F341429

General Info

Members Datasets Scaffolds Average Seq Length
228 150 456 118

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0282122|Ga0501073_0282122_406_795
Length 129
Sequence MAKNPDDSRLELLQGTLDMLILRTLQWGAQHGHGIGQAIRSQSEDLLKVETGSLYPALHRLEKRGWLESDWGVSEANQRAKYYRLTPAGKAQLSREQDRWSQLVHAIGRIMNPLPAAGSADSGDAGSKE

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 8.33
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 23.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0282122 3300049589 Bacteria 1146
2 Ga0070690_100000078 3300005330 Bacteria 47277
3 Ga0070666_10005354 3300005335 Bacteria 7866
4 Ga0070660_101435227 3300005339 Bacteria 586
5 Ga0070689_100004930 3300005340 Bacteria 9058
6 Ga0070689_100974916 3300005340 Bacteria 753
7 Ga0070675_100001089 3300005354 Bacteria 19604
8 Ga0070675_100745005 3300005354 Bacteria 894
9 Ga0070674_100685329 3300005356 Bacteria 875
10 Ga0070674_101997018 3300005356 Bacteria 528
11 Ga0070673_100028864 3300005364 Bacteria 4130
12 Ga0070688_100061424 3300005365 Bacteria 2375
13 Ga0070688_100334585 3300005365 Bacteria 1104
14 Ga0070667_100048347 3300005367 Bacteria 3580
15 Ga0070667_100456641 3300005367 Unclassified 1168
16 Ga0070713_101104182 3300005436 Unclassified 767
17 Ga0070705_100124640 3300005440 Bacteria 1669
18 Ga0070663_100180627 3300005455 Bacteria 1636
19 Ga0070678_100958117 3300005456 Bacteria 785
20 Ga0068867_100005396 3300005459 Bacteria 9042
21 Ga0070706_100491823 3300005467 Bacteria 1141
22 Ga0070707_101282161 3300005468 Bacteria 699
23 Ga0070699_100000644 3300005518 Bacteria 32680
24 Ga0070679_100316341 3300005530 Unclassified 1510
25 Ga0070672_100006131 3300005543 Bacteria 8047
26 Ga0070665_100308201 3300005548 Bacteria 1587
27 Ga0070704_100023546 3300005549 Bacteria 4026
28 Ga0068856_100002361 3300005614 Bacteria 19425
29 Ga0070702_100011830 3300005615 Bacteria 4353
30 Ga0068859_100003271 3300005617 Bacteria 16489
31 Ga0068859_101309262 3300005617 Bacteria 798
32 Ga0068861_102300211 3300005719 Bacteria 541
33 Ga0068863_100127707 3300005841 Bacteria 2426
34 Ga0068863_100279370 3300005841 Bacteria 1618
35 Ga0068863_101605187 3300005841 Bacteria 660
36 Ga0068858_100301851 3300005842 Bacteria 1528
37 Ga0068858_101025652 3300005842 Unclassified 809
38 Ga0068860_100002742 3300005843 Bacteria 18329
39 Ga0081455_10005962 3300005937 Bacteria 13212
40 Ga0075365_10016433 3300006038 Bacteria 4502
41 Ga0070715_10179710 3300006163 Unclassified 1060
42 Ga0075366_10885339 3300006195 Unclassified 556
43 Ga0097621_100086045 3300006237 Bacteria 2622
44 Ga0068871_101034591 3300006358 Unclassified 766
45 Ga0075428_100070870 3300006844 Bacteria 3810
46 Ga0075428_100086693 3300006844 Bacteria 3415
47 Ga0075428_102479484 3300006844 Unclassified 531
48 Ga0075430_100002072 3300006846 Bacteria 16563
49 Ga0075430_100057203 3300006846 Bacteria 3280
50 Ga0075430_100540440 3300006846 Unclassified 961
51 Ga0075431_100015529 3300006847 Bacteria 7717
52 Ga0075431_100043815 3300006847 Bacteria 4615
