F342324

General Info

Members Datasets Scaffolds Average Seq Length
229 182 205 94

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0320751|Ga0495628_0320751_405_743
Length 112
Sequence VPRLIVTEGAGQGLERCRQFLVRKDPVAAQRAAKAIDEQFALVAANPGIGRPYESDADLGDPDLRELVIRFGAGGYVALYRYDLKHDAVVMLAFRHQREAGYSNEVGAPGEQ

Samples

Sample ID Description Type Environment
1 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
4 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
5 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
6 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
7 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
8 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
9 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
10 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
11 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
12 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
13 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
14 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
15 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
16 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
17 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
18 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
19 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
20 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
21 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
22 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
23 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
117 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
118 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
175 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
180 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
181 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
182 8018221730 Enterobacter sp. CM29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.59
Metatranscriptomes 3.93
Isolates 10.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 7.42
Rhizoplane 2.18
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1015800 3300001904 Bacteria 1206
2 JGI24737J22298_10056883 3300001990 Bacteria 1181
3 JGI25156J39149_1008857 3300002705 Bacteria 2495
4 JGI25157J39369_1003159 3300002741 Bacteria 3518
5 JGI25151J46595_10000064 3300003187 Bacteria 145243
6 JGI25153J46596_10074747 3300003215 Bacteria 864
7 Ga0070676_10912486 3300005328 Bacteria 655
8 Ga0070670_100411717 3300005331 Plasmid 1195
9 Ga0068869_101308743 3300005334 Bacteria 639
10 Ga0070682_100027971 3300005337 Bacteria 3388
11 Ga0070669_100884120 3300005353 Bacteria 762
12 Ga0070673_100844670 3300005364 Plasmid 847
13 Ga0070714_101552241 3300005435 Bacteria 647
14 Ga0070714_102186816 3300005435 Archaea 539
15 Ga0070663_100288205 3300005455 Bacteria 1311
16 Ga0070696_100390676 3300005546 Bacteria 1086
17 Ga0070693_100231666 3300005547 Bacteria 1216
18 Ga0070665_100104302 3300005548 Bacteria 2838
19 Ga0068855_100077964 3300005563 Bacteria 3844
20 Ga0068854_101583937 3300005578 Bacteria 596
21 Ga0068856_100026764 3300005614 Bacteria 5623
22 Ga0068856_100182261 3300005614 Bacteria 2113
23 Ga0068852_100005970 3300005616 Bacteria 8771
24 Ga0068852_100550228 3300005616 Bacteria 1154
25 Ga0068858_100023507 3300005842 Bacteria 5740
26 Ga0068860_100586751 3300005843 Bacteria 1119
27 Ga0070717_11101141 3300006028 Bacteria 723
