F341428
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 228 | 187 | 456 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0722900|Ga0501072_0722900_165_764 |
| Length | 199 |
| Sequence | VVTPEASRALYALLVGAVGLERLFELWLTRRNLERARQRGGVEAGRGHYPAMVLLHALFLAACPTEVLLLERPFRPALAAAMLLLLAGAMTLRYWAIATLGERWTTRVVVVPGEAAVTGGPYRRVRHPNYLAVVVEGVALPLVHGAWLTAALFTLANALMLAVRIRAEEAVLRRHADYAERLGDRGRFLPRRRRGAAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 86 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 90 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 99 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 100 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 101 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 107 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 108 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 109 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 110 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 122 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 125 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 126 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 127 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 128 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 129 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 130 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 131 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 132 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 133 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 135 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 162 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 171 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 172 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 173 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 174 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 175 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 176 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 177 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 178 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 179 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 180 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 181 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 182 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 183 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 184 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 185 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 186 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 187 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.11 |
| Metatranscriptomes | 0 |
| Isolates | 7.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.09 |
| Nodule | 1.75 |
| Rhizoplane | 3.51 |
| Rhizosphere | 72.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501072_0722900 | 3300049588 | Bacteria | 782 |
| 2 | JGI25152J39213_1002571 | 3300002773 | Bacteria | 6800 |
| 3 | JGI25150J39212_1001283 | 3300002774 | Bacteria | 7179 |
| 4 | JGI25151J46595_10000481 | 3300003187 | Bacteria | 37750 |
| 5 | JGI25153J46596_10010868 | 3300003215 | Bacteria | 4076 |