53 Ga0075431_100266269 3300006847 Unclassified 1738
54 Ga0075429_100428582 3300006880 Unclassified 1158
55 Ga0075429_101655090 3300006880 Unclassified 556
56 Ga0075436_100024258 3300006914 Bacteria 4168
57 Ga0075436_100440672 3300006914 Bacteria 948
58 Ga0097620_100003271 3300006931 Bacteria 16489
59 Ga0097620_101309272 3300006931 Bacteria 798
60 Ga0075435_100075370 3300007076 Bacteria 2762
61 Ga0105251_10054263 3300009011 Bacteria 1904
62 Ga0111539_10004480 3300009094 Bacteria 18267
63 Ga0111539_10034916 3300009094 Bacteria 6091
64 Ga0111539_10612528 3300009094 Bacteria 1268
65 Ga0105245_10594063 3300009098 Unclassified 1133
66 Ga0105245_10620567 3300009098 Bacteria 1109
67 Ga0105247_10446565 3300009101 Bacteria 931
68 Ga0114129_10009022 3300009147 Bacteria 14216
69 Ga0114129_10174908 3300009147 Unclassified 2924
70 Ga0114129_10285875 3300009147 Bacteria 2202
71 Ga0114129_12465680 3300009147 Unclassified 622
72 Ga0105243_10215191 3300009148 Bacteria 1695
73 Ga0105243_10343450 3300009148 Bacteria 1368
74 Ga0105243_12269870 3300009148 Unclassified 580
75 Ga0105241_10017298 3300009174 Bacteria 5296
76 Ga0105241_10052752 3300009174 Bacteria 3106
77 Ga0105241_10764219 3300009174 Bacteria 887
78 Ga0105248_10004888 3300009177 Bacteria 14815
79 Ga0105239_12859030 3300010375 Bacteria 563
80 Ga0157374_10149864 3300013296 Bacteria 2267
81 Ga0157374_10622206 3300013296 Bacteria 1090
82 Ga0157378_10138910 3300013297 Bacteria 2255
83 Ga0157378_10310903 3300013297 Bacteria 1528
84 Ga0157378_11044707 3300013297 Unclassified 852
85 Ga0157372_10030226 3300013307 Bacteria 5924
86 Ga0157375_10001863 3300013308 Bacteria 18144
87 Ga0157379_10023572 3300014968 Bacteria 5462
88 Ga0157379_11207361 3300014968 Unclassified 728
89 Ga0157376_10001352 3300014969 Bacteria 16150
90 Ga0157376_11036797 3300014969 Unclassified 844
91 Ga0157376_11044357 3300014969 Unclassified 841
92 Ga0207642_10036886 3300025899 Bacteria 2102
93 Ga0207680_10001126 3300025903 Bacteria 12631
94 Ga0207685_10640284 3300025905 Bacteria 574
95 Ga0207699_10343622 3300025906 Bacteria 1052
96 Ga0207705_10756829 3300025909 Bacteria 755
97 Ga0207684_10337646 3300025910 Bacteria 1297
98 Ga0207654_10027984 3300025911 Bacteria 3069
99 Ga0207654_11388826 3300025911 Unclassified 512
100 Ga0207652_10407441 3300025921 Unclassified 1227
101 Ga0207650_10082966 3300025925 Bacteria 2434
102 Ga0207659_10000077 3300025926 Bacteria 62077
103 Ga0207687_10330995 3300025927 Bacteria 1235
104 Ga0207687_10523971 3300025927 Unclassified 992
105 Ga0207686_10029688 3300025934 Bacteria 3229
106 Ga0207686_10328365 3300025934 Bacteria 1145
107 Ga0207686_10350531 3300025934 Bacteria 1111
108 Ga0207670_10428952 3300025936 Bacteria 1062
109 Ga0207691_10067214 3300025940 Bacteria 3241
110 Ga0207691_10130900 3300025940 Bacteria 2217
111 Ga0207711_10000533 3300025941 Bacteria 38978
112 Ga0207711_10809503 3300025941 Bacteria 872
113 Ga0207651_10237576 3300025960 Bacteria 1483
114 Ga0207712_11587272 3300025961 Bacteria 586
