F343106

General Info

Members Datasets Scaffolds Average Seq Length
230 131 460 350

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10166886|Ga0207708_101668861
Length 404
Sequence MDSETGNRFLDRTHPKIPRGVRKRAGPWTRLLELIFGGWEQLMKKLITFLSICTTVAILALPVAARNFIAQPDTAFQDAACADEAKEALYASFLKNRAAEKPEDQAKAYDDAKKYLACPTTGITEAQQKIVDYLKKWSAKYEEITRASRFLDLLYNQKKYPEAYALGKEILAAQPDNLKVMIDLGANGYLVLPLNNAALSAEALQHAKNALAALDSGKTVQDWKPLPSKDVAVAYLNYSIGTLTLQSEPANALKFLLKAAQFETPLKKSPFTYAYIAGAYETGPYAQMSEEYKRLHGGKDETPESKLMLANINQLIDRMIDGYARAVALAGNDANFAQPKAVWQDSLTTWYKYQHKGEVTGMDQLVAGILSKPLPPEPTPLTSLPTTTPATKPAGAKPDRPRNR

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
121 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 3.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 28.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10166886 3300026075 Unclassified 1741
2 JGI24751J29686_10000036 3300002459 Bacteria 82067
3 JGI24751J29686_10000038 3300002459 Bacteria 80932
4 JGI25406J46586_10001090 3300003203 Bacteria 12737
5 rootL2_10208091 3300003322 Bacteria 2200
6 Ga0065714_10064462 3300005288 Bacteria 66145
7 Ga0065704_10073062 3300005289 Bacteria 7621
8 Ga0065712_10000135 3300005290 Bacteria 66145
9 Ga0065712_10083149 3300005290 Bacteria 2858
10 Ga0065715_10089247 3300005293 Bacteria 11943
11 Ga0065707_10001654 3300005295 Bacteria 5884
12 Ga0070676_10049775 3300005328 Bacteria 2454
13 Ga0070670_100000073 3300005331 Bacteria 98443
14 Ga0070670_100047872 3300005331 Bacteria 3680
15 Ga0070670_100098367 3300005331 Unclassified 2517
16 Ga0070680_100000581 3300005336 Bacteria 25209
17 Ga0070689_100000265 3300005340 Bacteria 30142
18 Ga0070689_100266976 3300005340 Unclassified 1416
19 Ga0070692_10002636 3300005345 Bacteria 7007
20 Ga0070692_10022455 3300005345 Bacteria 3082
21 Ga0070673_100086395 3300005364 Bacteria 2555
22 Ga0070701_10049694 3300005438 Bacteria 2169
23 Ga0070705_100003949 3300005440 Bacteria 7252
24 Ga0070700_100118314 3300005441 Unclassified 1772
25 Ga0070694_100002351 3300005444 Bacteria 11176
26 Ga0070694_100035762 3300005444 Bacteria 3286
27 Ga0070694_100064090 3300005444 Bacteria 2515
28 Ga0070694_100107483 3300005444 Bacteria 1983
29 Ga0070681_10002274 3300005458 Bacteria 17541
30 Ga0070681_10020998 3300005458 Bacteria 6542
31 Ga0070681_10057353 3300005458 Unclassified 3874
32 Ga0068867_100088155 3300005459 Bacteria 2351
33 Ga0070706_100000015 3300005467 Bacteria 188425
34 Ga0070707_100004566 3300005468 Bacteria 12961
35 Ga0070698_100003969 3300005471 Bacteria 16281
36 Ga0070698_100010224 3300005471 Bacteria 10023
37 Ga0070679_100000760 3300005530 Bacteria 27944
38 Ga0070697_100002436 3300005536 Bacteria 14317
39 Ga0070697_100053936 3300005536 Bacteria 3268
40 Ga0070697_100054682 3300005536 Unclassified 3245
41 Ga0068853_100061101 3300005539 Bacteria 3259
42 Ga0068853_100329283 3300005539 Unclassified 1417
43 Ga0070672_100155936 3300005543 Unclassified 1891
44 Ga0070696_100042397 3300005546 Bacteria 3146
45 Ga0070696_100045379 3300005546 Bacteria 3045
46 Ga0070696_100063149 3300005546 Bacteria 2593
47 Ga0070693_100002472 3300005547 Bacteria 8516
48 Ga0070693_100010904 3300005547 Bacteria 4564
49 Ga0070693_100032104 3300005547 Unclassified 2884