28 Ga0075366_10007552 3300006195 Bacteria 6013
29 Ga0105251_10041294 3300009011 Bacteria 2246
30 Ga0105244_10128804 3300009036 Bacteria 1222
31 Ga0105240_10009149 3300009093 Bacteria 14055
32 Ga0105240_10787151 3300009093 Bacteria 1031
33 Ga0105245_10008847 3300009098 Bacteria 8784
34 Ga0105243_11430555 3300009148 Bacteria 713
35 Ga0105241_10073808 3300009174 Bacteria 2655
36 Ga0105237_10000911 3300009545 Bacteria 39750
37 Ga0105238_10870220 3300009551 Bacteria 919
38 Ga0105147_107512 3300009982 Bacteria 925
39 Ga0157373_10100399 3300013100 Bacteria 2037
40 Ga0157370_10038899 3300013104 Bacteria 4600
41 Ga0157370_10216239 3300013104 Bacteria 1776
42 Ga0157369_10168320 3300013105 Bacteria 2310
43 Ga0157369_10274133 3300013105 Bacteria 1758
44 Ga0157374_10722450 3300013296 Bacteria 1010
45 Ga0157378_10340535 3300013297 Bacteria 1462
46 Ga0163162_10002615 3300013306 Bacteria 17077
47 Ga0163162_12408444 3300013306 Bacteria 605
48 Ga0157377_10502700 3300014745 Bacteria 847
49 Ga0157379_10860525 3300014968 Bacteria 858
50 Ga0157376_10304761 3300014969 Bacteria 1509
51 Ga0182006_1176277 3300015261 Bacteria 714
52 Ga0182007_10107130 3300015262 Bacteria 928
53 Ga0182005_1011260 3300015265 Bacteria 2555
54 Ga0197907_10857973 3300020069 Bacteria 853
55 Ga0206356_10017321 3300020070 Bacteria 771
56 Ga0206356_11844501 3300020070 Bacteria 1159
57 Ga0206355_1500484 3300020076 Bacteria 755
58 Ga0206355_1658745 3300020076 Bacteria 557
59 Ga0206351_10234718 3300020077 Bacteria 541
60 Ga0206350_11225117 3300020080 Bacteria 923
61 Ga0224712_10231431 3300022467 Bacteria 848
62 Ga0209025_1000182 3300025294 Bacteria 156443
63 Ga0209758_1003776 3300025297 Bacteria 13365
64 Ga0207696_1021776 3300025711 Bacteria 2047
65 Ga0207655_1074729 3300025728 Bacteria 1246
66 Ga0207713_1039554 3300025735 Bacteria 1988
67 Ga0207705_10179393 3300025909 Bacteria 1598
68 Ga0207695_10908551 3300025913 Bacteria 760
69 Ga0207671_10042662 3300025914 Bacteria 3357
70 Ga0207694_10504059 3300025924 Bacteria 1014
71 Ga0207650_10000360 3300025925 Bacteria 43867
72 Ga0207687_10002092 3300025927 Bacteria 13638
73 Ga0207689_11140133 3300025942 Bacteria 657
74 Ga0207651_11655453 3300025960 Bacteria 576
75 Ga0207668_10593443 3300025972 Bacteria 964
76 Ga0207640_11551446 3300025981 Bacteria 596
77 Ga0207640_11741769 3300025981 Bacteria 563
78 Ga0207658_10022134 3300025986 Bacteria 4422
79 Ga0207703_10007655 3300026035 Bacteria 8557
80 Ga0207678_10002758 3300026067 Bacteria 15911
81 Ga0207678_10207065 3300026067 Bacteria 1678
82 Ga0207702_10004185 3300026078 Bacteria 12911
83 Ga0207702_10032152 3300026078 Bacteria 4378
84 Ga0207702_10974318 3300026078 Bacteria 841
85 Ga0207675_100367234 3300026118 Bacteria 1413
86 Ga0207698_10002178 3300026142 Bacteria 11584
87 Ga0207698_10826071 3300026142 Bacteria 930
88 Ga0268266_10297631 3300028379 Bacteria 1504
89 Ga0268264_10452336 3300028381 Bacteria 1244
90 Ga0265338_10242096 3300028800 Plasmid 1335
91 Ga0265770_1037396 3300030878 Bacteria 837
92 Ga0265327_10005631 3300031251 Bacteria 10370
93 Ga0307408_100003639 3300031548 Bacteria 10504
94 Ga0307408_101648544 3300031548 Bacteria 610
95 Ga0307413_10003434 3300031824 Bacteria 6664
96 Ga0307406_10068021 3300031901 Bacteria 2324
97 Ga0307406_10341017 3300031901 Bacteria 1167
98 Ga0307407_11716943 3300031903 Bacteria 500
99 Ga0307412_10289680 3300031911 Bacteria 1289