115 Ga0207658_10006677 3300025986 Bacteria 7862
116 Ga0207677_10092060 3300026023 Unclassified 2207
117 Ga0207677_10908934 3300026023 Bacteria 794
118 Ga0207703_10008083 3300026035 Bacteria 8315
119 Ga0207703_11185388 3300026035 Bacteria 734
120 Ga0207678_10263728 3300026067 Bacteria 1476
121 Ga0207702_10009474 3300026078 Bacteria 8182
122 Ga0207641_10036473 3300026088 Bacteria 4104
123 Ga0207641_11395539 3300026088 Bacteria 701
124 Ga0207648_10014704 3300026089 Bacteria 7222
125 Ga0207648_10399885 3300026089 Bacteria 1245
126 Ga0207676_10118377 3300026095 Bacteria 2229
127 Ga0207676_10381090 3300026095 Bacteria 1313
128 Ga0207674_10868149 3300026116 Unclassified 870
129 Ga0207683_10447217 3300026121 Bacteria 1191
130 Ga0207698_11322240 3300026142 Bacteria 735
131 Ga0207428_10005433 3300027907 Bacteria 11884
132 Ga0207428_10074147 3300027907 Bacteria 2669
133 Ga0268264_10003656 3300028381 Bacteria 13224
134 Ga0268264_10286823 3300028381 Bacteria 1544
135 Ga0307408_100301107 3300031548 Bacteria 1343
136 Ga0307408_100983097 3300031548 Unclassified 777
137 Ga0307406_10138704 3300031901 Bacteria 1718
138 Ga0307407_11146111 3300031903 Unclassified 606
139 Ga0307412_10236392 3300031911 Bacteria 1410
140 Ga0307412_11505664 3300031911 Unclassified 612
141 Ga0307416_100304107 3300032002 Bacteria 1587
142 Ga0307416_100542657 3300032002 Bacteria 1235
143 Ga0307416_100543895 3300032002 Bacteria 1233
144 Ga0307416_101403562 3300032002 Unclassified 804
145 Ga0307415_101631490 3300032126 Unclassified 620
146 Ga0373934_0363135 3300035086 Bacteria 603
147 Ga0373945_0239984 3300035116 Bacteria 763
148 Ga0373957_0398397 3300035120 Bacteria 592
149 Ga0373955_0819054 3300035172 Bacteria 572
150 Ga0373933_0209757 3300035724 Bacteria 1248
151 Ga0436364_0278774 3300037853 Bacteria 400541
152 Ga0439449_0076385 3300042007 Bacteria 1235
153 Ga0439450_077861 3300042008 Bacteria 821
154 Ga0450923_045976 3300042125 Bacteria 928
155 Ga0439464_0002056 3300042439 Bacteria 4895
156 Ga0439464_0176268 3300042439 Unclassified 676
157 Ga0466963_0441879 3300044694 Unclassified 918
158 Ga0495592_0442120 3300046454 Bacteria 816
159 Ga0495629_0031430 3300046459 Bacteria 3760
160 Ga0495580_0000871 3300046472 Bacteria 26084
161 Ga0495580_0818156 3300046472 Unclassified 603
162 Ga0495662_0035562 3300046476 Bacteria 2404
163 Ga0495664_0115408 3300046477 Bacteria 1623
164 Ga0495618_0583779 3300046514 Bacteria 666
165 Ga0495618_0845265 3300046514 Bacteria 531
166 Ga0495665_0174030 3300046531 Unclassified 1120
167 Ga0495640_0546380 3300046533 Bacteria 702
168 Ga0495645_0231049 3300046543 Bacteria 1239
169 Ga0495667_0072550 3300046559 Bacteria 2244
170 Ga0495635_0125273 3300046663 Bacteria 1752
171 Ga0495657_0081473 3300046675 Bacteria 2093
172 Ga0495613_0212096 3300046689 Bacteria 1362
173 Ga0495674_0272277 3300047319 Bacteria 1389
174 Ga0495684_0036583 3300047471 Bacteria 3763
175 Ga0495593_0520173 3300047673 Unclassified 597
176 Ga0496100_0004936 3300048903 Bacteria 7128