50 Ga0070693_100109311 3300005547 Unclassified 1698
51 Ga0070704_100042136 3300005549 Bacteria 3156
52 Ga0068855_100466475 3300005563 Unclassified 1376
53 Ga0070664_100158299 3300005564 Unclassified 2002
54 Ga0070664_100218009 3300005564 Unclassified 1707
55 Ga0068857_100019382 3300005577 Bacteria 5972
56 Ga0068857_100228383 3300005577 Bacteria 1702
57 Ga0068857_100254481 3300005577 Unclassified 1610
58 Ga0068854_100069966 3300005578 Bacteria 2564
59 Ga0068854_100087646 3300005578 Unclassified 2310
60 Ga0068856_100141404 3300005614 Unclassified 2414
61 Ga0070702_100025036 3300005615 Unclassified 3192
62 Ga0070702_100274488 3300005615 Unclassified 1154
63 Ga0068859_100073602 3300005617 Unclassified 3455
64 Ga0068859_100127249 3300005617 Bacteria 2617
65 Ga0068859_100129866 3300005617 Bacteria 2591
66 Ga0068859_100158285 3300005617 Bacteria 2343
67 Ga0068859_100165429 3300005617 Unclassified 2292
68 Ga0068859_100198306 3300005617 Bacteria 2091
69 Ga0068864_100008029 3300005618 Bacteria 8707
70 Ga0068864_100057474 3300005618 Bacteria 3361
71 Ga0068864_100066855 3300005618 Bacteria 3121
72 Ga0068864_100186033 3300005618 Unclassified 1901
73 Ga0068861_100000514 3300005719 Bacteria 22601
74 Ga0068861_100162612 3300005719 Bacteria 1843
75 Ga0068861_100200951 3300005719 Bacteria 1673
76 Ga0068870_10024354 3300005840 Unclassified 2994
77 Ga0068863_100021508 3300005841 Bacteria 6155
78 Ga0068863_100166537 3300005841 Unclassified 2113
79 Ga0068863_100223561 3300005841 Bacteria 1814
80 Ga0068858_100180371 3300005842 Bacteria 1994
81 Ga0068860_100014660 3300005843 Bacteria 7670
82 Ga0068860_100060652 3300005843 Unclassified 3595
83 Ga0068860_100169154 3300005843 Bacteria 2111
84 Ga0068862_100283315 3300005844 Bacteria 1519
85 Ga0081539_10000487 3300005985 Bacteria 83994
86 Ga0097621_100028282 3300006237 Unclassified 4419
87 Ga0097621_100192587 3300006237 Bacteria 1766
88 Ga0068871_100011587 3300006358 Bacteria 6471
89 Ga0075428_100165585 3300006844 Unclassified 2398
90 Ga0075433_10018047 3300006852 Bacteria 5857
91 Ga0075433_10028459 3300006852 Bacteria 4750
92 Ga0075433_10033575 3300006852 Unclassified 4400
93 Ga0075433_10036939 3300006852 Bacteria 4211
94 Ga0075434_100035258 3300006871 Bacteria 4945
95 Ga0068865_100184395 3300006881 Bacteria 1609
96 Ga0075436_100012432 3300006914 Bacteria 5835
97 Ga0097620_100073602 3300006931 Unclassified 3455
98 Ga0097620_100127250 3300006931 Bacteria 2617
99 Ga0097620_100129862 3300006931 Bacteria 2591
100 Ga0097620_100158282 3300006931 Bacteria 2343
101 Ga0097620_100165427 3300006931 Unclassified 2292
102 Ga0097620_100198320 3300006931 Bacteria 2091
103 Ga0075435_100013468 3300007076 Bacteria 6085
104 Ga0111539_10007397 3300009094 Bacteria 14067
105 Ga0111539_10030469 3300009094 Bacteria 6557
106 Ga0105247_10012582 3300009101 Bacteria 5082
107 Ga0114129_10032306 3300009147 Bacteria 7398
108 Ga0105243_10033440 3300009148 Bacteria 3977
109 Ga0105243_10078811 3300009148 Bacteria 2683
110 Ga0105241_10050752 3300009174 Unclassified 3162
111 Ga0105241_10051994 3300009174 Unclassified 3126
112 Ga0105241_10159868 3300009174 Bacteria 1851
113 Ga0105242_10132318 3300009176 Bacteria 2155