100 Ga0307409_100222065 3300031995 Bacteria 1706
101 Ga0316584_0054096 3300036712 Bacteria 3004
102 Ga0395905_0002480 3300037471 Bacteria 20425
103 Ga0395905_0116578 3300037471 Bacteria 2510
104 Ga0395905_0131489 3300037471 Bacteria 2354
105 Ga0395905_0224602 3300037471 Bacteria 1757
106 Ga0400487_07056 3300039110 Bacteria 5103
107 Ga0436361_0097102 3300039447 Bacteria 718
108 Ga0436363_1119764 3300039450 Bacteria 2324
109 Ga0451789_0106963 3300041443 Bacteria 591
110 Ga0439448_0000098 3300042005 Bacteria 15629
111 Ga0439449_0373953 3300042007 Bacteria 540
112 Ga0439451_012926 3300042009 Bacteria 1687
113 Ga0439456_013892 3300042013 Bacteria 1677
114 Ga0450906_013513 3300042145 Bacteria 1503
115 Ga0466969_0253432 3300044656 Bacteria 798
116 Ga0466961_0006060 3300044693 Bacteria 7664
117 Ga0466971_0349081 3300044719 Bacteria 716
118 Ga0466958_1080249 3300045836 Bacteria 524
119 Ga0495638_0069983 3300046460 Bacteria 2149
120 Ga0495583_0000358 3300046506 Bacteria 71745
121 Ga0495583_0313215 3300046506 Bacteria 622
122 Ga0495610_0151813 3300046512 Bacteria 987
123 Ga0495628_0320751 3300046516 Bacteria 1143
124 Ga0495637_0027018 3300046520 Bacteria 2571
125 Ga0495648_0072867 3300046524 Bacteria 1986
126 Ga0495648_0106484 3300046524 Bacteria 1535
127 Ga0495654_0078826 3300046530 Bacteria 1548
128 Ga0495597_0006858 3300046542 Bacteria 5852
129 Ga0495611_0034266 3300046648 Bacteria 2244
130 Ga0495625_0220830 3300046660 Bacteria 1242
131 Ga0495661_0028022 3300046665 Bacteria 3612
132 Ga0495599_0244224 3300046678 Bacteria 1094
133 Ga0495670_0032378 3300046691 Bacteria 2601
134 Ga0495671_0012429 3300046692 Bacteria 4651
135 Ga0495671_0014046 3300046692 Bacteria 4318
136 Ga0495649_0074088 3300046694 Bacteria 1824
137 Ga0495600_0103033 3300046809 Bacteria 1860
138 Ga0495672_0093071 3300047320 Bacteria 1651
139 Ga0495687_048560 3300047443 Bacteria 1820
140 Ga0495615_0025484 3300048090 Bacteria 1373
141 Ga0496107_1017925 3300048910 Bacteria 601
142 Ga0496108_0066640 3300048911 Bacteria 3037
143 Ga0496114_0041233 3300048917 Bacteria 3824
144 Ga0496115_0993891 3300048918 Plasmid 642
145 Ga0496122_0032168 3300048925 Bacteria 4343
146 Ga0496124_0000083 3300048927 Bacteria 207798
147 Ga0496126_0617257 3300048929 Bacteria 852
148 Ga0495682_0018113 3300049460 Bacteria 2653
149 Ga0501031_0000011 3300049568 Bacteria 142761
150 Ga0501031_0051925 3300049568 Bacteria 2671
151 Ga0501031_0624213 3300049568 Bacteria 693
152 Ga0501032_0000006 3300049569 Bacteria 261727
153 Ga0501032_0192332 3300049569 Bacteria 1333
154 Ga0501033_0000039 3300049570 Bacteria 142732
155 Ga0501033_0003288 3300049570 Bacteria 13362
156 Ga0501033_0048130 3300049570 Bacteria 3167
157 Ga0501034_0000030 3300049571 Bacteria 248180
158 Ga0501034_0100042 3300049571 Bacteria 2894
159 Ga0501036_0000003 3300049572 Bacteria 261545
160 Ga0501036_0106706 3300049572 Bacteria 2368
161 Ga0501037_0000003 3300049573 Bacteria 261548
162 Ga0501037_0045632 3300049573 Bacteria 3216
163 Ga0501037_0151183 3300049573 Bacteria 1659
164 Ga0501038_0000004 3300049574 Bacteria 261289
165 Ga0501038_0071992 3300049574 Bacteria 2930
166 Ga0501038_0830172 3300049574 Bacteria 685
167 Ga0501039_0000008 3300049575 Bacteria 274778
168 Ga0501039_0429609 3300049575 Bacteria 1037
169 Ga0501040_0011767 3300049576 Bacteria 5724
170 Ga0501040_0292671 3300049576 Bacteria 1164
171 Ga0501043_0000177 3300049579 Bacteria 56981
