F341428

General Info

Members Datasets Scaffolds Average Seq Length
228 187 456 170

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0722900|Ga0501072_0722900_165_764
Length 199
Sequence VVTPEASRALYALLVGAVGLERLFELWLTRRNLERARQRGGVEAGRGHYPAMVLLHALFLAACPTEVLLLERPFRPALAAAMLLLLAGAMTLRYWAIATLGERWTTRVVVVPGEAAVTGGPYRRVRHPNYLAVVVEGVALPLVHGAWLTAALFTLANALMLAVRIRAEEAVLRRHADYAERLGDRGRFLPRRRRGAAAR

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
162 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
171 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
172 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
173 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
174 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
175 2643221718 Rhizobium sp. Root268 Isolate Unclassified
176 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
177 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
178 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
179 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
180 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
181 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
182 2996887358 Rhizobium sp. R711 Isolate Nodule
183 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
184 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
185 8005258706 Rhizobium sp. R693 Isolate Nodule
186 8005321885 Rhizobium sp. R72 Isolate Nodule
187 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.09
Nodule 1.75
Rhizoplane 3.51
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0722900 3300049588 Bacteria 782
2 JGI25152J39213_1002571 3300002773 Bacteria 6800
3 JGI25150J39212_1001283 3300002774 Bacteria 7179
4 JGI25151J46595_10000481 3300003187 Bacteria 37750
5 JGI25153J46596_10010868 3300003215 Bacteria 4076
6 rootH1_10125786 3300003316 Bacteria 2564
7 Ga0055524_1001752 3300003775 Bacteria 11985
8 Ga0055528_1000915 3300003790 Bacteria 19887
9 Ga0065165_1003349 3300005262 Bacteria 11399
10 Ga0065712_10074637 3300005290 Bacteria 4046
11 Ga0065715_10138440 3300005293 Bacteria 1892
12 Ga0070658_10029482 3300005327 Bacteria 4409
13 Ga0070658_10492546 3300005327 Bacteria 1058
14 Ga0070670_100001372 3300005331 Bacteria 19498
15 Ga0070677_10036157 3300005333 Bacteria 1919
16 Ga0070666_10041293 3300005335 Bacteria 3082
17 Ga0070660_100616176 3300005339 Bacteria 908
18 Ga0070660_100962341 3300005339 Bacteria 721
19 Ga0070669_100623440 3300005353 Bacteria 905
20 Ga0070675_100007264 3300005354 Bacteria 8547
21 Ga0070671_100003153 3300005355 Bacteria 12853
22 Ga0070671_100574668 3300005355 Bacteria 973
23 Ga0070674_100040276 3300005356 Bacteria 3160
24 Ga0070674_100606052 3300005356 Bacteria 926
25 Ga0070673_100169261 3300005364 Bacteria 1864
26 Ga0070667_100015165 3300005367 Bacteria 6365
27 Ga0070667_100101189 3300005367 Bacteria 2489
28 Ga0070667_100211694 3300005367 Bacteria 1723
29 Ga0070663_100107021 3300005455 Bacteria 2096
30 Ga0070678_101127240 3300005456 Bacteria 725
31 Ga0070662_100028194 3300005457 Bacteria 3905
32 Ga0070707_101329136 3300005468 Bacteria 685
33 Ga0070698_100928620 3300005471 Bacteria 816