114 Ga0105248_10031269 3300009177 Bacteria 5949
115 Ga0105248_10067596 3300009177 Unclassified 4012
116 Ga0105237_10002017 3300009545 Bacteria 25829
117 Ga0105237_10016553 3300009545 Bacteria 7661
118 Ga0105237_10030874 3300009545 Bacteria 5437
119 Ga0105238_10003575 3300009551 Bacteria 15496
120 Ga0105238_10004842 3300009551 Bacteria 13317
121 Ga0105238_10246170 3300009551 Bacteria 1766
122 Ga0105249_10054390 3300009553 Bacteria 3661
123 Ga0105249_10092763 3300009553 Bacteria 2827
124 Ga0105239_10173190 3300010375 Bacteria 2414
125 Ga0105246_10037337 3300011119 Bacteria 3260
126 Ga0105246_10044264 3300011119 Unclassified 3024
127 Ga0157373_10001035 3300013100 Bacteria 21421
128 Ga0157373_10061394 3300013100 Bacteria 2662
129 Ga0157378_10013247 3300013297 Bacteria 7210
130 Ga0157378_10215621 3300013297 Bacteria 1822
131 Ga0163162_10017537 3300013306 Bacteria 7006
132 Ga0157372_10034303 3300013307 Bacteria 5578
133 Ga0157372_10089377 3300013307 Bacteria 3499
134 Ga0157375_10132758 3300013308 Unclassified 2611
135 Ga0163163_10000466 3300014325 Bacteria 36943
136 Ga0163163_10007873 3300014325 Bacteria 9417
137 Ga0163163_10057725 3300014325 Unclassified 3838
138 Ga0163163_10150586 3300014325 Bacteria 2370
139 Ga0163163_10284994 3300014325 Bacteria 1704
140 Ga0157380_10161337 3300014326 Unclassified 1949
141 Ga0157377_10046078 3300014745 Archaea 2437
142 Ga0157377_10059880 3300014745 Bacteria 2172
143 Ga0182007_10012446 3300015262 Bacteria 3271
144 Ga0206352_10962607 3300020078 Unclassified 1457
145 Ga0207710_10004058 3300025900 Bacteria 6442
146 Ga0207647_10001179 3300025904 Bacteria 20116
147 Ga0207647_10100599 3300025904 Bacteria 1716
148 Ga0207645_10048455 3300025907 Unclassified 2713
149 Ga0207643_10006411 3300025908 Bacteria 6300
150 Ga0207643_10029881 3300025908 Unclassified 3031
151 Ga0207643_10079411 3300025908 Bacteria 1899
152 Ga0207643_10163231 3300025908 Bacteria 1341
153 Ga0207684_10000083 3300025910 Bacteria 176092
154 Ga0207707_10000012 3300025912 Bacteria 280486
155 Ga0207707_10037709 3300025912 Bacteria 4223
156 Ga0207671_10002100 3300025914 Bacteria 21784
157 Ga0207660_10098754 3300025917 Unclassified 2178
158 Ga0207652_10000178 3300025921 Bacteria 67478
159 Ga0207646_10244174 3300025922 Bacteria 1622
160 Ga0207681_10107036 3300025923 Bacteria 2027
161 Ga0207694_10077235 3300025924 Bacteria 2609
162 Ga0207650_10000006 3300025925 Bacteria 544730
163 Ga0207650_10038132 3300025925 Bacteria 3507
164 Ga0207709_10067762 3300025935 Unclassified 2254
165 Ga0207670_10000716 3300025936 Bacteria 17529
166 Ga0207711_10012382 3300025941 Bacteria 7090
167 Ga0207711_10028881 3300025941 Bacteria 4672
168 Ga0207711_10270106 3300025941 Unclassified 1564
169 Ga0207689_10070956 3300025942 Unclassified 2861
170 Ga0207689_10131683 3300025942 Bacteria 2058
171 Ga0207679_10151261 3300025945 Unclassified 1889
172 Ga0207679_10195685 3300025945 Unclassified 1685
173 Ga0207667_10277898 3300025949 Bacteria 1711
174 Ga0207667_10391090 3300025949 Unclassified 1416
175 Ga0207651_10089534 3300025960 Bacteria 2247
176 Ga0207703_10129983 3300026035 Bacteria 2174
177 Ga0207639_10017590 3300026041 Bacteria 5069