172 Ga0501043_0170963 3300049579 Bacteria 1695
173 Ga0501043_0331253 3300049579 Bacteria 1159
174 Ga0501046_0066283 3300049580 Bacteria 2814
175 Ga0501046_0066705 3300049580 Bacteria 2804
176 Ga0501047_0004892 3300049581 Bacteria 12583
177 Ga0501047_0414121 3300049581 Bacteria 1179
178 Ga0501047_0969550 3300049581 Bacteria 663
179 Ga0501048_0074939 3300049582 Bacteria 2387
180 Ga0501070_0091323 3300049586 Bacteria 2520
181 Ga0501070_0219766 3300049586 Bacteria 1558
182 Ga0501073_0339412 3300049589 Bacteria 1037
183 Ga0501074_0847871 3300049590 Bacteria 644
184 Ga0501080_0057740 3300049742 Bacteria 3613
185 Ga0501035_0000112 3300049822 Bacteria 99138
186 Ga0501035_0641878 3300049822 Bacteria 861
187 Ga0501044_0000008 3300049823 Bacteria 274778
188 Ga0501044_0119440 3300049823 Bacteria 2638
189 Ga0501044_0964359 3300049823 Bacteria 725
190 Ga0501044_1454360 3300049823 Bacteria 550
191 nmdc:mga0k408_13886_c1 3300050493 Bacteria 4427
192 Ga0495619_0249552 3300053085 Bacteria 1230
193 Ga0500644_0006192 3300053088 Bacteria 3054
194 Ga0500555_001253 3300053103 Bacteria 8147
195 Ga0500618_019580 3300053125 Bacteria 1663
196 Ga0500642_0059879 3300053130 Bacteria 1707
197 Ga0500655_003147 3300053133 Bacteria 2993
198 Ga0500559_0130729 3300053136 Bacteria 1172
199 Ga0500559_0209535 3300053136 Bacteria 919
200 Ga0500590_002600 3300053148 Bacteria 8083
201 Ga0500622_0010973 3300053156 Bacteria 4944
202 Ga0500622_0020951 3300053156 Bacteria 3470
203 Ga0500639_234050 3300053163 Bacteria 753
204 Ga0500570_025206 3300053724 Bacteria 3270
205 Ga0500552_033980 3300053733 Bacteria 800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_101308743 Ga0068869_1013087432 71
2 3300005548 Ga0070665_100104302 Ga0070665_1001043022 71
3 3300005843 Ga0068860_100586751 Ga0068860_1005867512 71
4 3300009093 Ga0105240_10009149 Ga0105240_100091492 71
5 3300009093 Ga0105240_10787151 Ga0105240_107871512 71
6 3300009545 Ga0105237_10000911 Ga0105237_1000091112 71
7 3300013104 Ga0157370_10038899 Ga0157370_100388992 71
8 3300025942 Ga0207689_11140133 Ga0207689_111401332 71
9 3300025972 Ga0207668_10593443 Ga0207668_105934432 71
10 3300025986 Ga0207658_10022134 Ga0207658_100221345 71
11 3300028379 Ga0268266_10297631 Ga0268266_102976312 71
12 3300028381 Ga0268264_10452336 Ga0268264_104523362 71
13 3300039447 Ga0436361_0097102 Ga0436361_0097102_226_480 71
14 3300044693 Ga0466961_0006060 Ga0466961_0006060_1796_2050 71
15 3300044719 Ga0466971_0349081 Ga0466971_0349081_132_386 71
16 3300045836 Ga0466958_1080249 Ga0466958_1080249_182_436 71
17 3300048925 Ga0496122_0032168 Ga0496122_0032168_1411_1665 71
18 3300049568 Ga0501031_0000011 Ga0501031_0000011_88827_89108 80
19 3300049569 Ga0501032_0000006 Ga0501032_0000006_172620_172901 80
20 3300049570 Ga0501033_0000039 Ga0501033_0000039_88827_89108 80
21 3300049571 Ga0501034_0000030 Ga0501034_0000030_62229_62510 80
22 3300049572 Ga0501036_0000003 Ga0501036_0000003_88827_89108 80
23 3300049573 Ga0501037_0000003 Ga0501037_0000003_88827_89108 80
24 3300049574 Ga0501038_0000004 Ga0501038_0000004_88827_89108 80
25 3300049575 Ga0501039_0000008 Ga0501039_0000008_88827_89108 80
26 3300049576 Ga0501040_0011767 Ga0501040_0011767_3236_3517 80
27 3300049579 Ga0501043_0000177 Ga0501043_0000177_3076_3357 80
28 3300049580 Ga0501046_0066705 Ga0501046_0066705_496_777 80
29 3300049581 Ga0501047_0004892 Ga0501047_0004892_9295_9576 80