| 6 | rootH1_10125786 | 3300003316 | Bacteria | 2564 |
| 7 | Ga0055524_1001752 | 3300003775 | Bacteria | 11985 |
| 8 | Ga0055528_1000915 | 3300003790 | Bacteria | 19887 |
| 9 | Ga0065165_1003349 | 3300005262 | Bacteria | 11399 |
| 10 | Ga0065712_10074637 | 3300005290 | Bacteria | 4046 |
| 11 | Ga0065715_10138440 | 3300005293 | Bacteria | 1892 |
| 12 | Ga0070658_10029482 | 3300005327 | Bacteria | 4409 |
| 13 | Ga0070658_10492546 | 3300005327 | Bacteria | 1058 |
| 14 | Ga0070670_100001372 | 3300005331 | Bacteria | 19498 |
| 15 | Ga0070677_10036157 | 3300005333 | Bacteria | 1919 |
| 16 | Ga0070666_10041293 | 3300005335 | Bacteria | 3082 |
| 17 | Ga0070660_100616176 | 3300005339 | Bacteria | 908 |
| 18 | Ga0070660_100962341 | 3300005339 | Bacteria | 721 |
| 19 | Ga0070669_100623440 | 3300005353 | Bacteria | 905 |
| 20 | Ga0070675_100007264 | 3300005354 | Bacteria | 8547 |
| 21 | Ga0070671_100003153 | 3300005355 | Bacteria | 12853 |
| 22 | Ga0070671_100574668 | 3300005355 | Bacteria | 973 |
| 23 | Ga0070674_100040276 | 3300005356 | Bacteria | 3160 |
| 24 | Ga0070674_100606052 | 3300005356 | Bacteria | 926 |
| 25 | Ga0070673_100169261 | 3300005364 | Bacteria | 1864 |
| 26 | Ga0070667_100015165 | 3300005367 | Bacteria | 6365 |
| 27 | Ga0070667_100101189 | 3300005367 | Bacteria | 2489 |
| 28 | Ga0070667_100211694 | 3300005367 | Bacteria | 1723 |
| 29 | Ga0070663_100107021 | 3300005455 | Bacteria | 2096 |
| 30 | Ga0070678_101127240 | 3300005456 | Bacteria | 725 |
| 31 | Ga0070662_100028194 | 3300005457 | Bacteria | 3905 |
| 32 | Ga0070707_101329136 | 3300005468 | Bacteria | 685 |
| 33 | Ga0070698_100928620 | 3300005471 | Bacteria | 816 |
| 34 | Ga0070672_100010039 | 3300005543 | Bacteria | 6553 |
| 35 | Ga0070665_100012284 | 3300005548 | Bacteria | 8633 |
| 36 | Ga0068855_101022451 | 3300005563 | Bacteria | 867 |
| 37 | Ga0070664_100016132 | 3300005564 | Bacteria | 6123 |
| 38 | Ga0070664_101303731 | 3300005564 | Bacteria | 686 |
| 39 | Ga0068856_100023968 | 3300005614 | Bacteria | 5936 |
| 40 | Ga0070702_100564816 | 3300005615 | Bacteria | 847 |
| 41 | Ga0068859_100215279 | 3300005617 | Bacteria | 2008 |
| 42 | Ga0068864_100158703 | 3300005618 | Bacteria | 2055 |
| 43 | Ga0068861_100320415 | 3300005719 | Bacteria | 1350 |
| 44 | Ga0068863_100273338 | 3300005841 | Bacteria | 1636 |
| 45 | Ga0068860_102007565 | 3300005843 | Bacteria | 600 |
| 46 | Ga0075368_10412508 | 3300006042 | Bacteria | 594 |
| 47 | Ga0075433_10919229 | 3300006852 | Bacteria | 763 |
| 48 | Ga0097620_100215282 | 3300006931 | Bacteria | 2008 |
| 49 | Ga0105240_10012992 | 3300009093 | Bacteria | 11468 |
| 50 | Ga0105243_10447945 | 3300009148 | Bacteria | 1210 |
| 51 | Ga0105248_10006665 | 3300009177 | Bacteria | 12669 |
| 52 | Ga0105248_10219978 | 3300009177 | Bacteria | 2138 |
| 53 | Ga0105237_10071505 | 3300009545 | Bacteria | 3464 |
| 54 | Ga0105238_11538261 | 3300009551 | Bacteria | 694 |
| 55 | Ga0105239_10010037 | 3300010375 | Bacteria | 10616 |
| 56 | Ga0157371_10457163 | 3300013102 | Bacteria | 939 |
| 57 | Ga0157370_11411942 | 3300013104 | Bacteria | 626 |
| 58 | Ga0163162_11182759 | 3300013306 | Bacteria | 867 |