178 Ga0207639_10036652 3300026041 Bacteria 3636
179 Ga0207708_10000016 3300026075 Bacteria 193989
180 Ga0207708_10075671 3300026075 Unclassified 2582
181 Ga0207708_10107053 3300026075 Bacteria 2168
182 Ga0207702_10112507 3300026078 Bacteria 2423
183 Ga0207648_10054126 3300026089 Unclassified 3506
184 Ga0207676_10030578 3300026095 Bacteria 4043
185 Ga0207676_10111087 3300026095 Bacteria 2294
186 Ga0207676_10131798 3300026095 Unclassified 2126
187 Ga0207674_10039497 3300026116 Bacteria 4891
188 Ga0207674_10057726 3300026116 Bacteria 3934
189 Ga0207674_10225721 3300026116 Bacteria 1821
190 Ga0207675_100003956 3300026118 Bacteria 14376
191 Ga0207675_100108083 3300026118 Bacteria 2623
192 Ga0207675_100205799 3300026118 Bacteria 1891
193 Ga0207428_10009209 3300027907 Bacteria 8870
194 Ga0268265_10069939 3300028380 Bacteria 2728
195 Ga0268265_10073504 3300028380 Bacteria 2670
196 Ga0268264_10023431 3300028381 Bacteria 5036
197 Ga0268264_10039075 3300028381 Bacteria 3920
198 Ga0268264_10089905 3300028381 Unclassified 2645
199 Ga0307416_100305053 3300032002 Bacteria 1585
200 Ga0307415_100002022 3300032126 Bacteria 9989
201 Ga0307415_100129741 3300032126 Bacteria 1906
202 Ga0373941_0018999 3300035115 Unclassified 1906
203 Ga0373942_0005282 3300035207 Unclassified 2994
204 Ga0395900_0336911 3300037418 Archaea 1485
205 Ga0395898_0080473 3300037466 Unclassified 3142
206 Ga0395898_0238393 3300037466 Bacteria 1735
207 Ga0496102_0010368 3300048905 Bacteria 8016
208 Ga0496112_0028036 3300048915 Bacteria 5433
209 Ga0496112_0365861 3300048915 Bacteria 1384
210 Ga0496113_0120832 3300048916 Bacteria 2048
211 Ga0501325_001376 3300049541 Unclassified 1479
212 Ga0501336_000840 3300049552 Unclassified 1681
213 Ga0501340_000672 3300049556 Unclassified 1614
214 Ga0501216_001793 3300049660 Unclassified 2953
215 Ga0501227_002471 3300049665 Bacteria 4078
216 Ga0501227_002923 3300049665 Unclassified 3738
217 nmdc:mga05p37_56048_c1 3300050507 Unclassified 4852
218 nmdc:mga05p37_63520_c1 3300050507 Unclassified 4544
219 nmdc:mga08y16_183063_c1 3300050511 Bacteria 2175
220 nmdc:mga08y16_236044_c1 3300050511 Unclassified 1891
221 nmdc:mga0n895_92605_c1 3300050512 Viruses 3026
222 nmdc:mga0rr50_62208_c1 3300050513 Bacteria 2815
223 nmdc:mga08x19_9425_c1 3300050514 Bacteria 5847
224 nmdc:mga0a205_108548_c1 3300050515 Unclassified 2674
225 nmdc:mga0a205_2253_c1 3300050515 Bacteria 17000
226 nmdc:mga0a205_36987_c1 3300050515 Unclassified 4693
227 Ga0587073_0016622 3300059492 Unclassified 1345
228 Ga0587077_012186 3300059493 Unclassified 1369
229 Ga0587128_007090 3300059630 Unclassified 1403
230 Ga0587076_010228 3300059645 Bacteria 1351
231 Ga0207708_10166886
232 JGI24751J29686_10000036
233 JGI24751J29686_10000038
234 JGI25406J46586_10001090
235 rootL2_10208091
236 Ga0065714_10064462
237 Ga0065704_10073062
238 Ga0065712_10000135
239 Ga0065712_10083149
240 Ga0065715_10089247
241 Ga0065707_10001654
242 Ga0070676_10049775
243 Ga0070670_100000073
244 Ga0070670_100047872
245 Ga0070670_100098367
246 Ga0070680_100000581
247 Ga0070689_100000265
248 Ga0070689_100266976
249 Ga0070692_10002636
250 Ga0070692_10022455
251 Ga0070673_100086395
252 Ga0070701_10049694
253 Ga0070705_100003949