30 3300049586 Ga0501070_0219766 Ga0501070_0219766_1128_1409 80
31 3300049822 Ga0501035_0000112 Ga0501035_0000112_10031_10312 80
32 3300049823 Ga0501044_0000008 Ga0501044_0000008_88827_89108 80
33 iso_pu_bacteria 2510917013 2511085999 80
34 iso_pu_bacteria 2511231052 2511503474 80
35 iso_pu_bacteria 2513237086 2513588565 80
36 iso_pu_bacteria 2517487022 2517568243 80
37 iso_pu_bacteria 2855839649 2855846697 80
38 iso_pu_bacteria 2916028427 2916033900 80
39 iso_pu_bacteria 2916055098 2916060564 80
40 iso_pu_bacteria 2919481497 2919483428 80
41 iso_pu_bacteria 2920760137 2920761019 80
42 iso_pu_bacteria 2921263974 2921269521 80
43 iso_pu_bacteria 2924172951 2924178701 80
44 iso_pu_bacteria 2924193448 2924198681 80
45 iso_pu_bacteria 2937042894 2937048696 80
46 iso_pu_bacteria 2937063883 2937071159 80
47 iso_pu_bacteria 2937843397 2937845426 80
48 iso_pu_bacteria 2946027586 2946030402 80
49 iso_pu_bacteria 2957478035 2957483423 80
50 iso_pu_bacteria 2957498199 2957499950 80
51 iso_pu_bacteria 2960584000 2960588299 80
52 iso_pu_bacteria 2960637947 2960639026 80
53 iso_pu_bacteria 2964719344 2964721250 80
54 iso_pu_bacteria 2967748971 2967754049 80
55 iso_pu_bacteria 2967775926 2967781481 80
56 iso_pu_bacteria 8018221730 8018222755 80
57 3300005614 Ga0068856_100026764 Ga0068856_1000267644 81
58 3300009011 Ga0105251_10041294 Ga0105251_100412941 81
59 3300009036 Ga0105244_10128804 Ga0105244_101288041 81
60 3300013105 Ga0157369_10274133 Ga0157369_102741332 81
61 3300026078 Ga0207702_10004185 Ga0207702_1000418512 81
62 3300036712 Ga0316584_0054096 Ga0316584_0054096_1614_1898 81
63 3300039450 Ga0436363_1119764 Ga0436363_1119764_446_730 81
64 3300046506 Ga0495583_0313215 Ga0495583_0313215_315_599 81
65 3300046520 Ga0495637_0027018 Ga0495637_0027018_2101_2385 81
66 3300046524 Ga0495648_0072867 Ga0495648_0072867_138_422 81
67 3300046542 Ga0495597_0006858 Ga0495597_0006858_2417_2701 81
68 3300048090 Ga0495615_0025484 Ga0495615_0025484_369_653 81
69 3300053130 Ga0500642_0059879 Ga0500642_0059879_208_492 81
70 3300053133 Ga0500655_003147 Ga0500655_003147_1463_1747 81
71 3300053136 Ga0500559_0209535 Ga0500559_0209535_203_487 81
72 3300053148 Ga0500590_002600 Ga0500590_002600_372_656 81
73 3300053156 Ga0500622_0020951 Ga0500622_0020951_1219_1503 81
74 3300053163 Ga0500639_234050 Ga0500639_234050_357_641 81
75 3300053724 Ga0500570_025206 Ga0500570_025206_1080_1364 81
76 3300053733 Ga0500552_033980 Ga0500552_033980_223_507 81
77 3300006195 Ga0075366_10007552 Ga0075366_100075523 82
78 3300026118 Ga0207675_100367234 Ga0207675_1003672343 82
79 3300028800 Ga0265338_10242096 Ga0265338_102420962 83
80 3300001904 JGI24736J21556_1015800 JGI24736J21556_10158002 84
81 3300001990 JGI24737J22298_10056883 JGI24737J22298_100568832 84
82 3300002705 JGI25156J39149_1008857 JGI25156J39149_10088573 84
83 3300002741 JGI25157J39369_1003159 JGI25157J39369_10031593 84
84 3300003187 JGI25151J46595_10000064 JGI25151J46595_1000006431 84
85 3300003215 JGI25153J46596_10074747 JGI25153J46596_100747472 84
86 3300005328 Ga0070676_10912486 Ga0070676_109124862 84
87 3300005331 Ga0070670_100411717 Ga0070670_1004117173 84
88 3300005337 Ga0070682_100027971 Ga0070682_1000279714 84
89 3300005353 Ga0070669_100884120 Ga0070669_1008841201 84
90 3300005364 Ga0070673_100844670 Ga0070673_1008446702 84
91 3300005435 Ga0070714_101552241 Ga0070714_1015522412 84
92 3300005435 Ga0070714_102186816 Ga0070714_1021868161 84