34 Ga0070672_100010039 3300005543 Bacteria 6553
35 Ga0070665_100012284 3300005548 Bacteria 8633
36 Ga0068855_101022451 3300005563 Bacteria 867
37 Ga0070664_100016132 3300005564 Bacteria 6123
38 Ga0070664_101303731 3300005564 Bacteria 686
39 Ga0068856_100023968 3300005614 Bacteria 5936
40 Ga0070702_100564816 3300005615 Bacteria 847
41 Ga0068859_100215279 3300005617 Bacteria 2008
42 Ga0068864_100158703 3300005618 Bacteria 2055
43 Ga0068861_100320415 3300005719 Bacteria 1350
44 Ga0068863_100273338 3300005841 Bacteria 1636
45 Ga0068860_102007565 3300005843 Bacteria 600
46 Ga0075368_10412508 3300006042 Bacteria 594
47 Ga0075433_10919229 3300006852 Bacteria 763
48 Ga0097620_100215282 3300006931 Bacteria 2008
49 Ga0105240_10012992 3300009093 Bacteria 11468
50 Ga0105243_10447945 3300009148 Bacteria 1210
51 Ga0105248_10006665 3300009177 Bacteria 12669
52 Ga0105248_10219978 3300009177 Bacteria 2138
53 Ga0105237_10071505 3300009545 Bacteria 3464
54 Ga0105238_11538261 3300009551 Bacteria 694
55 Ga0105239_10010037 3300010375 Bacteria 10616
56 Ga0157371_10457163 3300013102 Bacteria 939
57 Ga0157370_11411942 3300013104 Bacteria 626
58 Ga0163162_11182759 3300013306 Bacteria 867
59 Ga0157375_10009605 3300013308 Bacteria 8498
60 Ga0157375_10185973 3300013308 Bacteria 2231
61 Ga0163163_10052825 3300014325 Bacteria 4010
62 Ga0157380_11201058 3300014326 Bacteria 802
63 Ga0163161_10084610 3300017792 Bacteria 2339
64 Ga0207425_1000263 3300025245 Bacteria 38917
65 Ga0209129_1000350 3300025258 Bacteria 38917
66 Ga0209673_1001003 3300025273 Bacteria 34297
67 Ga0209673_1004673 3300025273 Bacteria 7226
68 Ga0209025_1000603 3300025294 Bacteria 64824
69 Ga0209025_1006052 3300025294 Bacteria 9568
70 Ga0209758_1000201 3300025297 Bacteria 132855
71 Ga0209758_1020027 3300025297 Bacteria 3189
72 Ga0209256_1002871 3300025299 Bacteria 13092
73 Ga0209257_1091574 3300025304 Bacteria 758
74 Ga0207682_10031707 3300025893 Bacteria 2122
75 Ga0207680_10104633 3300025903 Bacteria 1825
76 Ga0207705_10028529 3300025909 Bacteria 3980
77 Ga0207671_10020993 3300025914 Bacteria 4963
78 Ga0207646_10699103 3300025922 Bacteria 907
79 Ga0207681_10011009 3300025923 Bacteria 5555
80 Ga0207681_10113212 3300025923 Bacteria 1978
81 Ga0207681_10934382 3300025923 Bacteria 727
82 Ga0207650_10007148 3300025925 Bacteria 7609
83 Ga0207659_10002293 3300025926 Bacteria 11411
84 Ga0207644_10020331 3300025931 Bacteria 4513
85 Ga0207644_10099106 3300025931 Bacteria 2186
86 Ga0207706_10045088 3300025933 Bacteria 3907
87 Ga0207669_10087865 3300025937 Bacteria 2014
88 Ga0207669_10551403 3300025937 Bacteria 930
89 Ga0207691_10002508 3300025940 Bacteria 17963
90 Ga0207711_10027420 3300025941 Bacteria 4784
91 Ga0207679_10009369 3300025945 Bacteria 6272
92 Ga0207679_10877754 3300025945 Bacteria 820
93 Ga0207651_10218041 3300025960 Bacteria 1540
94 Ga0207658_10010340 3300025986 Bacteria 6340
95 Ga0207658_10202053 3300025986 Bacteria 1660
96 Ga0207678_10059471 3300026067 Bacteria 3288
97 Ga0207702_10000805 3300026078 Bacteria 33235
98 Ga0207702_10017394 3300026078 Bacteria 5948
99 Ga0207676_10216910 3300026095 Bacteria 1701
100 Ga0207675_100283748 3300026118 Bacteria 1609