254 Ga0070700_100118314
255 Ga0070694_100002351
256 Ga0070694_100035762
257 Ga0070694_100064090
258 Ga0070694_100107483
259 Ga0070681_10002274
260 Ga0070681_10020998
261 Ga0070681_10057353
262 Ga0068867_100088155
263 Ga0070706_100000015
264 Ga0070707_100004566
265 Ga0070698_100003969
266 Ga0070698_100010224
267 Ga0070679_100000760
268 Ga0070697_100002436
269 Ga0070697_100053936
270 Ga0070697_100054682
271 Ga0068853_100061101
272 Ga0068853_100329283
273 Ga0070672_100155936
274 Ga0070696_100042397
275 Ga0070696_100045379
276 Ga0070696_100063149
277 Ga0070693_100002472
278 Ga0070693_100010904
279 Ga0070693_100032104
280 Ga0070693_100109311
281 Ga0070704_100042136
282 Ga0068855_100466475
283 Ga0070664_100158299
284 Ga0070664_100218009
285 Ga0068857_100019382
286 Ga0068857_100228383
287 Ga0068857_100254481
288 Ga0068854_100069966
289 Ga0068854_100087646
290 Ga0068856_100141404
291 Ga0070702_100025036
292 Ga0070702_100274488
293 Ga0068859_100073602
294 Ga0068859_100127249
295 Ga0068859_100129866
296 Ga0068859_100158285
297 Ga0068859_100165429
298 Ga0068859_100198306
299 Ga0068864_100008029
300 Ga0068864_100057474
301 Ga0068864_100066855
302 Ga0068864_100186033
303 Ga0068861_100000514
304 Ga0068861_100162612
305 Ga0068861_100200951
306 Ga0068870_10024354
307 Ga0068863_100021508
308 Ga0068863_100166537
309 Ga0068863_100223561
310 Ga0068858_100180371
311 Ga0068860_100014660
312 Ga0068860_100060652
313 Ga0068860_100169154
314 Ga0068862_100283315
315 Ga0081539_10000487
316 Ga0097621_100028282
317 Ga0097621_100192587
318 Ga0068871_100011587
319 Ga0075428_100165585
320 Ga0075433_10018047
321 Ga0075433_10028459
322 Ga0075433_10033575
323 Ga0075433_10036939
324 Ga0075434_100035258
325 Ga0068865_100184395
326 Ga0075436_100012432
327 Ga0097620_100073602
328 Ga0097620_100127250
329 Ga0097620_100129862
330 Ga0097620_100158282
331 Ga0097620_100165427
332 Ga0097620_100198320
333 Ga0075435_100013468
334 Ga0111539_10007397
335 Ga0111539_10030469
336 Ga0105247_10012582
337 Ga0114129_10032306
338 Ga0105243_10033440
339 Ga0105243_10078811
340 Ga0105241_10050752
341 Ga0105241_10051994
342 Ga0105241_10159868
343 Ga0105242_10132318
344 Ga0105248_10031269
345 Ga0105248_10067596
346 Ga0105237_10002017
347 Ga0105237_10016553
348 Ga0105237_10030874
349 Ga0105238_10003575
350 Ga0105238_10004842
351 Ga0105238_10246170
352 Ga0105249_10054390
353 Ga0105249_10092763
354 Ga0105239_10173190
355 Ga0105246_10037337
356 Ga0105246_10044264
357 Ga0157373_10001035
358 Ga0157373_10061394
359 Ga0157378_10013247
360 Ga0157378_10215621
361 Ga0163162_10017537
362 Ga0157372_10034303
363 Ga0157372_10089377
364 Ga0157375_10132758
365 Ga0163163_10000466
366 Ga0163163_10007873
367 Ga0163163_10057725
368 Ga0163163_10150586
369 Ga0163163_10284994
370 Ga0157380_10161337
371 Ga0157377_10046078
372 Ga0157377_10059880
373 Ga0182007_10012446
374 Ga0206352_10962607
375 Ga0207710_10004058
376 Ga0207647_10001179
377 Ga0207647_10100599
378 Ga0207645_10048455
379 Ga0207643_10006411
380 Ga0207643_10029881
381 Ga0207643_10079411
382 Ga0207643_10163231
383 Ga0207684_10000083
384 Ga0207707_10000012
385 Ga0207707_10037709
386 Ga0207671_10002100
387 Ga0207660_10098754
388 Ga0207652_10000178