177 Ga0496101_0030105 3300048904 Bacteria 3803
178 Ga0496101_0207265 3300048904 Unclassified 1518
179 Ga0496102_0001464 3300048905 Bacteria 20862
180 Ga0496102_0213208 3300048905 Unclassified 1820
181 Ga0496103_0025959 3300048906 Unclassified 3544
182 Ga0496103_0106130 3300048906 Bacteria 1781
183 Ga0496104_0052839 3300048907 Bacteria 3838
184 Ga0496104_0749744 3300048907 Unclassified 883
185 Ga0496105_0584236 3300048908 Bacteria 869
186 Ga0496106_0002306 3300048909 Bacteria 14236
187 Ga0496107_0000369 3300048910 Bacteria 24408
188 Ga0496108_0110588 3300048911 Unclassified 2349
189 Ga0496108_1033712 3300048911 Bacteria 700
190 Ga0496109_0264227 3300048912 Unclassified 1621
191 Ga0496110_0012172 3300048913 Bacteria 7068
192 Ga0496111_0004075 3300048914 Bacteria 9176
193 Ga0496111_0201294 3300048914 Unclassified 1480
194 Ga0496113_0486262 3300048916 Unclassified 991
195 Ga0501036_0524439 3300049572 Bacteria 985
196 Ga0501073_0551630 3300049589 Bacteria 796
197 Ga0501079_0723831 3300049741 Unclassified 783
198 Ga0501079_0782220 3300049741 Unclassified 751
199 Ga0501081_0025939 3300049743 Bacteria 3948
200 nmdc:mga0yw44_2948_c1 3300050492 Bacteria 7412
201 nmdc:mga05p37_116463_c1 3300050507 Bacteria 3284
202 nmdc:mga05p37_2161_c1 3300050507 Bacteria 22923
203 nmdc:mga05p37_2220632_c1 3300050507 Bacteria 509
204 nmdc:mga09592_1562360_c1 3300050508 Unclassified 535
205 nmdc:mga09592_1623_c1 3300050508 Bacteria 18106
206 nmdc:mga09592_264242_c1 3300050508 Unclassified 1493
207 nmdc:mga0qj67_11435_c1 3300050509 Bacteria 6651
208 nmdc:mga0qj67_124980_c1 3300050509 Unclassified 2082
209 nmdc:mga0qj67_33205_c1 3300050509 Bacteria 4027
210 nmdc:mga06r32_29958_c1 3300050510 Bacteria 5104
211 nmdc:mga06r32_49142_c1 3300050510 Bacteria 4033
212 nmdc:mga06r32_66972_c1 3300050510 Bacteria 3466
213 nmdc:mga06r32_94907_c1 3300050510 Unclassified 2919
214 nmdc:mga08y16_124696_c1 3300050511 Bacteria 2679
215 nmdc:mga08y16_169_c1 3300050511 Bacteria 57254
216 nmdc:mga08y16_202421_c1 3300050511 Bacteria 2057
217 nmdc:mga0n895_293301_c1 3300050512 Bacteria 1649
218 nmdc:mga0n895_374756_c1 3300050512 Bacteria 1440
219 nmdc:mga0rr50_484805_c1 3300050513 Bacteria 1050
220 nmdc:mga08x19_102712_c1 3300050514 Bacteria 1899
221 nmdc:mga08x19_1082336_c1 3300050514 Unclassified 569
222 nmdc:mga08x19_1100361_c1 3300050514 Unclassified 564
223 nmdc:mga0a205_72142_c1 3300050515 Bacteria 3335
224 Ga0495595_0166321 3300053084 Bacteria 1090
225 Ga0495619_0019903 3300053085 Bacteria 4271
226 Ga0501084_0460685 3300054114 Unclassified 1075
227 Ga0501082_1036656 3300060353 Bacteria 717
228 Ga0501082_1321098 3300060353 Unclassified 630
229 Ga0501073_0282122
230 Ga0070690_100000078
231 Ga0070666_10005354
232 Ga0070660_101435227
233 Ga0070689_100004930
234 Ga0070689_100974916
235 Ga0070675_100001089
236 Ga0070675_100745005
237 Ga0070674_100685329
238 Ga0070674_101997018
239 Ga0070673_100028864
240 Ga0070688_100061424
241 Ga0070688_100334585
242 Ga0070667_100048347
243 Ga0070667_100456641