| 59 | Ga0157375_10009605 | 3300013308 | Bacteria | 8498 |
| 60 | Ga0157375_10185973 | 3300013308 | Bacteria | 2231 |
| 61 | Ga0163163_10052825 | 3300014325 | Bacteria | 4010 |
| 62 | Ga0157380_11201058 | 3300014326 | Bacteria | 802 |
| 63 | Ga0163161_10084610 | 3300017792 | Bacteria | 2339 |
| 64 | Ga0207425_1000263 | 3300025245 | Bacteria | 38917 |
| 65 | Ga0209129_1000350 | 3300025258 | Bacteria | 38917 |
| 66 | Ga0209673_1001003 | 3300025273 | Bacteria | 34297 |
| 67 | Ga0209673_1004673 | 3300025273 | Bacteria | 7226 |
| 68 | Ga0209025_1000603 | 3300025294 | Bacteria | 64824 |
| 69 | Ga0209025_1006052 | 3300025294 | Bacteria | 9568 |
| 70 | Ga0209758_1000201 | 3300025297 | Bacteria | 132855 |
| 71 | Ga0209758_1020027 | 3300025297 | Bacteria | 3189 |
| 72 | Ga0209256_1002871 | 3300025299 | Bacteria | 13092 |
| 73 | Ga0209257_1091574 | 3300025304 | Bacteria | 758 |
| 74 | Ga0207682_10031707 | 3300025893 | Bacteria | 2122 |
| 75 | Ga0207680_10104633 | 3300025903 | Bacteria | 1825 |
| 76 | Ga0207705_10028529 | 3300025909 | Bacteria | 3980 |
| 77 | Ga0207671_10020993 | 3300025914 | Bacteria | 4963 |
| 78 | Ga0207646_10699103 | 3300025922 | Bacteria | 907 |
| 79 | Ga0207681_10011009 | 3300025923 | Bacteria | 5555 |
| 80 | Ga0207681_10113212 | 3300025923 | Bacteria | 1978 |
| 81 | Ga0207681_10934382 | 3300025923 | Bacteria | 727 |
| 82 | Ga0207650_10007148 | 3300025925 | Bacteria | 7609 |
| 83 | Ga0207659_10002293 | 3300025926 | Bacteria | 11411 |
| 84 | Ga0207644_10020331 | 3300025931 | Bacteria | 4513 |
| 85 | Ga0207644_10099106 | 3300025931 | Bacteria | 2186 |
| 86 | Ga0207706_10045088 | 3300025933 | Bacteria | 3907 |
| 87 | Ga0207669_10087865 | 3300025937 | Bacteria | 2014 |
| 88 | Ga0207669_10551403 | 3300025937 | Bacteria | 930 |
| 89 | Ga0207691_10002508 | 3300025940 | Bacteria | 17963 |
| 90 | Ga0207711_10027420 | 3300025941 | Bacteria | 4784 |
| 91 | Ga0207679_10009369 | 3300025945 | Bacteria | 6272 |
| 92 | Ga0207679_10877754 | 3300025945 | Bacteria | 820 |
| 93 | Ga0207651_10218041 | 3300025960 | Bacteria | 1540 |
| 94 | Ga0207658_10010340 | 3300025986 | Bacteria | 6340 |
| 95 | Ga0207658_10202053 | 3300025986 | Bacteria | 1660 |
| 96 | Ga0207678_10059471 | 3300026067 | Bacteria | 3288 |
| 97 | Ga0207702_10000805 | 3300026078 | Bacteria | 33235 |
| 98 | Ga0207702_10017394 | 3300026078 | Bacteria | 5948 |
| 99 | Ga0207676_10216910 | 3300026095 | Bacteria | 1701 |
| 100 | Ga0207675_100283748 | 3300026118 | Bacteria | 1609 |
| 101 | Ga0207683_11202043 | 3300026121 | Bacteria | 703 |
| 102 | Ga0268266_10088615 | 3300028379 | Bacteria | 2708 |
| 103 | Ga0268264_11388192 | 3300028381 | Bacteria | 713 |
| 104 | Ga0265340_10020073 | 3300031247 | Bacteria | 3438 |
| 105 | Ga0265340_10236193 | 3300031247 | Bacteria | 816 |
| 106 | Ga0265316_10523698 | 3300031344 | Bacteria | 845 |
| 107 | Ga0307408_100090001 | 3300031548 | Bacteria | 2315 |
| 108 | Ga0265342_10248438 | 3300031712 | Bacteria | 950 |
| 109 | Ga0316576_10000529 | 3300031727 | Bacteria | 17872 |
| 110 | Ga0316576_10008319 | 3300031727 | Bacteria | 6607 |
| 111 | Ga0316578_10214915 | 3300031728 | Bacteria | 1156 |