389 Ga0207646_10244174
390 Ga0207681_10107036
391 Ga0207694_10077235
392 Ga0207650_10000006
393 Ga0207650_10038132
394 Ga0207709_10067762
395 Ga0207670_10000716
396 Ga0207711_10012382
397 Ga0207711_10028881
398 Ga0207711_10270106
399 Ga0207689_10070956
400 Ga0207689_10131683
401 Ga0207679_10151261
402 Ga0207679_10195685
403 Ga0207667_10277898
404 Ga0207667_10391090
405 Ga0207651_10089534
406 Ga0207703_10129983
407 Ga0207639_10017590
408 Ga0207639_10036652
409 Ga0207708_10000016
410 Ga0207708_10075671
411 Ga0207708_10107053
412 Ga0207702_10112507
413 Ga0207648_10054126
414 Ga0207676_10030578
415 Ga0207676_10111087
416 Ga0207676_10131798
417 Ga0207674_10039497
418 Ga0207674_10057726
419 Ga0207674_10225721
420 Ga0207675_100003956
421 Ga0207675_100108083
422 Ga0207675_100205799
423 Ga0207428_10009209
424 Ga0268265_10069939
425 Ga0268265_10073504
426 Ga0268264_10023431
427 Ga0268264_10039075
428 Ga0268264_10089905
429 Ga0307416_100305053
430 Ga0307415_100002022
431 Ga0307415_100129741
432 Ga0373941_0018999
433 Ga0373942_0005282
434 Ga0395900_0336911
435 Ga0395898_0080473
436 Ga0395898_0238393
437 Ga0496102_0010368
438 Ga0496112_0028036
439 Ga0496112_0365861
440 Ga0496113_0120832
441 Ga0501325_001376
442 Ga0501336_000840
443 Ga0501340_000672
444 Ga0501216_001793
445 Ga0501227_002471
446 Ga0501227_002923
447 nmdc:mga05p37_56048_c1
448 nmdc:mga05p37_63520_c1
449 nmdc:mga08y16_183063_c1
450 nmdc:mga08y16_236044_c1
451 nmdc:mga0n895_92605_c1
452 nmdc:mga0rr50_62208_c1
453 nmdc:mga08x19_9425_c1
454 nmdc:mga0a205_108548_c1
455 nmdc:mga0a205_2253_c1
456 nmdc:mga0a205_36987_c1
457 Ga0587073_0016622
458 Ga0587077_012186
459 Ga0587128_007090
460 Ga0587076_010228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vl6-assembly1.cif.gz_A de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.7677 98 238
4am9-assembly1.cif.gz_A crystal structure of the yersinia enterocolitica type iii secretion chaperone sycd in complex with a peptide of the translocator yopd 0.7496 131 306
2vgx-assembly1.cif.gz_B structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd 0.7454 130 310
6vl6-assembly1.cif.gz_A de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.7301 98 238
2xcc-assembly1.cif.gz_B crystal structure of pcrh from pseudomonas aeruginosa 0.7102 131 306
ID Description Score Start End Superfamily
af_A4HUJ4_263_389_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7356 133 287 1.25.40.10
af_A0A096MJB5_3_128_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.709 136 304 1.25.40.10
af_Q4E5D0_2_130_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.709 96 246 1.25.40.10
af_Q6NMH5_351_474_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.703 156 300 1.25.40.10
af_G5ECY6_2_122_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7029 98 238 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7W0XDL1-F1-model_v4 Uncharacterized protein 0.9826 244 333
AF-A0A7W0XDL1-F1-model_v4 Uncharacterized protein 0.9616 244 333
AF-A0A7V9Q7H5-F1-model_v4 Tetratricopeptide repeat protein 0.9039 177 340
AF-A0A838RUP3-F1-model_v4 Uncharacterized protein 0.8897 58 341
AF-A0A2V8LZH4-F1-model_v4 Tetratricopeptide repeat protein 0.8865 110 330

Map