101 Ga0207683_11202043 3300026121 Bacteria 703
102 Ga0268266_10088615 3300028379 Bacteria 2708
103 Ga0268264_11388192 3300028381 Bacteria 713
104 Ga0265340_10020073 3300031247 Bacteria 3438
105 Ga0265340_10236193 3300031247 Bacteria 816
106 Ga0265316_10523698 3300031344 Bacteria 845
107 Ga0307408_100090001 3300031548 Bacteria 2315
108 Ga0265342_10248438 3300031712 Bacteria 950
109 Ga0316576_10000529 3300031727 Bacteria 17872
110 Ga0316576_10008319 3300031727 Bacteria 6607
111 Ga0316578_10214915 3300031728 Bacteria 1156
112 Ga0316578_10306439 3300031728 Bacteria 949
113 Ga0307405_10004489 3300031731 Bacteria 6603
114 Ga0307405_10142142 3300031731 Bacteria 1675
115 Ga0307413_10080373 3300031824 Bacteria 2087
116 Ga0307410_10051039 3300031852 Bacteria 2785
117 Ga0307410_10358445 3300031852 Bacteria 1167
118 Ga0307407_10788073 3300031903 Bacteria 722
119 Ga0307412_11020350 3300031911 Bacteria 732
120 Ga0307409_100121073 3300031995 Bacteria 2216
121 Ga0307409_100844758 3300031995 Bacteria 926
122 Ga0307416_101647728 3300032002 Bacteria 746
123 Ga0307411_10083612 3300032005 Bacteria 2205
124 Ga0307415_100084624 3300032126 Bacteria 2276
125 Ga0316580_10030754 3300032139 Bacteria 1663
126 Ga0373931_0123051 3300035691 Bacteria 1485
127 Ga0395900_1360102 3300037418 Bacteria 623
128 Ga0395898_0128699 3300037466 Bacteria 2425
129 Ga0395905_0023795 3300037471 Bacteria 5783
130 Ga0436364_1501031 3300037853 Bacteria 5881
131 Ga0436365_0468426 3300039437 Bacteria 3842
132 Ga0451795_1135607 3300041456 Bacteria 694
133 Ga0466966_0062537 3300044684 Bacteria 2347
134 Ga0451576_0629134 3300045051 Bacteria 1128
135 Ga0495585_0038486 3300046492 Bacteria 2692
136 Ga0495610_0000161 3300046512 Bacteria 74599
137 Ga0495620_0026681 3300046515 Bacteria 2713
138 Ga0495620_0081043 3300046515 Bacteria 1313
139 Ga0495632_0072760 3300046519 Bacteria 1649
140 Ga0495643_0142404 3300046522 Bacteria 1194
141 Ga0495663_0092890 3300046525 Bacteria 985
142 Ga0495588_0023666 3300046674 Bacteria 3043
143 Ga0495669_0002396 3300046684 Bacteria 7693
144 Ga0495669_0218603 3300046684 Bacteria 913
145 Ga0495677_0163996 3300047445 Bacteria 858
146 Ga0495673_0023588 3300047469 Bacteria 2990
147 Ga0496100_0968789 3300048903 Unclassified 669
148 Ga0496106_0860145 3300048909 Bacteria 717
149 Ga0496107_0083064 3300048910 Bacteria 2336
150 Ga0496109_0164702 3300048912 Bacteria 2078
151 Ga0496110_0003604 3300048913 Bacteria 11911
152 Ga0496111_0012660 3300048914 Bacteria 5716
153 Ga0496115_0000607 3300048918 Bacteria 27313
154 Ga0496116_0013065 3300048919 Bacteria 6729
155 Ga0496116_0067538 3300048919 Bacteria 2283
156 Ga0496117_0020657 3300048920 Bacteria 5360
157 Ga0496118_0009831 3300048921 Bacteria 9577
158 Ga0496118_0017114 3300048921 Bacteria 6617
159 Ga0496121_0043620 3300048924 Unclassified 3881
160 Ga0496121_0075008 3300048924 Bacteria 2703
161 Ga0496122_0024297 3300048925 Bacteria 5305
162 Ga0496122_0027672 3300048925 Bacteria 4839
163 Ga0496123_0032344 3300048926 Bacteria 3789
164 Ga0496123_0052630 3300048926 Bacteria 2700
165 Ga0496123_0348267 3300048926 Bacteria 690
166 Ga0496124_0000064 3300048927 Bacteria 225176
