F341081

General Info

Members Datasets Scaffolds Average Seq Length
228 151 456 248

Family's Representative Sequence

Representative Sequence 3300027671|Ga0209588_1001561|Ga0209588_10015611
Length 274
Sequence VLVCALAGESIAMALGEIGSMGGSGLDGKVVLVTGSSRGIGAAIARLFAQQGAKVAVHGRDTAAIAAVRSDIESAGGTVTQVVADVTKFAEIEALRRQVEHELGPVDVLVANAGGSFTIPGPLEQISEDGWHASVDGNLTATFLTIKSVLPGMKERKAGNIITMSSVAGHRPHPRSPIPYAAAKAGIEILTKDLASQVGPYGIRVNCIAPETILTERNQQWIPDEQKKALVDLHAIRRLGTPDDVAQAALFLASEESGWITGIVLDVAGGAVMT

Samples

Sample ID Description Type Environment
1 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
147 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
150 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
151 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 1.75
Rhizosphere 91.67
Stem 0
Stem Tuber 0.44
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209588_1001561 3300027671 Bacteria 6025
2 MBSR1b_contig_10291313 2162886012 Bacteria 2227
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 rootH1_10059582 3300003323 Bacteria 6188
5 Ga0065715_10178781 3300005293 Unclassified 1492
6 Ga0070683_100003329 3300005329 Bacteria 12996
7 Ga0070683_100315949 3300005329 Unclassified 1486
8 Ga0070682_100476414 3300005337 Bacteria 962
9 Ga0070689_100000006 3300005340 Bacteria 332562
10 Ga0070667_100153866 3300005367 Bacteria 2022
11 Ga0070709_10024842 3300005434 Bacteria 3532
12 Ga0070709_10036534 3300005434 Bacteria 2994
13 Ga0070709_10070985 3300005434 Bacteria 2247
14 Ga0070713_100009951 3300005436 Bacteria 6848
15 Ga0070713_100032422 3300005436 Unclassified 4173
16 Ga0070713_100058600 3300005436 Bacteria 3212
17 Ga0070710_10022343 3300005437 Bacteria 3307
18 Ga0070710_10023467 3300005437 Unclassified 3244
19 Ga0070710_10236966 3300005437 Bacteria 1167
20 Ga0070711_100001611 3300005439 Bacteria 12451
21 Ga0070711_100003097 3300005439 Bacteria 9618
22 Ga0070711_100074091 3300005439 Bacteria 2407
23 Ga0070711_100123294 3300005439 Bacteria 1920
24 Ga0070694_100051871 3300005444 Bacteria 2771
25 Ga0070708_100000112 3300005445 Bacteria 53740
26 Ga0070708_100041229 3300005445 Bacteria 4047
27 Ga0070708_100152662 3300005445 Bacteria 2148
28 Ga0068867_100007036 3300005459 Bacteria 7947
29 Ga0070685_10137552 3300005466 Bacteria 1534
30 Ga0070706_100006303 3300005467 Bacteria 11210
31 Ga0070706_100091981 3300005467 Bacteria 2814
32 Ga0070706_100102549 3300005467 Bacteria 2660
33 Ga0070706_100122878 3300005467 Bacteria 2420
34 Ga0070706_100225951 3300005467 Bacteria 1747
35 Ga0070707_100003903 3300005468 Bacteria 14036
36 Ga0070707_100524310 3300005468 Bacteria 1147
37 Ga0070698_100017060 3300005471 Bacteria 7656
38 Ga0070698_100026975 3300005471 Bacteria 5974
39 Ga0070698_100036837 3300005471 Bacteria 5049
40 Ga0070698_100054997 3300005471 Bacteria 4039
41 Ga0070699_100000771 3300005518 Bacteria 29598
42 Ga0070699_100053670 3300005518 Bacteria 3488
43 Ga0070699_100566650 3300005518 Bacteria 1034
44 Ga0070684_100002919 3300005535 Bacteria 12711
45 Ga0070684_100054109 3300005535 Unclassified 3496
46 Ga0070697_100005872 3300005536 Bacteria 9472
47 Ga0070697_100045649 3300005536 Unclassified 3551
48 Ga0070697_100265451 3300005536 Bacteria 1470
