F343725

General Info

Members Datasets Scaffolds Average Seq Length
231 148 231 220

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100031096|Ga0070670_1000310963
Length 253
Sequence MSSSRLVIGFLCCMLAACVTHTMDGGKPLKDEDPQVAAAKYNVQLGTAYLQQGNYALARDKLERALKQNSKDPDVHTSLGLLYDRTGDTKGADKHFREALRLAPDKPDISNNYAIYLCKNGRTDEGVERFTAVASNKYYRTPEVALTNAGVCLRSAKRLEEAEKKFAGAIKARPNYTEATVQLASLHLERNEIPQARKVVDTYLNAFKAQPDVLLSAVTVARAAKDRMSEEKYSRALRLEFPDSAQARALKKP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
146 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 3.03
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011393 3300003203 Bacteria 3902
2 rootL2_10084058 3300003322 Bacteria 3277
3 rootL2_10086487 3300003322 Unclassified 1612
4 Ga0070676_10069270 3300005328 Bacteria 2114
5 Ga0070690_100000948 3300005330 Bacteria 14809
6 Ga0070690_100036345 3300005330 Bacteria 3095
7 Ga0070670_100031096 3300005331 Bacteria 4597
8 Ga0068869_100198311 3300005334 Bacteria 1582
9 Ga0068869_100307863 3300005334 Bacteria 1281
10 Ga0070682_100028113 3300005337 Bacteria 3380
11 Ga0070682_100076910 3300005337 Bacteria 2149
12 Ga0070682_100220503 3300005337 Bacteria 1350
13 Ga0068868_100152849 3300005338 Bacteria 1902
14 Ga0068868_100328797 3300005338 Bacteria 1304
15 Ga0070660_100344681 3300005339 Bacteria 1226
16 Ga0070689_100360214 3300005340 Bacteria 1222
17 Ga0070661_100086481 3300005344 Bacteria 2318
18 Ga0070692_10133006 3300005345 Bacteria 1400
19 Ga0070668_100240263 3300005347 Bacteria 1500
20 Ga0070675_100027696 3300005354 Bacteria 4556
21 Ga0070675_100053830 3300005354 Bacteria 3310
22 Ga0070675_100124674 3300005354 Bacteria 2191
23 Ga0070675_100562697 3300005354 Bacteria 1032
24 Ga0070673_100036620 3300005364 Bacteria 3731
25 Ga0070673_100430657 3300005364 Bacteria 1184
26 Ga0070688_100180509 3300005365 Bacteria 1464
27 Ga0070659_100267254 3300005366 Bacteria 1420
28 Ga0070701_10008215 3300005438 Bacteria 4501
29 Ga0070701_10105174 3300005438 Unclassified 1569
30 Ga0070701_10196025 3300005438 Bacteria 1191
31 Ga0070705_100017859 3300005440 Bacteria 3709
32 Ga0070700_100041224 3300005441 Bacteria 2830
33 Ga0070694_100011704 3300005444 Bacteria 5436
34 Ga0070678_100008029 3300005456 Bacteria 6293
35 Ga0068867_100237632 3300005459 Bacteria 1476
36 Ga0068867_100270013 3300005459 Bacteria 1390
37 Ga0070685_10118376 3300005466 Bacteria 1642
38 Ga0070698_100216344 3300005471 Bacteria 1850
39 Ga0070672_100043664 3300005543 Bacteria 3458
40 Ga0070672_100062812 3300005543 Bacteria 2932
41 Ga0070686_100029343 3300005544 Bacteria 3345
42 Ga0070695_100027412 3300005545 Bacteria 3528
43 Ga0070696_100014335 3300005546 Bacteria 5317
44 Ga0070665_100006069 3300005548 Bacteria 12350
45 Ga0070665_100012457 3300005548 Bacteria 8573
46 Ga0070665_100197072 3300005548 Bacteria 2015
47 Ga0070704_100111225 3300005549 Bacteria 2085
48 Ga0070664_100012168 3300005564 Bacteria 6992
49 Ga0068857_100248667 3300005577 Bacteria 1630
50 Ga0070702_100009238 3300005615 Bacteria 4817
51 Ga0068859_100017291 3300005617 Bacteria 7242
52 Ga0068864_100069473 3300005618 Bacteria 3063
53 Ga0068861_100000827 3300005719 Bacteria 18696
54 Ga0068861_100152354 3300005719 Bacteria 1898
55 Ga0068861_100395798 3300005719 Bacteria 1224
56 Ga0068861_100653340 3300005719 Bacteria 972
57 Ga0068870_10006276 3300005840 Bacteria 5235
58 Ga0068863_100147718 3300005841 Bacteria 2249
59 Ga0068860_100006747 3300005843 Bacteria 11513
60 Ga0068860_100188316 3300005843 Bacteria 1996
61 Ga0068862_100025769 3300005844 Bacteria 4938
62 Ga0068862_100168264 3300005844 Bacteria 1961
63 Ga0068862_100305968 3300005844 Bacteria 1464
64 Ga0068862_100333267 3300005844 Bacteria 1404