| 112 | Ga0316578_10306439 | 3300031728 | Bacteria | 949 |
| 113 | Ga0307405_10004489 | 3300031731 | Bacteria | 6603 |
| 114 | Ga0307405_10142142 | 3300031731 | Bacteria | 1675 |
| 115 | Ga0307413_10080373 | 3300031824 | Bacteria | 2087 |
| 116 | Ga0307410_10051039 | 3300031852 | Bacteria | 2785 |
| 117 | Ga0307410_10358445 | 3300031852 | Bacteria | 1167 |
| 118 | Ga0307407_10788073 | 3300031903 | Bacteria | 722 |
| 119 | Ga0307412_11020350 | 3300031911 | Bacteria | 732 |
| 120 | Ga0307409_100121073 | 3300031995 | Bacteria | 2216 |
| 121 | Ga0307409_100844758 | 3300031995 | Bacteria | 926 |
| 122 | Ga0307416_101647728 | 3300032002 | Bacteria | 746 |
| 123 | Ga0307411_10083612 | 3300032005 | Bacteria | 2205 |
| 124 | Ga0307415_100084624 | 3300032126 | Bacteria | 2276 |
| 125 | Ga0316580_10030754 | 3300032139 | Bacteria | 1663 |
| 126 | Ga0373931_0123051 | 3300035691 | Bacteria | 1485 |
| 127 | Ga0395900_1360102 | 3300037418 | Bacteria | 623 |
| 128 | Ga0395898_0128699 | 3300037466 | Bacteria | 2425 |
| 129 | Ga0395905_0023795 | 3300037471 | Bacteria | 5783 |
| 130 | Ga0436364_1501031 | 3300037853 | Bacteria | 5881 |
| 131 | Ga0436365_0468426 | 3300039437 | Bacteria | 3842 |
| 132 | Ga0451795_1135607 | 3300041456 | Bacteria | 694 |
| 133 | Ga0466966_0062537 | 3300044684 | Bacteria | 2347 |
| 134 | Ga0451576_0629134 | 3300045051 | Bacteria | 1128 |
| 135 | Ga0495585_0038486 | 3300046492 | Bacteria | 2692 |
| 136 | Ga0495610_0000161 | 3300046512 | Bacteria | 74599 |
| 137 | Ga0495620_0026681 | 3300046515 | Bacteria | 2713 |
| 138 | Ga0495620_0081043 | 3300046515 | Bacteria | 1313 |
| 139 | Ga0495632_0072760 | 3300046519 | Bacteria | 1649 |
| 140 | Ga0495643_0142404 | 3300046522 | Bacteria | 1194 |
| 141 | Ga0495663_0092890 | 3300046525 | Bacteria | 985 |
| 142 | Ga0495588_0023666 | 3300046674 | Bacteria | 3043 |
| 143 | Ga0495669_0002396 | 3300046684 | Bacteria | 7693 |
| 144 | Ga0495669_0218603 | 3300046684 | Bacteria | 913 |
| 145 | Ga0495677_0163996 | 3300047445 | Bacteria | 858 |
| 146 | Ga0495673_0023588 | 3300047469 | Bacteria | 2990 |
| 147 | Ga0496100_0968789 | 3300048903 | Unclassified | 669 |
| 148 | Ga0496106_0860145 | 3300048909 | Bacteria | 717 |
| 149 | Ga0496107_0083064 | 3300048910 | Bacteria | 2336 |
| 150 | Ga0496109_0164702 | 3300048912 | Bacteria | 2078 |
| 151 | Ga0496110_0003604 | 3300048913 | Bacteria | 11911 |
| 152 | Ga0496111_0012660 | 3300048914 | Bacteria | 5716 |
| 153 | Ga0496115_0000607 | 3300048918 | Bacteria | 27313 |
| 154 | Ga0496116_0013065 | 3300048919 | Bacteria | 6729 |
| 155 | Ga0496116_0067538 | 3300048919 | Bacteria | 2283 |
| 156 | Ga0496117_0020657 | 3300048920 | Bacteria | 5360 |
| 157 | Ga0496118_0009831 | 3300048921 | Bacteria | 9577 |
| 158 | Ga0496118_0017114 | 3300048921 | Bacteria | 6617 |
| 159 | Ga0496121_0043620 | 3300048924 | Unclassified | 3881 |
| 160 | Ga0496121_0075008 | 3300048924 | Bacteria | 2703 |
| 161 | Ga0496122_0024297 | 3300048925 | Bacteria | 5305 |
| 162 | Ga0496122_0027672 | 3300048925 | Bacteria | 4839 |
| 163 | Ga0496123_0032344 | 3300048926 | Bacteria | 3789 |
| 164 | Ga0496123_0052630 | 3300048926 | Bacteria | 2700 |
| 165 | Ga0496123_0348267 | 3300048926 | Bacteria | 690 |