93 3300005455 Ga0070663_100288205 Ga0070663_1002882052 84
94 3300005546 Ga0070696_100390676 Ga0070696_1003906762 84
95 3300005547 Ga0070693_100231666 Ga0070693_1002316662 84
96 3300005563 Ga0068855_100077964 Ga0068855_1000779642 84
97 3300005578 Ga0068854_101583937 Ga0068854_1015839372 84
98 3300005614 Ga0068856_100182261 Ga0068856_1001822612 84
99 3300005616 Ga0068852_100005970 Ga0068852_1000059703 84
100 3300005616 Ga0068852_100550228 Ga0068852_1005502282 84
101 3300005842 Ga0068858_100023507 Ga0068858_10002350710 84
102 3300006028 Ga0070717_11101141 Ga0070717_111011412 84
103 3300009098 Ga0105245_10008847 Ga0105245_100088476 84
104 3300009148 Ga0105243_11430555 Ga0105243_114305552 84
105 3300009174 Ga0105241_10073808 Ga0105241_100738084 84
106 3300009551 Ga0105238_10870220 Ga0105238_108702202 84
107 3300009982 Ga0105147_107512 Ga0105147_1075123 84
108 3300013100 Ga0157373_10100399 Ga0157373_101003993 84
109 3300013104 Ga0157370_10216239 Ga0157370_102162392 84
110 3300013105 Ga0157369_10168320 Ga0157369_101683203 84
111 3300013296 Ga0157374_10722450 Ga0157374_107224502 84
112 3300013297 Ga0157378_10340535 Ga0157378_103405353 84
113 3300013306 Ga0163162_10002615 Ga0163162_1000261514 84
114 3300013306 Ga0163162_12408444 Ga0163162_124084441 84
115 3300014745 Ga0157377_10502700 Ga0157377_105027002 84
116 3300014968 Ga0157379_10860525 Ga0157379_108605252 84
117 3300014969 Ga0157376_10304761 Ga0157376_103047613 84
118 3300015261 Ga0182006_1176277 Ga0182006_11762771 84
119 3300015262 Ga0182007_10107130 Ga0182007_101071302 84
120 3300015265 Ga0182005_1011260 Ga0182005_10112602 84
121 3300020069 Ga0197907_10857973 Ga0197907_108579732 84
122 3300020070 Ga0206356_10017321 Ga0206356_100173211 84
123 3300020070 Ga0206356_11844501 Ga0206356_118445013 84
124 3300020076 Ga0206355_1500484 Ga0206355_15004841 84
125 3300020076 Ga0206355_1658745 Ga0206355_16587452 84
126 3300020077 Ga0206351_10234718 Ga0206351_102347182 84
127 3300020080 Ga0206350_11225117 Ga0206350_112251172 84
128 3300022467 Ga0224712_10231431 Ga0224712_102314312 84
129 3300025294 Ga0209025_1000182 Ga0209025_1000182155 84
130 3300025297 Ga0209758_1003776 Ga0209758_10037766 84
131 3300025711 Ga0207696_1021776 Ga0207696_10217763 84
132 3300025728 Ga0207655_1074729 Ga0207655_10747293 84
133 3300025735 Ga0207713_1039554 Ga0207713_10395543 84
134 3300025909 Ga0207705_10179393 Ga0207705_101793932 84
135 3300025913 Ga0207695_10908551 Ga0207695_109085512 84
136 3300025914 Ga0207671_10042662 Ga0207671_100426624 84
137 3300025924 Ga0207694_10504059 Ga0207694_105040593 84
138 3300025925 Ga0207650_10000360 Ga0207650_100003603 84
139 3300025927 Ga0207687_10002092 Ga0207687_1000209210 84
140 3300025960 Ga0207651_11655453 Ga0207651_116554532 84
141 3300025981 Ga0207640_11551446 Ga0207640_115514461 84
142 3300025981 Ga0207640_11741769 Ga0207640_117417692 84
143 3300026035 Ga0207703_10007655 Ga0207703_1000765510 84
144 3300026067 Ga0207678_10002758 Ga0207678_100027583 84
145 3300026067 Ga0207678_10207065 Ga0207678_102070653 84
146 3300026078 Ga0207702_10032152 Ga0207702_100321523 84
147 3300026078 Ga0207702_10974318 Ga0207702_109743181 84
148 3300026142 Ga0207698_10002178 Ga0207698_1000217811 84
149 3300026142 Ga0207698_10826071 Ga0207698_108260712 84
150 3300030878 Ga0265770_1037396 Ga0265770_10373962 84
151 3300031251 Ga0265327_10005631 Ga0265327_100056313 84