65 Ga0081455_10000401 3300005937 Bacteria 57163
66 Ga0081539_10000016 3300005985 Bacteria 381648
67 Ga0097621_100013252 3300006237 Bacteria 6137
68 Ga0097621_100045750 3300006237 Bacteria 3536
69 Ga0097621_100138031 3300006237 Bacteria 2081
70 Ga0097621_100146349 3300006237 Bacteria 2023
71 Ga0097621_100627454 3300006237 Bacteria 984
72 Ga0068871_100071359 3300006358 Bacteria 2856
73 Ga0068871_100192560 3300006358 Bacteria 1757
74 Ga0068871_100335382 3300006358 Bacteria 1334
75 Ga0068865_100343345 3300006881 Viruses 1207
76 Ga0097620_100017293 3300006931 Bacteria 7242
77 Ga0105240_10147272 3300009093 Bacteria 2808
78 Ga0105240_10823272 3300009093 Bacteria 1004
79 Ga0111539_10021010 3300009094 Bacteria 8039
80 Ga0105248_10279227 3300009177 Bacteria 1880
81 Ga0105249_10654350 3300009553 Bacteria 1108
82 Ga0105249_10960790 3300009553 Bacteria 922
83 Ga0105239_11027928 3300010375 Unclassified 948
84 Ga0157374_10150459 3300013296 Bacteria 2263
85 Ga0157378_10268726 3300013297 Bacteria 1639
86 Ga0163162_10206878 3300013306 Bacteria 2092
87 Ga0163162_10509641 3300013306 Bacteria 1333
88 Ga0157375_10010670 3300013308 Bacteria 8091
89 Ga0157375_10473623 3300013308 Bacteria 1417
90 Ga0157375_10588969 3300013308 Bacteria 1272
91 Ga0163163_10062604 3300014325 Bacteria 3687
92 Ga0163163_10115349 3300014325 Bacteria 2718
93 Ga0163163_10413043 3300014325 Bacteria 1408
94 Ga0157380_10044786 3300014326 Bacteria 3469
95 Ga0157380_10076802 3300014326 Bacteria 2719
96 Ga0157376_10042495 3300014969 Bacteria 3725
97 Ga0157376_10211365 3300014969 Bacteria 1791
98 Ga0163161_10196663 3300017792 Bacteria 1552
99 Ga0163161_10497860 3300017792 Unclassified 992
100 Ga0207682_10004620 3300025893 Bacteria 5721
101 Ga0207682_10009794 3300025893 Bacteria 3773
102 Ga0207645_10020558 3300025907 Bacteria 4320
103 Ga0207645_10053533 3300025907 Bacteria 2579
104 Ga0207643_10005636 3300025908 Bacteria 6693
105 Ga0207649_10423961 3300025920 Bacteria 1000
106 Ga0207681_10008277 3300025923 Bacteria 6360
107 Ga0207681_10090823 3300025923 Bacteria 2180
108 Ga0207650_10214889 3300025925 Bacteria 1545
109 Ga0207659_10034972 3300025926 Bacteria 3469
110 Ga0207659_10072267 3300025926 Bacteria 2521
111 Ga0207659_10203653 3300025926 Bacteria 1582
112 Ga0207706_10337159 3300025933 Bacteria 1312
113 Ga0207670_10127071 3300025936 Bacteria 1862
114 Ga0207670_10275572 3300025936 Bacteria 1309
115 Ga0207669_10028638 3300025937 Bacteria 3067
116 Ga0207704_10209970 3300025938 Bacteria 1432
117 Ga0207691_10003005 3300025940 Bacteria 16462
118 Ga0207691_10042728 3300025940 Bacteria 4177
119 Ga0207691_10504893 3300025940 Bacteria 1027
120 Ga0207689_10030011 3300025942 Bacteria 4533
121 Ga0207689_10097388 3300025942 Bacteria 2416
122 Ga0207689_10215756 3300025942 Bacteria 1585
123 Ga0207651_10012342 3300025960 Bacteria 4830
124 Ga0207651_10269039 3300025960 Bacteria 1403
125 Ga0207651_10474465 3300025960 Bacteria 1077
126 Ga0207712_10216499 3300025961 Bacteria 1529
127 Ga0207677_10087144 3300026023 Bacteria 2259
128 Ga0207703_10040099 3300026035 Bacteria 3746
129 Ga0207678_10225839 3300026067 Bacteria 1603
130 Ga0207708_10032848 3300026075 Bacteria 3940
131 Ga0207708_10083724 3300026075 Bacteria 2452
132 Ga0207641_10142389 3300026088 Bacteria 2165
133 Ga0207648_10101849 3300026089 Bacteria 2516
134 Ga0207648_10258158 3300026089 Bacteria 1554
135 Ga0207648_10318681 3300026089 Bacteria 1397
136 Ga0207676_10098805 3300026095 Bacteria 2414
137 Ga0207676_10175142 3300026095 Bacteria 1873
138 Ga0207674_10157314 3300026116 Bacteria 2228
139 Ga0207675_100001836 3300026118 Bacteria 21302
140 Ga0207675_100007216 3300026118 Bacteria 10498