| 166 | Ga0496124_0000064 | 3300048927 | Bacteria | 225176 |
| 167 | Ga0496124_0475495 | 3300048927 | Bacteria | 845 |
| 168 | Ga0496125_0013830 | 3300048928 | Bacteria | 7903 |
| 169 | Ga0495678_027114 | 3300049459 | Bacteria | 2434 |
| 170 | Ga0501031_0002364 | 3300049568 | Bacteria | 11965 |
| 171 | Ga0501032_0001044 | 3300049569 | Bacteria | 22225 |
| 172 | Ga0501033_0001831 | 3300049570 | Bacteria | 18525 |
| 173 | Ga0501034_0011865 | 3300049571 | Bacteria | 9016 |
| 174 | Ga0501036_0001498 | 3300049572 | Bacteria | 18007 |
| 175 | Ga0501037_0000344 | 3300049573 | Bacteria | 39209 |
| 176 | Ga0501038_0000195 | 3300049574 | Bacteria | 52526 |
| 177 | Ga0501039_0000355 | 3300049575 | Bacteria | 32637 |
| 178 | Ga0501041_0234328 | 3300049577 | Bacteria | 1153 |
| 179 | Ga0501042_0028786 | 3300049578 | Bacteria | 3918 |
| 180 | Ga0501043_0005189 | 3300049579 | Bacteria | 10540 |
| 181 | Ga0501046_0000436 | 3300049580 | Bacteria | 41914 |
| 182 | Ga0501047_0001151 | 3300049581 | Bacteria | 26235 |
| 183 | Ga0501047_0316393 | 3300049581 | Bacteria | 1401 |
| 184 | Ga0501048_0004432 | 3300049582 | Bacteria | 10690 |
| 185 | Ga0501068_0110037 | 3300049584 | Bacteria | 1712 |
| 186 | Ga0501069_0001205 | 3300049585 | Bacteria | 12600 |
| 187 | Ga0501070_0004191 | 3300049586 | Bacteria | 12412 |
| 188 | Ga0501071_0162573 | 3300049587 | Bacteria | 1669 |
| 189 | Ga0501072_0147170 | 3300049588 | Bacteria | 1878 |
| 190 | Ga0501073_0003188 | 3300049589 | Bacteria | 12303 |
| 191 | Ga0501074_0006509 | 3300049590 | Bacteria | 8434 |
| 192 | Ga0501075_0183184 | 3300049591 | Bacteria | 1598 |
| 193 | Ga0501233_171943 | 3300049668 | Bacteria | 616 |
| 194 | Ga0501080_0000080 | 3300049742 | Bacteria | 65358 |
| 195 | Ga0501081_0407872 | 3300049743 | Bacteria | 1006 |
| 196 | Ga0501083_0004936 | 3300049744 | Bacteria | 9443 |
| 197 | Ga0501268_012559 | 3300049765 | Bacteria | 1356 |
| 198 | Ga0501268_062074 | 3300049765 | Bacteria | 742 |
| 199 | Ga0501270_051919 | 3300049767 | Bacteria | 745 |
| 200 | Ga0501035_0008432 | 3300049822 | Bacteria | 9598 |
| 201 | Ga0501044_0003216 | 3300049823 | Bacteria | 18405 |
| 202 | Ga0501044_0023356 | 3300049823 | Bacteria | 6577 |
| 203 | Ga0501044_0320977 | 3300049823 | Bacteria | 1473 |
| 204 | nmdc:mga0yw44_181338_c1 | 3300050492 | Bacteria | 1386 |
| 205 | Ga0500618_001133 | 3300053125 | Bacteria | 12921 |
| 206 | Ga0500618_008725 | 3300053125 | Bacteria | 2808 |
| 207 | Ga0500636_0000026 | 3300053177 | Bacteria | 84046 |
| 208 | Ga0500636_0000409 | 3300053177 | Bacteria | 23651 |
| 209 | Ga0501084_0004874 | 3300054114 | Bacteria | 10959 |
| 210 | Ga0501082_0124340 | 3300060353 | Bacteria | 2237 |
| 211 | 2511196797 | 2510917030 | Bacteria | 7460662 |
| 212 | 2585258162 | 2582581304 | Bacteria | 5831370 |
| 213 | 2585847815 | 2585427594 | Bacteria | 6180594 |
| 214 | 2644208513 | 2643221637 | Bacteria | 5345260 |
| 215 | 2644497830 | 2643221689 | Bacteria | 6042950 |
| 216 | 2644652044 | 2643221718 | Bacteria | 5345506 |
| 217 | 2738948549 | 2738541317 | Bacteria | 5340176 |
| 218 | 2839994059 | 2839993093 | Bacteria | 5512535 |
