666_c1 3300050489 Bacteria 2482
199 nmdc:mga00v17_8832_c1 3300050491 Bacteria 5432
200 nmdc:mga0k408_16335_c1 3300050493 Bacteria 4118
201 nmdc:mga07m45_80894_c1 3300050496 Unclassified 1855
202 nmdc:mga05p37_13967_c1 3300050507 Bacteria 9631
203 nmdc:mga05p37_158225_c1 3300050507 Bacteria 2768
204 nmdc:mga05p37_401744_c1 3300050507 Bacteria 1600
205 nmdc:mga05p37_42303_c1 3300050507 Bacteria 5597
206 nmdc:mga05p37_56868_c1 3300050507 Bacteria 4817
207 nmdc:mga05p37_595119_c1 3300050507 Unclassified 1249
208 nmdc:mga05p37_632410_c1 3300050507 Bacteria 1202
209 nmdc:mga05p37_83072_c1 3300050507 Bacteria 3946
210 nmdc:mga09592_109628_c1 3300050508 Bacteria 2368
211 nmdc:mga09592_197162_c1 3300050508 Bacteria 1743
212 nmdc:mga09592_281119_c1 3300050508 Bacteria 1443
213 nmdc:mga09592_42074_c1 3300050508 Bacteria 3843
214 nmdc:mga09592_65326_c1 3300050508 Bacteria 3082
215 nmdc:mga0qj67_50148_c1 3300050509 Bacteria 3300
216 nmdc:mga0qj67_67339_c1 3300050509 Unclassified 2853
217 nmdc:mga06r32_116257_c1 3300050510 Bacteria 2635
218 nmdc:mga06r32_238367_c1 3300050510 Bacteria 1807
219 nmdc:mga06r32_28811_c1 3300050510 Bacteria 5199
220 nmdc:mga06r32_63906_c1 3300050510 Unclassified 3549
221 nmdc:mga08y16_124720_c1 3300050511 Unclassified 2679
222 nmdc:mga08y16_18719_c1 3300050511 Bacteria 7294
223 nmdc:mga08y16_39875_c1 3300050511 Bacteria 4926
224 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
225 nmdc:mga08y16_56617_c1 3300050511 Bacteria 4097
226 nmdc:mga0n895_395159_c1 3300050512 Bacteria 1399
227 nmdc:mga08x19_103982_c1 3300050514 Bacteria 1887
228 nmdc:mga08x19_59327_c1 3300050514 Unclassified 2477
229 nmdc:mga0a205_141605_c1 3300050515 Bacteria 2305
230 nmdc:mga0a205_86095_c1 3300050515 Bacteria 3035
231 Ga0530510_0324763 3300061734 Unclassified 1154
232 Ga0114129_10591773
233 Ga0065712_10000916
234 Ga0065712_10080061
235 Ga0065712_10084188
236 Ga0065715_10000278
237 Ga0065715_10101339
238 Ga0070676_10046844
239 Ga0070670_100001347
240 Ga0070670_100003450
241 Ga0070689_100273715
242 Ga0070668_100070948
243 Ga0070669_100001341
244 Ga0070669_100069484
245 Ga0070675_100026039
246 Ga0070675_100112708
247 Ga0070675_100339502
248 Ga0070675_100353776
249 Ga0070674_100029740
250 Ga0070674_100128482
251 Ga0070673_100005180
252 Ga0070673_100063202
253 Ga0070673_100199865
254 Ga0070673_100217532
255 Ga0070688_100003427
256 Ga0070688_100019847
257 Ga0070701_10021995
258 Ga0070701_10142772
259 Ga0070705_100050529
260 Ga0070705_100089665
261 Ga0070700_100062605
262 Ga0070694_100001731
263 Ga0070663_100147502
264 Ga0070662_100088760
265 Ga0070662_100132543
266 Ga0070662_100191091
267 Ga0068867_100170977
268 Ga0068867_100176847
269 Ga0070685_10049490
270 Ga0070685_10062617
271 Ga0070699_100002390
272 Ga0070699_100095820
273 Ga0070699_100381938
274 Ga0070697_100161523
275 Ga0070672_100022898
276 Ga0070672_100187921
277 Ga0070686_100052877
278 Ga0070665_100008408
279 Ga0070704_100005375
280 Ga0070704_100079027
281 Ga0070664_100214268
282 Ga0068857_100033837
283 Ga0070702_100106061
284 Ga0068859_100017628
285 Ga0068859_100138737
286 Ga0068859_100291784
287 Ga0068864_100049537
288 Ga0068870_10076706
289 Ga0068858_100036444
290 Ga0068858_100176298
291 Ga0068860_100513306
292 Ga0068862_100009172
293 Ga0068862_100034421
294 Ga0068862_100040012
295 Ga0068862_100047708
296 Ga0075365_10009460
297 Ga0075364_10040313
298 Ga0075364_10170600
299 Ga0075367_10010780
300 Ga0075366_10002230
301 Ga0075366_10004485
302 Ga0097621_100037716
303 Ga0075370_10008458
304 Ga0068871_100010195
305 Ga0075428_100000108
306 Ga0075428_100209836
307 Ga0075428_100276809
308 Ga0075430_100016537
309 Ga0075430_100066923
310 Ga0075431_100019991