141 Ga0207675_100031249 3300026118 Bacteria 4960
142 Ga0207675_100054114 3300026118 Bacteria 3744
143 Ga0207675_100345876 3300026118 Bacteria 1456
144 Ga0207683_10011472 3300026121 Bacteria 7563
145 Ga0207683_10594822 3300026121 Bacteria 1024
146 Ga0268266_10050393 3300028379 Bacteria 3572
147 Ga0268266_10165640 3300028379 Bacteria 2002
148 Ga0268266_10382969 3300028379 Bacteria 1327
149 Ga0268265_10077791 3300028380 Bacteria 2607
150 Ga0268265_10092721 3300028380 Bacteria 2418
151 Ga0268265_10191321 3300028380 Bacteria 1767
152 Ga0268265_10290434 3300028380 Bacteria 1467
153 Ga0268264_10074801 3300028381 Bacteria 2878
154 Ga0268264_10499559 3300028381 Bacteria 1186
155 Ga0268264_10602081 3300028381 Bacteria 1083
156 Ga0307515_10097845 3300028794 Bacteria 3581
157 Ga0307513_10013766 3300031456 Bacteria 9920
158 Ga0307513_10044026 3300031456 Bacteria 4894
159 Ga0307513_10049968 3300031456 Bacteria 4525
160 Ga0307509_10044133 3300031507 Bacteria 4818
161 Ga0307408_100108028 3300031548 Bacteria 2132
162 Ga0307408_100191941 3300031548 Bacteria 1646
163 Ga0307514_10077064 3300031649 Bacteria 2481
164 Ga0307405_10041597 3300031731 Bacteria 2792
165 Ga0307405_10069653 3300031731 Bacteria 2256
166 Ga0307413_10001079 3300031824 Bacteria 9954
167 Ga0307410_10293341 3300031852 Bacteria 1281
168 Ga0307406_10079947 3300031901 Bacteria 2169
169 Ga0307409_100031802 3300031995 Bacteria 3815
170 Ga0307409_100414866 3300031995 Unclassified 1290
171 Ga0307409_100423225 3300031995 Bacteria 1278
172 Ga0307411_10002850 3300032005 Bacteria 7805
173 Ga0307411_10305956 3300032005 Bacteria 1277
174 Ga0373933_0304706 3300035724 Unclassified 1032
175 Ga0373937_0145200 3300036401 Bacteria 2221
176 Ga0373925_0231819 3300037068 Unclassified 1477
177 Ga0436360_0275191 3300039438 Bacteria 1189
178 Ga0436363_0402446 3300039450 Bacteria 5372
179 Ga0451791_0536070 3300041451 Bacteria 5812
180 Ga0451793_1168043 3300041452 Bacteria 1415
181 Ga0451800_0257865 3300041459 Unclassified 1033
182 Ga0451802_1439085 3300041460 Bacteria 1438
183 Ga0451807_0086282 3300041486 Bacteria 2259
184 Ga0451807_0400937 3300041486 Bacteria 2024
185 Ga0451807_2528886 3300041486 Bacteria 3114
186 Ga0495590_0021629 3300046457 Bacteria 2278
187 Ga0495638_0003227 3300046460 Bacteria 12894
188 Ga0495638_0115994 3300046460 Bacteria 1587
189 Ga0495641_0145776 3300046461 Bacteria 1058
190 Ga0495584_0118264 3300046491 Bacteria 1342
191 Ga0495585_0108123 3300046492 Bacteria 1481
192 Ga0495616_0228145 3300046513 Bacteria 808
193 Ga0495620_0029406 3300046515 Bacteria 2543
194 Ga0495625_0006266 3300046660 Bacteria 10644
195 Ga0495625_0028599 3300046660 Bacteria 4179
196 Ga0495671_0050295 3300046692 Bacteria 2075
197 Ga0495649_0008605 3300046694 Bacteria 6128
198 Ga0495649_0070433 3300046694 Bacteria 1875
199 Ga0495589_0084067 3300046794 Bacteria 1547
200 Ga0495589_0091321 3300046794 Bacteria 1479
201 Ga0495686_0234388 3300047472 Bacteria 1038
202 Ga0501039_0056987 3300049575 Bacteria 3027
203 Ga0501042_0368086 3300049578 Bacteria 1040
204 Ga0501067_0016212 3300049583 Bacteria 4118
205 Ga0501068_0007552 3300049584 Bacteria 6017
206 Ga0501068_0076708 3300049584 Bacteria 2046
207 Ga0501070_0003421 3300049586 Bacteria 13764
208 Ga0501071_0006602 3300049587 Bacteria 7537
209 Ga0501072_0217933 3300049588 Bacteria 1521
210 Ga0501073_0026799 3300049589 Bacteria 4126
211 Ga0501073_0057913 3300049589 Bacteria 2709
212 Ga0501074_0004988 3300049590 Bacteria 9522
213 Ga0501076_0023988 3300049592 Bacteria 4709
214 Ga0501077_0001106 3300049593 Bacteria 16260
215 Ga0501079_0005163 3300049741 Bacteria 9708
216 Ga0501080_0003359 3300049742 Bacteria 14131