| 219 | 2854681735 | 2854681122 | Bacteria | 4548679 |
| 220 | 2904579666 | 2904578770 | Bacteria | 5302906 |
| 221 | 2913313509 | 2913308742 | Bacteria | 5350706 |
| 222 | 2919120667 | 2919119836 | Bacteria | 5208557 |
| 223 | 2996892153 | 2996887358 | Bacteria | 5795980 |
| 224 | 3006325511 | 3006321560 | Bacteria | 8247479 |
| 225 | 3006493621 | 3006486233 | Bacteria | 8157040 |
| 226 | 8005263497 | 8005258706 | Bacteria | 6184835 |
| 227 | 8005326680 | 8005321885 | Bacteria | 5795980 |
| 228 | 8024491841 | 8024486573 | Bacteria | 6540512 |
| 229 | Ga0501072_0722900 | |||
| 230 | JGI25152J39213_1002571 | |||
| 231 | JGI25150J39212_1001283 | |||
| 232 | JGI25151J46595_10000481 | |||
| 233 | JGI25153J46596_10010868 | |||
| 234 | rootH1_10125786 | |||
| 235 | Ga0055524_1001752 | |||
| 236 | Ga0055528_1000915 | |||
| 237 | Ga0065165_1003349 | |||
| 238 | Ga0065712_10074637 | |||
| 239 | Ga0065715_10138440 | |||
| 240 | Ga0070658_10029482 | |||
| 241 | Ga0070658_10492546 | |||
| 242 | Ga0070670_100001372 | |||
| 243 | Ga0070677_10036157 | |||
| 244 | Ga0070666_10041293 | |||
| 245 | Ga0070660_100616176 | |||
| 246 | Ga0070660_100962341 | |||
| 247 | Ga0070669_100623440 | |||
| 248 | Ga0070675_100007264 | |||
| 249 | Ga0070671_100003153 | |||
| 250 | Ga0070671_100574668 | |||
| 251 | Ga0070674_100040276 | |||
| 252 | Ga0070674_100606052 | |||
| 253 | Ga0070673_100169261 | |||
| 254 | Ga0070667_100015165 | |||
| 255 | Ga0070667_100101189 | |||
| 256 | Ga0070667_100211694 | |||
| 257 | Ga0070663_100107021 | |||
| 258 | Ga0070678_101127240 | |||
| 259 | Ga0070662_100028194 | |||
| 260 | Ga0070707_101329136 | |||
| 261 | Ga0070698_100928620 | |||
| 262 | Ga0070672_100010039 | |||
| 263 | Ga0070665_100012284 | |||
| 264 | Ga0068855_101022451 | |||
| 265 | Ga0070664_100016132 | |||
| 266 | Ga0070664_101303731 | |||
| 267 | Ga0068856_100023968 | |||
| 268 | Ga0070702_100564816 | |||
| 269 | Ga0068859_100215279 | |||
| 270 | Ga0068864_100158703 | |||
| 271 | Ga0068861_100320415 | |||
| 272 | Ga0068863_100273338 | |||
| 273 | Ga0068860_102007565 | |||
| 274 | Ga0075368_10412508 | |||
| 275 | Ga0075433_10919229 | |||
| 276 | Ga0097620_100215282 | |||
| 277 | Ga0105240_10012992 | |||
| 278 | Ga0105243_10447945 | |||
| 279 | Ga0105248_10006665 | |||
| 280 | Ga0105248_10219978 | |||
| 281 | Ga0105237_10071505 | |||
| 282 | Ga0105238_11538261 | |||
| 283 | Ga0105239_10010037 | |||
| 284 | Ga0157371_10457163 | |||
| 285 | Ga0157370_11411942 | |||
| 286 | Ga0163162_11182759 | |||
| 287 | Ga0157375_10009605 | |||
| 288 | Ga0157375_10185973 | |||
| 289 | Ga0163163_10052825 | |||
| 290 | Ga0157380_11201058 | |||
| 291 | Ga0163161_10084610 | |||
| 292 | Ga0207425_1000263 | |||
| 293 | Ga0209129_1000350 | |||
| 294 | Ga0209673_1001003 | |||
| 295 | Ga0209673_1004673 | |||
| 296 | Ga0209025_1000603 | |||
| 297 | Ga0209025_1006052 | |||
| 298 | Ga0209758_1000201 | |||
| 299 | Ga0209758_1020027 | |||
| 300 | Ga0209256_1002871 | |||
| 301 | Ga0209257_1091574 | |||
| 302 | Ga0207682_10031707 | |||
| 303 | Ga0207680_10104633 | |||
| 304 | Ga0207705_10028529 | |||
| 305 | Ga0207671_10020993 | |||
| 306 | Ga0207646_10699103 | |||