311 Ga0075431_100028243
312 Ga0075431_100301707
313 Ga0075433_10065817
314 Ga0075433_10074656
315 Ga0075433_10446887
316 Ga0075434_100001752
317 Ga0075429_100022940
318 Ga0075429_100079462
319 Ga0075429_100135315
320 Ga0075429_100166691
321 Ga0075429_100302472
322 Ga0075436_100040497
323 Ga0097620_100017629
324 Ga0097620_100138735
325 Ga0097620_100291820
326 Ga0075435_100256222
327 Ga0111539_10000001
328 Ga0111539_10001097
329 Ga0111539_10003911
330 Ga0111539_10009320
331 Ga0111539_10022759
332 Ga0111539_10104118
333 Ga0111539_10492268
334 Ga0105245_10104739
335 Ga0114129_10010669
336 Ga0114129_10013860
337 Ga0114129_10031425
338 Ga0114129_10056996
339 Ga0114129_10060399
340 Ga0114129_10089650
341 Ga0114129_10226388
342 Ga0114129_10304073
343 Ga0114129_10331911
344 Ga0105243_10079997
345 Ga0105242_10156922
346 Ga0105242_10223815
347 Ga0105248_10328748
348 Ga0105249_10000452
349 Ga0105249_10005293
350 Ga0105249_10021294
351 Ga0105249_10077462
352 Ga0105249_10161187
353 Ga0105239_10149876
354 Ga0163163_10292972
355 Ga0157380_10047782
356 Ga0157380_10162949
357 Ga0157380_10317711
358 Ga0157376_10010734
359 Ga0157376_10070056
360 Ga0207646_10127598
361 Ga0207681_10064785
362 Ga0207681_10285115
363 Ga0207650_10003316
364 Ga0207650_10185303
365 Ga0207659_10143925
366 Ga0207659_10329431
367 Ga0207687_10059054
368 Ga0207706_10087642
369 Ga0207706_10155743
370 Ga0207706_10346423
371 Ga0207686_10010996
372 Ga0207670_10128462
373 Ga0207669_10184642
374 Ga0207691_10115173
375 Ga0207691_10221897
376 Ga0207711_10427310
377 Ga0207679_10007102
378 Ga0207651_10003189
379 Ga0207668_10040796
380 Ga0207668_10241005
381 Ga0207678_10007430
382 Ga0207708_10059309
383 Ga0207708_10068697
384 Ga0207708_10433859
385 Ga0207641_10138771
386 Ga0207648_10010620
387 Ga0207648_10225719
388 Ga0207674_10051708
389 Ga0207675_100018579
390 Ga0207675_100049693
391 Ga0207683_10022516
392 Ga0207428_10000002
393 Ga0207428_10007177
394 Ga0207428_10025185
395 Ga0207428_10072516
396 Ga0268266_10015531
397 Ga0268265_10024867
398 Ga0268265_10038737
399 Ga0268265_10344526
400 Ga0268264_10454552
401 Ga0307408_100001432
402 Ga0265314_10001266
403 Ga0307406_10003775
404 Ga0307416_100034969
405 Ga0373943_0067996
406 Ga0373925_0181109
407 Ga0436365_1288767
408 Ga0439450_022809
409 Ga0451576_0046772
410 Ga0451576_0305512
411 Ga0495621_0062568
412 Ga0495658_0064613
413 Ga0496101_0026984
414 Ga0496102_0056303
415 Ga0496103_0119412
416 Ga0496104_0014429
417 Ga0496108_0011263
418 Ga0496109_0015431
419 Ga0496110_0011749
420 Ga0496111_0015835
421 Ga0496112_0001717
422 Ga0496113_0088556
423 Ga0501031_0104434
424 Ga0501036_0146075
425 Ga0501040_0178572
426 Ga0501072_0238697
427 Ga0501283_006612
428 Ga0501045_0102384
429 nmdc:mga03683_21666_c1
430 nmdc:mga00v17_8832_c1
431 nmdc:mga0k408_16335_c1
432 nmdc:mga07m45_80894_c1
433 nmdc:mga05p37_13967_c1
434 nmdc:mga05p37_158225_c1
435 nmdc:mga05p37_401744_c1
436 nmdc:mga05p37_42303_c1
437 nmdc:mga05p37_56868_c1
438 nmdc:mga05p37_595119_c1
439 nmdc:mga05p37_632410_c1
440 nmdc:mga05p37_83072_c1
441 nmdc:mga09592_109628_c1
442 nmdc:mga09592_197162_c1
443 nmdc:mga09592_281119_c1
444 nmdc:mga09592_42074_c1
445 nmdc:mga09592_65326_c1
446 nmdc:mga0qj67_50148_c1
447 nmdc:mga0qj67_67339_c1
448 nmdc:mga06r32_116257_c1
449 nmdc:mga06r32_238367_c1
450 nmdc:mga06r32_28811_c1
451 nmdc:mga06r32_63906_c1
452 nmdc:mga08y16_124720_c1
453 nmdc:mga08y16_18719_c1
454 nmdc:mga08y16_39875_c1
455 nmdc:mga08y16_3_c1
456 nmdc:mga08y16_56617_c1
457 nmdc:mga0n895_395159_c1
458 nmdc:mga08x19_103982_c1
459 nmdc:mga08x19_59327_c1
460 nmdc:mga0a205_141605_c1
461 nmdc:mga0a205_86095_c1
462 Ga0530510_0324763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01436