167 Ga0496124_0475495 3300048927 Bacteria 845
168 Ga0496125_0013830 3300048928 Bacteria 7903
169 Ga0495678_027114 3300049459 Bacteria 2434
170 Ga0501031_0002364 3300049568 Bacteria 11965
171 Ga0501032_0001044 3300049569 Bacteria 22225
172 Ga0501033_0001831 3300049570 Bacteria 18525
173 Ga0501034_0011865 3300049571 Bacteria 9016
174 Ga0501036_0001498 3300049572 Bacteria 18007
175 Ga0501037_0000344 3300049573 Bacteria 39209
176 Ga0501038_0000195 3300049574 Bacteria 52526
177 Ga0501039_0000355 3300049575 Bacteria 32637
178 Ga0501041_0234328 3300049577 Bacteria 1153
179 Ga0501042_0028786 3300049578 Bacteria 3918
180 Ga0501043_0005189 3300049579 Bacteria 10540
181 Ga0501046_0000436 3300049580 Bacteria 41914
182 Ga0501047_0001151 3300049581 Bacteria 26235
183 Ga0501047_0316393 3300049581 Bacteria 1401
184 Ga0501048_0004432 3300049582 Bacteria 10690
185 Ga0501068_0110037 3300049584 Bacteria 1712
186 Ga0501069_0001205 3300049585 Bacteria 12600
187 Ga0501070_0004191 3300049586 Bacteria 12412
188 Ga0501071_0162573 3300049587 Bacteria 1669
189 Ga0501072_0147170 3300049588 Bacteria 1878
190 Ga0501073_0003188 3300049589 Bacteria 12303
191 Ga0501074_0006509 3300049590 Bacteria 8434
192 Ga0501075_0183184 3300049591 Bacteria 1598
193 Ga0501233_171943 3300049668 Bacteria 616
194 Ga0501080_0000080 3300049742 Bacteria 65358
195 Ga0501081_0407872 3300049743 Bacteria 1006
196 Ga0501083_0004936 3300049744 Bacteria 9443
197 Ga0501268_012559 3300049765 Bacteria 1356
198 Ga0501268_062074 3300049765 Bacteria 742
199 Ga0501270_051919 3300049767 Bacteria 745
200 Ga0501035_0008432 3300049822 Bacteria 9598
201 Ga0501044_0003216 3300049823 Bacteria 18405
202 Ga0501044_0023356 3300049823 Bacteria 6577
203 Ga0501044_0320977 3300049823 Bacteria 1473
204 nmdc:mga0yw44_181338_c1 3300050492 Bacteria 1386
205 Ga0500618_001133 3300053125 Bacteria 12921
206 Ga0500618_008725 3300053125 Bacteria 2808
207 Ga0500636_0000026 3300053177 Bacteria 84046
208 Ga0500636_0000409 3300053177 Bacteria 23651
209 Ga0501084_0004874 3300054114 Bacteria 10959
210 Ga0501082_0124340 3300060353 Bacteria 2237
211 2511196797 2510917030 Bacteria 7460662
212 2585258162 2582581304 Bacteria 5831370
213 2585847815 2585427594 Bacteria 6180594
214 2644208513 2643221637 Bacteria 5345260
215 2644497830 2643221689 Bacteria 6042950
216 2644652044 2643221718 Bacteria 5345506
217 2738948549 2738541317 Bacteria 5340176
218 2839994059 2839993093 Bacteria 5512535
219 2854681735 2854681122 Bacteria 4548679
220 2904579666 2904578770 Bacteria 5302906
221 2913313509 2913308742 Bacteria 5350706
222 2919120667 2919119836 Bacteria 5208557
223 2996892153 2996887358 Bacteria 5795980
224 3006325511 3006321560 Bacteria 8247479
225 3006493621 3006486233 Bacteria 8157040
226 8005263497 8005258706 Bacteria 6184835
227 8005326680 8005321885 Bacteria 5795980
228 8024491841 8024486573 Bacteria 6540512
229 Ga0501072_0722900
230 JGI25152J39213_1002571
231 JGI25150J39212_1001283
232 JGI25151J46595_10000481
233 JGI25153J46596_10010868
234 rootH1_10125786
235 Ga0055524_1001752
236 Ga0055528_1000915
237 Ga0065165_1003349
238 Ga0065712_10074637
239 Ga0065715_10138440