152 3300031548 Ga0307408_100003639 Ga0307408_1000036392 84
153 3300031548 Ga0307408_101648544 Ga0307408_1016485442 84
154 3300031824 Ga0307413_10003434 Ga0307413_100034345 84
155 3300031901 Ga0307406_10068021 Ga0307406_100680213 84
156 3300031901 Ga0307406_10341017 Ga0307406_103410174 84
157 3300031903 Ga0307407_11716943 Ga0307407_117169432 84
158 3300031911 Ga0307412_10289680 Ga0307412_102896802 84
159 3300031995 Ga0307409_100222065 Ga0307409_1002220652 84
160 3300037471 Ga0395905_0002480 Ga0395905_0002480_10361_10654 84
161 3300037471 Ga0395905_0116578 Ga0395905_0116578_1076_1369 84
162 3300037471 Ga0395905_0131489 Ga0395905_0131489_720_1013 84
163 3300037471 Ga0395905_0224602 Ga0395905_0224602_114_407 84
164 3300039110 Ga0400487_07056 Ga0400487_07056_4430_4723 84
165 3300041443 Ga0451789_0106963 Ga0451789_0106963_202_495 84
166 3300042005 Ga0439448_0000098 Ga0439448_0000098_13569_13862 84
167 3300042007 Ga0439449_0373953 Ga0439449_0373953_40_336 84
168 3300042009 Ga0439451_012926 Ga0439451_012926_363_656 84
169 3300042013 Ga0439456_013892 Ga0439456_013892_578_871 84
170 3300042145 Ga0450906_013513 Ga0450906_013513_807_1100 84
171 3300044656 Ga0466969_0253432 Ga0466969_0253432_239_532 84
172 3300046460 Ga0495638_0069983 Ga0495638_0069983_1779_2087 84
173 3300046506 Ga0495583_0000358 Ga0495583_0000358_1497_1805 84
174 3300046512 Ga0495610_0151813 Ga0495610_0151813_172_465 84
175 3300046516 Ga0495628_0320751 Ga0495628_0320751_405_743 84
176 3300046524 Ga0495648_0106484 Ga0495648_0106484_259_552 84
177 3300046530 Ga0495654_0078826 Ga0495654_0078826_476_769 84
178 3300046648 Ga0495611_0034266 Ga0495611_0034266_862_1170 84
179 3300046660 Ga0495625_0220830 Ga0495625_0220830_23_316 84
180 3300046665 Ga0495661_0028022 Ga0495661_0028022_1571_1879 84
181 3300046678 Ga0495599_0244224 Ga0495599_0244224_78_416 84
182 3300046691 Ga0495670_0032378 Ga0495670_0032378_555_863 84
183 3300046692 Ga0495671_0012429 Ga0495671_0012429_2841_3134 84
184 3300046692 Ga0495671_0014046 Ga0495671_0014046_3029_3322 84
185 3300046694 Ga0495649_0074088 Ga0495649_0074088_324_617 84
186 3300046809 Ga0495600_0103033 Ga0495600_0103033_252_590 84
187 3300047320 Ga0495672_0093071 Ga0495672_0093071_765_1058 84
188 3300047443 Ga0495687_048560 Ga0495687_048560_1200_1493 84
189 3300048910 Ga0496107_1017925 Ga0496107_1017925_192_491 84
190 3300048911 Ga0496108_0066640 Ga0496108_0066640_1025_1324 84
191 3300048917 Ga0496114_0041233 Ga0496114_0041233_1053_1346 84
192 3300048918 Ga0496115_0993891 Ga0496115_0993891_320_613 84
193 3300048927 Ga0496124_0000083 Ga0496124_0000083_84960_85253 84
194 3300048929 Ga0496126_0617257 Ga0496126_0617257_430_723 84
195 3300049460 Ga0495682_0018113 Ga0495682_0018113_663_971 84
196 3300049568 Ga0501031_0051925 Ga0501031_0051925_1777_2070 84
197 3300049568 Ga0501031_0624213 Ga0501031_0624213_162_455 84
198 3300049569 Ga0501032_0192332 Ga0501032_0192332_743_1036 84
199 3300049570 Ga0501033_0003288 Ga0501033_0003288_2310_2603 84
200 3300049570 Ga0501033_0048130 Ga0501033_0048130_583_876 84
201 3300049571 Ga0501034_0100042 Ga0501034_0100042_745_1038 84
202 3300049572 Ga0501036_0106706 Ga0501036_0106706_1075_1368 84
203 3300049573 Ga0501037_0045632 Ga0501037_0045632_1589_1882 84
204 3300049573 Ga0501037_0151183 Ga0501037_0151183_124_417 84
205 3300049574 Ga0501038_0071992 Ga0501038_0071992_751_1044 84