| 307 | Ga0207681_10011009 | |||
| 308 | Ga0207681_10113212 | |||
| 309 | Ga0207681_10934382 | |||
| 310 | Ga0207650_10007148 | |||
| 311 | Ga0207659_10002293 | |||
| 312 | Ga0207644_10020331 | |||
| 313 | Ga0207644_10099106 | |||
| 314 | Ga0207706_10045088 | |||
| 315 | Ga0207669_10087865 | |||
| 316 | Ga0207669_10551403 | |||
| 317 | Ga0207691_10002508 | |||
| 318 | Ga0207711_10027420 | |||
| 319 | Ga0207679_10009369 | |||
| 320 | Ga0207679_10877754 | |||
| 321 | Ga0207651_10218041 | |||
| 322 | Ga0207658_10010340 | |||
| 323 | Ga0207658_10202053 | |||
| 324 | Ga0207678_10059471 | |||
| 325 | Ga0207702_10000805 | |||
| 326 | Ga0207702_10017394 | |||
| 327 | Ga0207676_10216910 | |||
| 328 | Ga0207675_100283748 | |||
| 329 | Ga0207683_11202043 | |||
| 330 | Ga0268266_10088615 | |||
| 331 | Ga0268264_11388192 | |||
| 332 | Ga0265340_10020073 | |||
| 333 | Ga0265340_10236193 | |||
| 334 | Ga0265316_10523698 | |||
| 335 | Ga0307408_100090001 | |||
| 336 | Ga0265342_10248438 | |||
| 337 | Ga0316576_10000529 | |||
| 338 | Ga0316576_10008319 | |||
| 339 | Ga0316578_10214915 | |||
| 340 | Ga0316578_10306439 | |||
| 341 | Ga0307405_10004489 | |||
| 342 | Ga0307405_10142142 | |||
| 343 | Ga0307413_10080373 | |||
| 344 | Ga0307410_10051039 | |||
| 345 | Ga0307410_10358445 | |||
| 346 | Ga0307407_10788073 | |||
| 347 | Ga0307412_11020350 | |||
| 348 | Ga0307409_100121073 | |||
| 349 | Ga0307409_100844758 | |||
| 350 | Ga0307416_101647728 | |||
| 351 | Ga0307411_10083612 | |||
| 352 | Ga0307415_100084624 | |||
| 353 | Ga0316580_10030754 | |||
| 354 | Ga0373931_0123051 | |||
| 355 | Ga0395900_1360102 | |||
| 356 | Ga0395898_0128699 | |||
| 357 | Ga0395905_0023795 | |||
| 358 | Ga0436364_1501031 | |||
| 359 | Ga0436365_0468426 | |||
| 360 | Ga0451795_1135607 | |||
| 361 | Ga0466966_0062537 | |||
| 362 | Ga0451576_0629134 | |||
| 363 | Ga0495585_0038486 | |||
| 364 | Ga0495610_0000161 | |||
| 365 | Ga0495620_0026681 | |||
| 366 | Ga0495620_0081043 | |||
| 367 | Ga0495632_0072760 | |||
| 368 | Ga0495643_0142404 | |||
| 369 | Ga0495663_0092890 | |||
| 370 | Ga0495588_0023666 | |||
| 371 | Ga0495669_0002396 | |||
| 372 | Ga0495669_0218603 | |||
| 373 | Ga0495677_0163996 | |||
| 374 | Ga0495673_0023588 | |||
| 375 | Ga0496100_0968789 | |||
| 376 | Ga0496106_0860145 | |||
| 377 | Ga0496107_0083064 | |||
| 378 | Ga0496109_0164702 | |||
| 379 | Ga0496110_0003604 | |||
| 380 | Ga0496111_0012660 | |||
| 381 | Ga0496115_0000607 | |||
| 382 | Ga0496116_0013065 | |||
| 383 | Ga0496116_0067538 | |||
| 384 | Ga0496117_0020657 | |||
| 385 | Ga0496118_0009831 | |||
| 386 | Ga0496118_0017114 | |||
| 387 | Ga0496121_0043620 | |||
| 388 | Ga0496121_0075008 | |||
| 389 | Ga0496122_0024297 | |||
| 390 | Ga0496122_0027672 | |||
| 391 | Ga0496123_0032344 | |||
| 392 | Ga0496123_0052630 | |||
| 393 | Ga0496123_0348267 | |||
| 394 | Ga0496124_0000064 | |||
| 395 | Ga0496124_0475495 | |||
| 396 | Ga0496125_0013830 | |||
| 397 | Ga0495678_027114 | |||
| 398 | Ga0501031_0002364 | |||
| 399 | Ga0501032_0001044 | |||
| 400 | Ga0501033_0001831 | |||
| 401 | Ga0501034_0011865 | |||
| 402 | Ga0501036_0001498 | |||
| 403 | Ga0501037_0000344 | |||