217 Ga0501081_0047178 3300049743 Bacteria 2964
218 Ga0501083_0022611 3300049744 Bacteria 4362
219 nmdc:mga08y16_167320_c1 3300050511 Bacteria 2284
220 Ga0500583_0054779 3300053092 Archaea 1863
221 Ga0500641_0038638 3300053096 Bacteria 1919
222 Ga0500556_0071535 3300053104 Bacteria 1296
223 Ga0500617_022854 3300053124 Bacteria 2761
224 Ga0500658_0039028 3300053134 Bacteria 1895
225 Ga0500588_0003564 3300053146 Bacteria 3298
226 Ga0500616_0000018 3300053153 Bacteria 610976
227 Ga0500616_0006188 3300053153 Bacteria 7902
228 Ga0500627_0036061 3300053158 Bacteria 2104
229 Ga0500656_013060 3300053732 Bacteria 946
230 Ga0501084_0159568 3300054114 Bacteria 1902
231 Ga0501082_0018675 3300060353 Bacteria 5973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10823272 Ga0105240_108232721 179
2 3300006237 Ga0097621_100013252 Ga0097621_1000132523 186
3 3300041451 Ga0451791_0536070 Ga0451791_0536070_3485_4249 187
4 3300041486 Ga0451807_0400937 Ga0451807_0400937_977_1741 187
5 3300046660 Ga0495625_0006266 Ga0495625_0006266_6059_6814 188
6 3300005337 Ga0070682_100076910 Ga0070682_1000769102 189
7 3300031852 Ga0307410_10293341 Ga0307410_102933412 189
8 3300041452 Ga0451793_1168043 Ga0451793_1168043_173_931 189
9 3300041460 Ga0451802_1439085 Ga0451802_1439085_66_824 189
10 3300041486 Ga0451807_2528886 Ga0451807_2528886_750_1508 189
11 3300031731 Ga0307405_10069653 Ga0307405_100696532 190
12 3300005330 Ga0070690_100000948 Ga0070690_1000009487 191
13 3300005334 Ga0068869_100307863 Ga0068869_1003078632 191
14 3300005338 Ga0068868_100328797 Ga0068868_1003287972 191
15 3300005438 Ga0070701_10008215 Ga0070701_100082153 191
16 3300005440 Ga0070705_100017859 Ga0070705_1000178593 191
17 3300005444 Ga0070694_100011704 Ga0070694_1000117042 191
18 3300005544 Ga0070686_100029343 Ga0070686_1000293433 191
19 3300005545 Ga0070695_100027412 Ga0070695_1000274123 191
20 3300005546 Ga0070696_100014335 Ga0070696_1000143356 191
21 3300005549 Ga0070704_100111225 Ga0070704_1001112252 191
22 3300005615 Ga0070702_100009238 Ga0070702_1000092383 191
23 3300005617 Ga0068859_100017291 Ga0068859_1000172916 191
24 3300005618 Ga0068864_100069473 Ga0068864_1000694732 191
25 3300005841 Ga0068863_100147718 Ga0068863_1001477182 191
26 3300005843 Ga0068860_100006747 Ga0068860_1000067478 191
27 3300005844 Ga0068862_100025769 Ga0068862_1000257692 191
28 3300006931 Ga0097620_100017293 Ga0097620_1000172936 191
29 3300009553 Ga0105249_10654350 Ga0105249_106543501 191
30 3300013306 Ga0163162_10206878 Ga0163162_102068783 191
31 3300013308 Ga0157375_10473623 Ga0157375_104736232 191
32 3300025936 Ga0207670_10275572 Ga0207670_102755722 191
33 3300026035 Ga0207703_10040099 Ga0207703_100400994 191
34 3300026088 Ga0207641_10142389 Ga0207641_101423892 191
35 3300026089 Ga0207648_10258158 Ga0207648_102581582 191
36 3300026118 Ga0207675_100007216 Ga0207675_1000072169 191
37 3300028380 Ga0268265_10092721 Ga0268265_100927212 191
38 3300028381 Ga0268264_10074801 Ga0268264_100748012 191
39 3300031548 Ga0307408_100108028 Ga0307408_1001080282 191
40 3300005330 Ga0070690_100036345 Ga0070690_1000363452 192
41 3300005334 Ga0068869_100198311 Ga0068869_1001983111 192
42 3300005365 Ga0070688_100180509 Ga0070688_1001805092 192
43 3300005441 Ga0070700_100041224 Ga0070700_1000412243 192
44 3300005459 Ga0068867_100237632 Ga0068867_1002376321 192
45 3300005577 Ga0068857_100248667 Ga0068857_1002486672 192
46 3300005719 Ga0068861_100000827 Ga0068861_10000082715 192
47 3300006237 Ga0097621_100138031 Ga0097621_1001380313 192
48 3300006358 Ga0068871_100071359 Ga0068871_1000713592 192
49 3300009177 Ga0105248_10279227 Ga0105248_102792272 192
50 3300013296 Ga0157374_10150459 Ga0157374_101504593 192