244 Ga0070713_101104182
245 Ga0070705_100124640
246 Ga0070663_100180627
247 Ga0070678_100958117
248 Ga0068867_100005396
249 Ga0070706_100491823
250 Ga0070707_101282161
251 Ga0070699_100000644
252 Ga0070679_100316341
253 Ga0070672_100006131
254 Ga0070665_100308201
255 Ga0070704_100023546
256 Ga0068856_100002361
257 Ga0070702_100011830
258 Ga0068859_100003271
259 Ga0068859_101309262
260 Ga0068861_102300211
261 Ga0068863_100127707
262 Ga0068863_100279370
263 Ga0068863_101605187
264 Ga0068858_100301851
265 Ga0068858_101025652
266 Ga0068860_100002742
267 Ga0081455_10005962
268 Ga0075365_10016433
269 Ga0070715_10179710
270 Ga0075366_10885339
271 Ga0097621_100086045
272 Ga0068871_101034591
273 Ga0075428_100070870
274 Ga0075428_100086693
275 Ga0075428_102479484
276 Ga0075430_100002072
277 Ga0075430_100057203
278 Ga0075430_100540440
279 Ga0075431_100015529
280 Ga0075431_100043815
281 Ga0075431_100266269
282 Ga0075429_100428582
283 Ga0075429_101655090
284 Ga0075436_100024258
285 Ga0075436_100440672
286 Ga0097620_100003271
287 Ga0097620_101309272
288 Ga0075435_100075370
289 Ga0105251_10054263
290 Ga0111539_10004480
291 Ga0111539_10034916
292 Ga0111539_10612528
293 Ga0105245_10594063
294 Ga0105245_10620567
295 Ga0105247_10446565
296 Ga0114129_10009022
297 Ga0114129_10174908
298 Ga0114129_10285875
299 Ga0114129_12465680
300 Ga0105243_10215191
301 Ga0105243_10343450
302 Ga0105243_12269870
303 Ga0105241_10017298
304 Ga0105241_10052752
305 Ga0105241_10764219
306 Ga0105248_10004888
307 Ga0105239_12859030
308 Ga0157374_10149864
309 Ga0157374_10622206
310 Ga0157378_10138910
311 Ga0157378_10310903
312 Ga0157378_11044707
313 Ga0157372_10030226
314 Ga0157375_10001863
315 Ga0157379_10023572
316 Ga0157379_11207361
317 Ga0157376_10001352
318 Ga0157376_11036797
319 Ga0157376_11044357
320 Ga0207642_10036886
321 Ga0207680_10001126
322 Ga0207685_10640284
323 Ga0207699_10343622
324 Ga0207705_10756829
325 Ga0207684_10337646
326 Ga0207654_10027984
327 Ga0207654_11388826
328 Ga0207652_10407441
329 Ga0207650_10082966
330 Ga0207659_10000077
331 Ga0207687_10330995
332 Ga0207687_10523971
333 Ga0207686_10029688
334 Ga0207686_10328365
335 Ga0207686_10350531
336 Ga0207670_10428952
337 Ga0207691_10067214
338 Ga0207691_10130900
339 Ga0207711_10000533
340 Ga0207711_10809503
341 Ga0207651_10237576
342 Ga0207712_11587272
343 Ga0207658_10006677
344 Ga0207677_10092060
345 Ga0207677_10908934
346 Ga0207703_10008083
347 Ga0207703_11185388
348 Ga0207678_10263728
349 Ga0207702_10009474
350 Ga0207641_10036473
351 Ga0207641_11395539
352 Ga0207648_10014704
353 Ga0207648_10399885
354 Ga0207676_10118377
355 Ga0207676_10381090
356 Ga0207674_10868149
357 Ga0207683_10447217
358 Ga0207698_11322240
359 Ga0207428_10005433
360 Ga0207428_10074147
361 Ga0268264_10003656
362 Ga0268264_10286823
363 Ga0307408_100301107
364 Ga0307408_100983097
365 Ga0307406_10138704
366 Ga0307407_11146111
367 Ga0307412_10236392
368 Ga0307412_11505664
369 Ga0307416_100304107
370 Ga0307416_100542657