| 404 | Ga0501038_0000195 | |||
| 405 | Ga0501039_0000355 | |||
| 406 | Ga0501041_0234328 | |||
| 407 | Ga0501042_0028786 | |||
| 408 | Ga0501043_0005189 | |||
| 409 | Ga0501046_0000436 | |||
| 410 | Ga0501047_0001151 | |||
| 411 | Ga0501047_0316393 | |||
| 412 | Ga0501048_0004432 | |||
| 413 | Ga0501068_0110037 | |||
| 414 | Ga0501069_0001205 | |||
| 415 | Ga0501070_0004191 | |||
| 416 | Ga0501071_0162573 | |||
| 417 | Ga0501072_0147170 | |||
| 418 | Ga0501073_0003188 | |||
| 419 | Ga0501074_0006509 | |||
| 420 | Ga0501075_0183184 | |||
| 421 | Ga0501233_171943 | |||
| 422 | Ga0501080_0000080 | |||
| 423 | Ga0501081_0407872 | |||
| 424 | Ga0501083_0004936 | |||
| 425 | Ga0501268_012559 | |||
| 426 | Ga0501268_062074 | |||
| 427 | Ga0501270_051919 | |||
| 428 | Ga0501035_0008432 | |||
| 429 | Ga0501044_0003216 | |||
| 430 | Ga0501044_0023356 | |||
| 431 | Ga0501044_0320977 | |||
| 432 | nmdc:mga0yw44_181338_c1 | |||
| 433 | Ga0500618_001133 | |||
| 434 | Ga0500618_008725 | |||
| 435 | Ga0500636_0000026 | |||
| 436 | Ga0500636_0000409 | |||
| 437 | Ga0501084_0004874 | |||
| 438 | Ga0501082_0124340 | |||
| 439 | 2511196797 | |||
| 440 | 2585258162 | |||
| 441 | 2585847815 | |||
| 442 | 2644208513 | |||
| 443 | 2644497830 | |||
| 444 | 2644652044 | |||
| 445 | 2738948549 | |||
| 446 | 2839994059 | |||
| 447 | 2854681735 | |||
| 448 | 2904579666 | |||
| 449 | 2913313509 | |||
| 450 | 2919120667 | |||
| 451 | 2996892153 | |||
| 452 | 3006325511 | |||
| 453 | 3006493621 | |||
| 454 | 8005263497 | |||
| 455 | 8005326680 | |||
| 456 | 8024491841 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.7532 | 46 | 159 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.7486 | 68 | 151 |
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.7158 | 3 | 172 |
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.6818 | 3 | 172 |
| 5vg9-assembly1.cif.gz_A | structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody | 0.6351 | 41 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06539_1_164_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9425 | 4 | 159 | 1.20.120.1630 |
| af_O06539_1_164_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8925 | 4 | 159 | 1.20.120.1630 |
| af_Q2G1E3_21_189_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8899 | 4 | 157 | 1.20.120.1630 |
| af_F1R5J9_127_285_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8803 | 67 | 159 | 1.20.120.1630 |
| af_Q8I555_347_506_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8566 | 67 | 159 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H4F634-F1-model_v4 | Isoprenylcysteine carboxyl methyltransferase | 0.9978 | 4 | 167 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A429VCJ9-F1-model_v4 | Methyltransferase | 0.997 | 4 | 162 |
GO:0004671
GO:0016020 |
| AF-A0A559SRX6-F1-model_v4 | Methyltransferase | 0.9966 | 1 | 165 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A5N3PA60-F1-model_v4 | Isoprenylcysteine carboxyl methyltransferase | 0.9948 | 1 | 177 |
GO:0004671
GO:0016020 |
| AF-A0A2K9EN92-F1-model_v4 | Chalcone/stilbene synthase N-terminal domain-containing protein | 0.9921 | 4 | 164 |
GO:0004671
GO:0016020 GO:0016746 |