51 3300014325 Ga0163163_10413043 Ga0163163_104130432 192
52 3300025933 Ga0207706_10337159 Ga0207706_103371592 192
53 3300025942 Ga0207689_10215756 Ga0207689_102157562 192
54 3300025960 Ga0207651_10269039 Ga0207651_102690391 192
55 3300026075 Ga0207708_10032848 Ga0207708_100328483 192
56 3300026089 Ga0207648_10101849 Ga0207648_101018492 192
57 3300026116 Ga0207674_10157314 Ga0207674_101573142 192
58 3300026118 Ga0207675_100001836 Ga0207675_1000018368 192
59 3300026118 Ga0207675_100345876 Ga0207675_1003458762 192
60 3300014969 Ga0157376_10042495 Ga0157376_100424954 193
61 3300025942 Ga0207689_10030011 Ga0207689_100300115 193
62 3300046492 Ga0495585_0108123 Ga0495585_0108123_300_1061 193
63 3300046794 Ga0495589_0084067 Ga0495589_0084067_490_1245 193
64 3300005347 Ga0070668_100240263 Ga0070668_1002402631 194
65 3300005354 Ga0070675_100027696 Ga0070675_1000276964 194
66 3300005366 Ga0070659_100267254 Ga0070659_1002672542 194
67 3300005438 Ga0070701_10105174 Ga0070701_101051742 194
68 3300005543 Ga0070672_100062812 Ga0070672_1000628123 194
69 3300013297 Ga0157378_10268726 Ga0157378_102687262 194
70 3300025893 Ga0207682_10009794 Ga0207682_100097942 194
71 3300025926 Ga0207659_10072267 Ga0207659_100722672 194
72 3300025940 Ga0207691_10003005 Ga0207691_100030052 194
73 3300031995 Ga0307409_100423225 Ga0307409_1004232251 194
74 3300046460 Ga0495638_0003227 Ga0495638_0003227_2743_3498 194
75 3300046694 Ga0495649_0008605 Ga0495649_0008605_2091_2846 194
76 3300005337 Ga0070682_100220503 Ga0070682_1002205032 195
77 3300005354 Ga0070675_100562697 Ga0070675_1005626972 195
78 3300005548 Ga0070665_100197072 Ga0070665_1001970722 195
79 3300005719 Ga0068861_100395798 Ga0068861_1003957982 195
80 3300013308 Ga0157375_10588969 Ga0157375_105889691 195
81 3300025907 Ga0207645_10020558 Ga0207645_100205585 195
82 3300026118 Ga0207675_100054114 Ga0207675_1000541144 195
83 3300028379 Ga0268266_10165640 Ga0268266_101656402 195
84 3300031456 Ga0307513_10049968 Ga0307513_100499683 195
85 3300031649 Ga0307514_10077064 Ga0307514_100770642 195
86 3300046515 Ga0495620_0029406 Ga0495620_0029406_1496_2251 195
87 3300046794 Ga0495589_0091321 Ga0495589_0091321_670_1425 195
88 3300047472 Ga0495686_0234388 Ga0495686_0234388_257_1012 195
89 3300005338 Ga0068868_100152849 Ga0068868_1001528492 196
90 3300005354 Ga0070675_100053830 Ga0070675_1000538302 196
91 3300005364 Ga0070673_100036620 Ga0070673_1000366203 196
92 3300005456 Ga0070678_100008029 Ga0070678_1000080292 196
93 3300005466 Ga0070685_10118376 Ga0070685_101183762 196
94 3300005543 Ga0070672_100043664 Ga0070672_1000436643 196
95 3300005840 Ga0068870_10006276 Ga0068870_100062764 196
96 3300005844 Ga0068862_100305968 Ga0068862_1003059682 196
97 3300006358 Ga0068871_100335382 Ga0068871_1003353821 196
98 3300006881 Ga0068865_100343345 Ga0068865_1003433452 196
99 3300013306 Ga0163162_10509641 Ga0163162_105096412 196
100 3300013308 Ga0157375_10010670 Ga0157375_100106708 196
101 3300014325 Ga0163163_10115349 Ga0163163_101153492 196
102 3300017792 Ga0163161_10196663 Ga0163161_101966632 196
103 3300025893 Ga0207682_10004620 Ga0207682_100046206 196
104 3300025908 Ga0207643_10005636 Ga0207643_100056363 196
105 3300025923 Ga0207681_10090823 Ga0207681_100908232 196
106 3300025926 Ga0207659_10034972 Ga0207659_100349723 196
107 3300025936 Ga0207670_10127071 Ga0207670_101270712 196
108 3300025937 Ga0207669_10028638 Ga0207669_100286383 196
109 3300025938 Ga0207704_10209970 Ga0207704_102099702 196
110 3300025940 Ga0207691_10042728 Ga0207691_100427283 196
111 3300025940 Ga0207691_10504893 Ga0207691_105048931 196
112 3300025960 Ga0207651_10012342 Ga0207651_100123423 196