371 Ga0307416_100543895
372 Ga0307416_101403562
373 Ga0307415_101631490
374 Ga0373934_0363135
375 Ga0373945_0239984
376 Ga0373957_0398397
377 Ga0373955_0819054
378 Ga0373933_0209757
379 Ga0436364_0278774
380 Ga0439449_0076385
381 Ga0439450_077861
382 Ga0450923_045976
383 Ga0439464_0002056
384 Ga0439464_0176268
385 Ga0466963_0441879
386 Ga0495592_0442120
387 Ga0495629_0031430
388 Ga0495580_0000871
389 Ga0495580_0818156
390 Ga0495662_0035562
391 Ga0495664_0115408
392 Ga0495618_0583779
393 Ga0495618_0845265
394 Ga0495665_0174030
395 Ga0495640_0546380
396 Ga0495645_0231049
397 Ga0495667_0072550
398 Ga0495635_0125273
399 Ga0495657_0081473
400 Ga0495613_0212096
401 Ga0495674_0272277
402 Ga0495684_0036583
403 Ga0495593_0520173
404 Ga0496100_0004936
405 Ga0496101_0030105
406 Ga0496101_0207265
407 Ga0496102_0001464
408 Ga0496102_0213208
409 Ga0496103_0025959
410 Ga0496103_0106130
411 Ga0496104_0052839
412 Ga0496104_0749744
413 Ga0496105_0584236
414 Ga0496106_0002306
415 Ga0496107_0000369
416 Ga0496108_0110588
417 Ga0496108_1033712
418 Ga0496109_0264227
419 Ga0496110_0012172
420 Ga0496111_0004075
421 Ga0496111_0201294
422 Ga0496113_0486262
423 Ga0501036_0524439
424 Ga0501073_0551630
425 Ga0501079_0723831
426 Ga0501079_0782220
427 Ga0501081_0025939
428 nmdc:mga0yw44_2948_c1
429 nmdc:mga05p37_116463_c1
430 nmdc:mga05p37_2161_c1
431 nmdc:mga05p37_2220632_c1
432 nmdc:mga09592_1562360_c1
433 nmdc:mga09592_1623_c1
434 nmdc:mga09592_264242_c1
435 nmdc:mga0qj67_11435_c1
436 nmdc:mga0qj67_124980_c1
437 nmdc:mga0qj67_33205_c1
438 nmdc:mga06r32_29958_c1
439 nmdc:mga06r32_49142_c1
440 nmdc:mga06r32_66972_c1
441 nmdc:mga06r32_94907_c1
442 nmdc:mga08y16_124696_c1
443 nmdc:mga08y16_169_c1
444 nmdc:mga08y16_202421_c1
445 nmdc:mga0n895_293301_c1
446 nmdc:mga0n895_374756_c1
447 nmdc:mga0rr50_484805_c1
448 nmdc:mga08x19_102712_c1
449 nmdc:mga08x19_1082336_c1
450 nmdc:mga08x19_1100361_c1
451 nmdc:mga0a205_72142_c1
452 Ga0495595_0166321
453 Ga0495619_0019903
454 Ga0501084_0460685
455 Ga0501082_1036656
456 Ga0501082_1321098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9329 14 113
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9172 11 109
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9126 9 112
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9107 11 109
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.896 9 112
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9254 11 107 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9206 14 113 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9107 11 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8891 17 93 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8726 17 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.9981 9 113
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9971 14 112
AF-A0A843S070-F1-model_v4 PadR family transcriptional regulator 0.9939 15 112
AF-A0A495BUS2-F1-model_v4 deleted 0.9931 15 112
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9906 13 112

Map