206 3300049574 Ga0501038_0830172 Ga0501038_0830172_115_408 84
207 3300049575 Ga0501039_0429609 Ga0501039_0429609_229_522 84
208 3300049576 Ga0501040_0292671 Ga0501040_0292671_20_313 84
209 3300049579 Ga0501043_0170963 Ga0501043_0170963_1001_1294 84
210 3300049579 Ga0501043_0331253 Ga0501043_0331253_468_761 84
211 3300049580 Ga0501046_0066283 Ga0501046_0066283_228_521 84
212 3300049581 Ga0501047_0414121 Ga0501047_0414121_730_1023 84
213 3300049581 Ga0501047_0969550 Ga0501047_0969550_278_571 84
214 3300049582 Ga0501048_0074939 Ga0501048_0074939_1232_1525 84
215 3300049586 Ga0501070_0091323 Ga0501070_0091323_2158_2451 84
216 3300049589 Ga0501073_0339412 Ga0501073_0339412_288_581 84
217 3300049590 Ga0501074_0847871 Ga0501074_0847871_195_488 84
218 3300049742 Ga0501080_0057740 Ga0501080_0057740_3028_3321 84
219 3300049822 Ga0501035_0641878 Ga0501035_0641878_407_700 84
220 3300049823 Ga0501044_0119440 Ga0501044_0119440_1392_1685 84
221 3300049823 Ga0501044_0964359 Ga0501044_0964359_407_700 84
222 3300049823 Ga0501044_1454360 Ga0501044_1454360_228_521 84
223 3300050493 nmdc:mga0k408_13886_c1 nmdc:mga0k408_13886_c1_4091_4387 84
224 3300053085 Ga0495619_0249552 Ga0495619_0249552_533_871 84
225 3300053088 Ga0500644_0006192 Ga0500644_0006192_2355_2648 84
226 3300053103 Ga0500555_001253 Ga0500555_001253_1844_2152 84
227 3300053125 Ga0500618_019580 Ga0500618_019580_509_802 84
228 3300053136 Ga0500559_0130729 Ga0500559_0130729_543_848 84
229 3300053156 Ga0500622_0010973 Ga0500622_0010973_2972_3265 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

4

101

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a0x-assembly1.cif.gz_C crystal structure of the higb2-higa2 tetramer in complex with operator dna 0.7667 34 80
3to1-assembly2.cif.gz_B two surfaces on rtt106 mediate histone binding and chaperone activity 0.764 52 76
6e5w-assembly4.cif.gz_D crystal structure of human cellular retinol binding protein 3 in complex with abnormal-cannabidiol (abn-cbd) 0.642 56 78
4i9r-assembly1.cif.gz_A crystal structure of the r111k:r132l:y134f:t54v:r59w:a32w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.6 angstrom resolution 0.6411 50 78
5f6b-assembly2.cif.gz_B crystal structure of the q108k:k40l:t51v:r58y:y19w mutant of human cellular retinol binding protein ii in complex with all-trans-retinal at 1.3 angstrom resolution 0.6397 56 78
ID Description Score Start End Superfamily
af_F1Q4Y0_657_804_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.806 51 79 2.30.29.30
af_Q8I3L4_55_526_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.7704 5 47 3.40.50.12780
6bc1D00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7466 50 80 2.30.29.30
af_Q59XM1_304_430_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7176 51 74 2.30.29.30
af_X1WDX0_131_272_2.60.40.1460 Mainly Beta;Sandwich;Immunoglobulin-like;Integrin domains. Chain A, domain 2 0.7043 59 77 2.60.40.1460
ID Description Score Start End GO Terms
AF-A0A6I5NKA5-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.922 24 78
AF-A0A1J4Z6Z1-F1-model_v4 Plasmid stabilization protein 0.906 28 76
AF-B4SB69-F1-model_v4 Plasmid stabilization system 0.8776 15 76
AF-A0A7V5NW27-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.8719 12 78
AF-A0A7Y5UMB0-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.8578 11 80

Feature Viewer

pLDDT pTM Quality
79.75 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map