113 3300026023 Ga0207677_10087144 Ga0207677_100871443 196
114 3300026095 Ga0207676_10098805 Ga0207676_100988052 196
115 3300026121 Ga0207683_10011472 Ga0207683_100114725 196
116 3300028379 Ga0268266_10382969 Ga0268266_103829692 196
117 3300035724 Ga0373933_0304706 Ga0373933_0304706_18_782 196
118 3300005328 Ga0070676_10069270 Ga0070676_100692702 197
119 3300005339 Ga0070660_100344681 Ga0070660_1003446812 197
120 3300005354 Ga0070675_100124674 Ga0070675_1001246742 197
121 3300005459 Ga0068867_100270013 Ga0068867_1002700131 197
122 3300005843 Ga0068860_100188316 Ga0068860_1001883162 197
123 3300005844 Ga0068862_100168264 Ga0068862_1001682642 197
124 3300005844 Ga0068862_100333267 Ga0068862_1003332672 197
125 3300014326 Ga0157380_10044786 Ga0157380_100447863 197
126 3300025907 Ga0207645_10053533 Ga0207645_100535333 197
127 3300025923 Ga0207681_10008277 Ga0207681_100082772 197
128 3300026067 Ga0207678_10225839 Ga0207678_102258392 197
129 3300026075 Ga0207708_10083724 Ga0207708_100837242 197
130 3300026089 Ga0207648_10318681 Ga0207648_103186812 197
131 3300028380 Ga0268265_10191321 Ga0268265_101913212 197
132 3300028380 Ga0268265_10290434 Ga0268265_102904342 197
133 3300028381 Ga0268264_10499559 Ga0268264_104995592 197
134 3300028794 Ga0307515_10097845 Ga0307515_100978455 197
135 3300031456 Ga0307513_10013766 Ga0307513_100137667 197
136 3300036401 Ga0373937_0145200 Ga0373937_0145200_115_879 197
137 3300037068 Ga0373925_0231819 Ga0373925_0231819_624_1388 197
138 3300046461 Ga0495641_0145776 Ga0495641_0145776_205_969 197
139 3300003322 rootL2_10086487 rootL2_100864871 198
140 3300006237 Ga0097621_100045750 Ga0097621_1000457505 198
141 3300014969 Ga0157376_10211365 Ga0157376_102113652 198
142 3300026121 Ga0207683_10594822 Ga0207683_105948222 198
143 3300049575 Ga0501039_0056987 Ga0501039_0056987_1145_1909 198
144 3300049583 Ga0501067_0016212 Ga0501067_0016212_1398_2162 198
145 3300049584 Ga0501068_0007552 Ga0501068_0007552_1179_1943 198
146 3300049586 Ga0501070_0003421 Ga0501070_0003421_2853_3617 198
147 3300049587 Ga0501071_0006602 Ga0501071_0006602_5045_5809 198
148 3300049588 Ga0501072_0217933 Ga0501072_0217933_457_1221 198
149 3300049589 Ga0501073_0026799 Ga0501073_0026799_1439_2203 198
150 3300049590 Ga0501074_0004988 Ga0501074_0004988_1184_1948 198
151 3300049592 Ga0501076_0023988 Ga0501076_0023988_2606_3370 198
152 3300049593 Ga0501077_0001106 Ga0501077_0001106_15059_15823 198
153 3300049741 Ga0501079_0005163 Ga0501079_0005163_4125_4889 198
154 3300049742 Ga0501080_0003359 Ga0501080_0003359_2443_3207 198
155 3300049743 Ga0501081_0047178 Ga0501081_0047178_1203_1967 198
156 3300049744 Ga0501083_0022611 Ga0501083_0022611_2183_2947 198
157 3300054114 Ga0501084_0159568 Ga0501084_0159568_926_1690 198
158 3300060353 Ga0501082_0018675 Ga0501082_0018675_4799_5563 198
159 3300005340 Ga0070689_100360214 Ga0070689_1003602142 199
160 3300005548 Ga0070665_100006069 Ga0070665_1000060698 199
161 3300005719 Ga0068861_100152354 Ga0068861_1001523542 199
162 3300009094 Ga0111539_10021010 Ga0111539_100210103 199
163 3300026118 Ga0207675_100031249 Ga0207675_1000312493 199
164 3300028379 Ga0268266_10050393 Ga0268266_100503935 199
165 3300031995 Ga0307409_100414866 Ga0307409_1004148662 199
166 3300041459 Ga0451800_0257865 Ga0451800_0257865_229_828 199
167 3300046457 Ga0495590_0021629 Ga0495590_0021629_321_1079 199
168 3300046491 Ga0495584_0118264 Ga0495584_0118264_167_925 199
169 3300046513 Ga0495616_0228145 Ga0495616_0228145_24_782 199
170 3300046694 Ga0495649_0070433 Ga0495649_0070433_243_1001 199
171 3300050511 nmdc:mga08y16_167320_c1 nmdc:mga08y16_167320_c1_1218_1991 199
172 3300005438 Ga0070701_10196025 Ga0070701_101960251 200