NHL

NHL repeat

347

373

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zcn-assembly1.cif.gz_A crystal structure of nvpizza2-s16s58 0.9 42 136
7djm-assembly1.cif.gz_A structure of four truncated and mutated forms of quenching protein 0.8931 42 339
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8891 42 136
3ww7-assembly1.cif.gz_C crystal structure of the computationally designed pizza2 protein 0.8885 42 125
7djj-assembly1.cif.gz_A structure of four truncated and mutated forms of quenching protein lumenal domains 0.8831 41 339
ID Description Score Start End Superfamily
af_Q8VZ10_784_886_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9348 191 285 2.40.10.500
af_Q8BZW8_223_308_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9242 200 286 2.40.10.500
af_Q8BZW8_223_308_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9041 200 286 2.40.10.500
af_Q66H79_552_654_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9034 47 125 2.40.10.500
af_D3ZLM5_424_559_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8924 212 337 2.40.10.500
ID Description Score Start End GO Terms
AF-A0A3D4FVI4-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9813 26 337
AF-A0A3B9CT00-F1-model_v4 6-bladed beta-propeller 0.9805 216 337
AF-A0A3D4FA55-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9756 27 166
AF-A0A355GHN5-F1-model_v4 ScyD/ScyE family protein 0.9724 27 117
AF-A0A2E8F6D2-F1-model_v4 deleted 0.9681 16 342

Map