240 Ga0070658_10029482
241 Ga0070658_10492546
242 Ga0070670_100001372
243 Ga0070677_10036157
244 Ga0070666_10041293
245 Ga0070660_100616176
246 Ga0070660_100962341
247 Ga0070669_100623440
248 Ga0070675_100007264
249 Ga0070671_100003153
250 Ga0070671_100574668
251 Ga0070674_100040276
252 Ga0070674_100606052
253 Ga0070673_100169261
254 Ga0070667_100015165
255 Ga0070667_100101189
256 Ga0070667_100211694
257 Ga0070663_100107021
258 Ga0070678_101127240
259 Ga0070662_100028194
260 Ga0070707_101329136
261 Ga0070698_100928620
262 Ga0070672_100010039
263 Ga0070665_100012284
264 Ga0068855_101022451
265 Ga0070664_100016132
266 Ga0070664_101303731
267 Ga0068856_100023968
268 Ga0070702_100564816
269 Ga0068859_100215279
270 Ga0068864_100158703
271 Ga0068861_100320415
272 Ga0068863_100273338
273 Ga0068860_102007565
274 Ga0075368_10412508
275 Ga0075433_10919229
276 Ga0097620_100215282
277 Ga0105240_10012992
278 Ga0105243_10447945
279 Ga0105248_10006665
280 Ga0105248_10219978
281 Ga0105237_10071505
282 Ga0105238_11538261
283 Ga0105239_10010037
284 Ga0157371_10457163
285 Ga0157370_11411942
286 Ga0163162_11182759
287 Ga0157375_10009605
288 Ga0157375_10185973
289 Ga0163163_10052825
290 Ga0157380_11201058
291 Ga0163161_10084610
292 Ga0207425_1000263
293 Ga0209129_1000350
294 Ga0209673_1001003
295 Ga0209673_1004673
296 Ga0209025_1000603
297 Ga0209025_1006052
298 Ga0209758_1000201
299 Ga0209758_1020027
300 Ga0209256_1002871
301 Ga0209257_1091574
302 Ga0207682_10031707
303 Ga0207680_10104633
304 Ga0207705_10028529
305 Ga0207671_10020993
306 Ga0207646_10699103
307 Ga0207681_10011009
308 Ga0207681_10113212
309 Ga0207681_10934382
310 Ga0207650_10007148
311 Ga0207659_10002293
312 Ga0207644_10020331
313 Ga0207644_10099106
314 Ga0207706_10045088
315 Ga0207669_10087865
316 Ga0207669_10551403
317 Ga0207691_10002508
318 Ga0207711_10027420
319 Ga0207679_10009369
320 Ga0207679_10877754
321 Ga0207651_10218041
322 Ga0207658_10010340
323 Ga0207658_10202053
324 Ga0207678_10059471
325 Ga0207702_10000805
326 Ga0207702_10017394
327 Ga0207676_10216910
328 Ga0207675_100283748
329 Ga0207683_11202043
330 Ga0268266_10088615
331 Ga0268264_11388192
332 Ga0265340_10020073
333 Ga0265340_10236193
334 Ga0265316_10523698
335 Ga0307408_100090001
336 Ga0265342_10248438
337 Ga0316576_10000529
338 Ga0316576_10008319
339 Ga0316578_10214915
340 Ga0316578_10306439
341 Ga0307405_10004489
342 Ga0307405_10142142
343 Ga0307413_10080373
344 Ga0307410_10051039
345 Ga0307410_10358445
346 Ga0307407_10788073
347 Ga0307412_11020350
348 Ga0307409_100121073
349 Ga0307409_100844758
350 Ga0307416_101647728
351 Ga0307411_10083612
352 Ga0307415_100084624
353 Ga0316580_10030754
354 Ga0373931_0123051
355 Ga0395900_1360102
356 Ga0395898_0128699
357 Ga0395905_0023795
358 Ga0436364_1501031
359 Ga0436365_0468426
360 Ga0451795_1135607
361 Ga0466966_0062537
362 Ga0451576_0629134
363 Ga0495585_0038486
364 Ga0495610_0000161
365 Ga0495620_0026681
366 Ga0495620_0081043
367 Ga0495632_0072760
368 Ga0495643_0142404
369 Ga0495663_0092890
370 Ga0495588_0023666
371 Ga0495669_0002396
372 Ga0495669_0218603
373 Ga0495677_0163996
374 Ga0495673_0023588
375 Ga0496100_0968789