173 3300025942 Ga0207689_10097388 Ga0207689_100973883 200
174 3300005337 Ga0070682_100028113 Ga0070682_1000281133 201
175 3300031456 Ga0307513_10044026 Ga0307513_100440263 201
176 3300014326 Ga0157380_10076802 Ga0157380_100768022 202
177 3300031548 Ga0307408_100191941 Ga0307408_1001919412 202
178 3300031731 Ga0307405_10041597 Ga0307405_100415971 202
179 3300031824 Ga0307413_10001079 Ga0307413_100010792 202
180 3300031901 Ga0307406_10079947 Ga0307406_100799473 202
181 3300032005 Ga0307411_10002850 Ga0307411_100028506 202
182 3300031507 Ga0307509_10044133 Ga0307509_100441333 203
183 3300009553 Ga0105249_10960790 Ga0105249_109607901 205
184 3300049584 Ga0501068_0076708 Ga0501068_0076708_1044_1787 209
185 3300049589 Ga0501073_0057913 Ga0501073_0057913_1108_1851 209
186 3300003322 rootL2_10084058 rootL2_100840581 212
187 3300005345 Ga0070692_10133006 Ga0070692_101330062 215
188 3300039438 Ga0436360_0275191 Ga0436360_0275191_269_943 221
189 3300046660 Ga0495625_0028599 Ga0495625_0028599_488_1243 227
190 3300009093 Ga0105240_10147272 Ga0105240_101472722 228
191 3300010375 Ga0105239_11027928 Ga0105239_110279282 228
192 3300039450 Ga0436363_0402446 Ga0436363_0402446_170_907 229
193 3300005719 Ga0068861_100653340 Ga0068861_1006533402 231
194 3300025961 Ga0207712_10216499 Ga0207712_102164991 233
195 3300006237 Ga0097621_100146349 Ga0097621_1001463492 235
196 3300006358 Ga0068871_100192560 Ga0068871_1001925602 235
197 3300005331 Ga0070670_100031096 Ga0070670_1000310963 236
198 3300005344 Ga0070661_100086481 Ga0070661_1000864812 236
199 3300005364 Ga0070673_100430657 Ga0070673_1004306572 236
200 3300005564 Ga0070664_100012168 Ga0070664_1000121682 236
201 3300014325 Ga0163163_10062604 Ga0163163_100626042 236
202 3300025920 Ga0207649_10423961 Ga0207649_104239612 236
203 3300025925 Ga0207650_10214889 Ga0207650_102148892 236
204 3300025926 Ga0207659_10203653 Ga0207659_102036532 236
205 3300025960 Ga0207651_10474465 Ga0207651_104744651 236
206 3300026095 Ga0207676_10175142 Ga0207676_101751422 236
207 3300046692 Ga0495671_0050295 Ga0495671_0050295_629_1387 236
208 3300017792 Ga0163161_10497860 Ga0163161_104978602 237
209 3300031995 Ga0307409_100031802 Ga0307409_1000318025 237
210 3300032005 Ga0307411_10305956 Ga0307411_103059562 237
211 3300049578 Ga0501042_0368086 Ga0501042_0368086_171_935 237
212 3300005471 Ga0070698_100216344 Ga0070698_1002163442 238
213 3300041486 Ga0451807_0086282 Ga0451807_0086282_1219_1980 238
214 3300053153 Ga0500616_0000018 Ga0500616_0000018_31439_32239 238
215 3300005937 Ga0081455_10000401 Ga0081455_1000040132 239
216 3300005548 Ga0070665_100012457 Ga0070665_1000124576 242
217 3300028380 Ga0268265_10077791 Ga0268265_100777913 242
218 3300053153 Ga0500616_0006188 Ga0500616_0006188_1814_2629 242
219 3300006237 Ga0097621_100627454 Ga0097621_1006274542 243
220 3300028381 Ga0268264_10602081 Ga0268264_106020812 243
221 3300053092 Ga0500583_0054779 Ga0500583_0054779_878_1666 243
222 3300053096 Ga0500641_0038638 Ga0500641_0038638_818_1606 243
223 3300053104 Ga0500556_0071535 Ga0500556_0071535_192_980 243
224 3300053124 Ga0500617_022854 Ga0500617_022854_1882_2670 243
225 3300053134 Ga0500658_0039028 Ga0500658_0039028_586_1374 243
226 3300053146 Ga0500588_0003564 Ga0500588_0003564_172_960 243
227 3300053158 Ga0500627_0036061 Ga0500627_0036061_210_998 243
228 3300053732 Ga0500656_013060 Ga0500656_013060_37_825 243
229 3300003203 JGI25406J46586_10011393 JGI25406J46586_100113934 244
230 3300005985 Ga0081539_10000016 Ga0081539_10000016246 244
231 3300046460 Ga0495638_0115994 Ga0495638_0115994_423_1229 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13432

TPR_16

Tetratricopeptide repeat

43

107

0.97

PF13414

TPR_11

TPR repeat

46

87

0.95

PF14559

TPR_19

Tetratricopeptide repeat

153

217

0.94

PF13181

TPR_8

Tetratricopeptide repeat

73

106

0.93

PF13176

TPR_7

Tetratricopeptide repeat

75

110

0.93

PF13174

TPR_6

Tetratricopeptide repeat

43

72

0.92

PF13181

TPR_8

Tetratricopeptide repeat

39

72

0.91

PF07719

TPR_2

Tetratricopeptide repeat

39

72

0.9

PF13424

TPR_12

Tetratricopeptide repeat

35

105

0.88

PF13432

TPR_16

Tetratricopeptide repeat

113

177

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9403 27 93
2kc7-assembly1.cif.gz_A solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218 0.9296 100 178
5fzq-assembly1.cif.gz_B designed tpr protein m4n 0.9186 25 120
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9146 27 93
7obi-assembly2.cif.gz_B consensus tetratricopeptide repeat protein type rv4 0.9026 25 158
ID Description Score Start End Superfamily
5fzqB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9186 25 120 1.25.40.10
af_Q57711_237_338_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9179 30 124 1.25.40.10
3pe4A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.911 60 163 1.25.40.10
af_F1R498_263_378_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9102 11 124 1.25.40.10
af_Q10E52_455_569_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9089 12 120 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q3WYJ0-F1-model_v4 deleted 0.9566 22 237
AF-A0A534DK25-F1-model_v4 deleted 0.9468 44 244
AF-A0A534DK25-F1-model_v4 deleted 0.9333 44 244
AF-A0A7G3FBH4-F1-model_v4 deleted 0.9307 22 236
AF-A0A0F9EJM1-F1-model_v4 Uncharacterized protein 0.93 22 235

Feature Viewer

pLDDT pTM Quality
92.11 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map