376 Ga0496106_0860145
377 Ga0496107_0083064
378 Ga0496109_0164702
379 Ga0496110_0003604
380 Ga0496111_0012660
381 Ga0496115_0000607
382 Ga0496116_0013065
383 Ga0496116_0067538
384 Ga0496117_0020657
385 Ga0496118_0009831
386 Ga0496118_0017114
387 Ga0496121_0043620
388 Ga0496121_0075008
389 Ga0496122_0024297
390 Ga0496122_0027672
391 Ga0496123_0032344
392 Ga0496123_0052630
393 Ga0496123_0348267
394 Ga0496124_0000064
395 Ga0496124_0475495
396 Ga0496125_0013830
397 Ga0495678_027114
398 Ga0501031_0002364
399 Ga0501032_0001044
400 Ga0501033_0001831
401 Ga0501034_0011865
402 Ga0501036_0001498
403 Ga0501037_0000344
404 Ga0501038_0000195
405 Ga0501039_0000355
406 Ga0501041_0234328
407 Ga0501042_0028786
408 Ga0501043_0005189
409 Ga0501046_0000436
410 Ga0501047_0001151
411 Ga0501047_0316393
412 Ga0501048_0004432
413 Ga0501068_0110037
414 Ga0501069_0001205
415 Ga0501070_0004191
416 Ga0501071_0162573
417 Ga0501072_0147170
418 Ga0501073_0003188
419 Ga0501074_0006509
420 Ga0501075_0183184
421 Ga0501233_171943
422 Ga0501080_0000080
423 Ga0501081_0407872
424 Ga0501083_0004936
425 Ga0501268_012559
426 Ga0501268_062074
427 Ga0501270_051919
428 Ga0501035_0008432
429 Ga0501044_0003216
430 Ga0501044_0023356
431 Ga0501044_0320977
432 nmdc:mga0yw44_181338_c1
433 Ga0500618_001133
434 Ga0500618_008725
435 Ga0500636_0000026
436 Ga0500636_0000409
437 Ga0501084_0004874
438 Ga0501082_0124340
439 2511196797
440 2585258162
441 2585847815
442 2644208513
443 2644497830
444 2644652044
445 2738948549
446 2839994059
447 2854681735
448 2904579666
449 2913313509
450 2919120667
451 2996892153
452 3006325511
453 3006493621
454 8005263497
455 8005326680
456 8024491841

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

80

174

0.92

PF04191

PEMT

Phospholipid methyltransferase

77

181

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.7532 46 159
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.7486 68 151
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.7158 3 172
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.6818 3 172
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.6351 41 167
ID Description Score Start End Superfamily
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9425 4 159 1.20.120.1630
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8925 4 159 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8899 4 157 1.20.120.1630
af_F1R5J9_127_285_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8803 67 159 1.20.120.1630
af_Q8I555_347_506_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8566 67 159 1.20.120.1630
ID Description Score Start End GO Terms
AF-H4F634-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9978 4 167 GO:0004671
GO:0016020
GO:0032259
AF-A0A429VCJ9-F1-model_v4 Methyltransferase 0.997 4 162 GO:0004671
GO:0016020
AF-A0A559SRX6-F1-model_v4 Methyltransferase 0.9966 1 165 GO:0004671
GO:0016020
GO:0032259
AF-A0A5N3PA60-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9948 1 177 GO:0004671
GO:0016020
AF-A0A2K9EN92-F1-model_v4 Chalcone/stilbene synthase N-terminal domain-containing protein 0.9921 4 164 GO:0004671
GO:0016020
GO:0016746

Map