49 Ga0070695_100059432 3300005545 Bacteria 2475
50 Ga0070696_100000474 3300005546 Bacteria 25182
51 Ga0070696_100077495 3300005546 Bacteria 2349
52 Ga0070696_100103071 3300005546 Bacteria 2047
53 Ga0070665_100194551 3300005548 Bacteria 2029
54 Ga0070704_100075283 3300005549 Bacteria 2465
55 Ga0068855_100073517 3300005563 Unclassified 3972
56 Ga0070664_100049188 3300005564 Bacteria 3565
57 Ga0068861_100013384 3300005719 Bacteria 5741
58 Ga0070717_10008575 3300006028 Bacteria 7637
59 Ga0070717_10013275 3300006028 Bacteria 6306
60 Ga0070717_10063643 3300006028 Bacteria 3062
61 Ga0070715_10105305 3300006163 Bacteria 1322
62 Ga0070716_100053986 3300006173 Bacteria 2294
63 Ga0070716_100119853 3300006173 Bacteria 1645
64 Ga0070712_100002934 3300006175 Bacteria 10567
65 Ga0070712_100026423 3300006175 Bacteria 3866
66 Ga0075430_100580384 3300006846 Unclassified 925
67 Ga0075433_10010407 3300006852 Bacteria 7465
68 Ga0075433_10073433 3300006852 Bacteria 3009
69 Ga0075434_100308141 3300006871 Bacteria 1604
70 Ga0075429_100552646 3300006880 Bacteria 1009
71 Ga0068865_100310877 3300006881 Bacteria 1264
72 Ga0099794_10001003 3300007265 Bacteria 9534
73 Ga0111539_10012419 3300009094 Bacteria 10680
74 Ga0105245_10415513 3300009098 Bacteria 1347
75 Ga0105241_10300895 3300009174 Unclassified 1377
76 Ga0105248_10500370 3300009177 Bacteria 1370
77 Ga0105237_10088367 3300009545 Unclassified 3088
78 Ga0105249_10030485 3300009553 Bacteria 4876
79 Ga0157370_10535759 3300013104 Unclassified 1074
80 Ga0157369_10131797 3300013105 Bacteria 2648
81 Ga0157374_10086565 3300013296 Bacteria 2981
82 Ga0157372_10082537 3300013307 Bacteria 3639
83 Ga0163163_10369328 3300014325 Bacteria 1492
84 Ga0157380_10166393 3300014326 Bacteria 1922
85 Ga0207427_100052 3300025231 Bacteria 218228
86 Ga0209437_100451 3300025233 Bacteria 33803
87 Ga0209233_1000001 3300025261 Bacteria 2992747
88 Ga0207692_10010700 3300025898 Bacteria 3878
89 Ga0207685_10019778 3300025905 Bacteria 2224
90 Ga0207699_10044665 3300025906 Bacteria 2580
91 Ga0207699_10099110 3300025906 Bacteria 1845
92 Ga0207684_10005907 3300025910 Bacteria 11208
93 Ga0207684_10033067 3300025910 Unclassified 4398
94 Ga0207684_10197384 3300025910 Bacteria 1736
95 Ga0207684_10228395 3300025910 Bacteria 1606
96 Ga0207654_10432522 3300025911 Bacteria 920
97 Ga0207695_10012235 3300025913 Bacteria 10306
98 Ga0207693_10002011 3300025915 Bacteria 17845
99 Ga0207693_10023723 3300025915 Bacteria 4867
100 Ga0207663_10001746 3300025916 Bacteria 10225
101 Ga0207663_10012583 3300025916 Bacteria 4580
102 Ga0207663_10094899 3300025916 Bacteria 1989
103 Ga0207646_10006986 3300025922 Bacteria 11565
104 Ga0207646_10133823 3300025922 Bacteria 2232
105 Ga0207646_10538739 3300025922 Bacteria 1050
106 Ga0207700_10033375 3300025928 Bacteria 3683
107 Ga0207700_10055257 3300025928 Plasmid 2984
108 Ga0207700_10057053 3300025928 Bacteria 2943
109 Ga0207700_10080069 3300025928 Bacteria 2546
110 Ga0207664_10123522 3300025929 Bacteria 2170
111 Ga0207670_10000003 3300025936 Bacteria 760449
112 Ga0207704_10581298 3300025938 Bacteria 914
113 Ga0207665_10007468 3300025939 Bacteria 7225
114 Ga0207665_10311717 3300025939 Bacteria 1179
115 Ga0207661_10009654 3300025944 Bacteria 6929
116 Ga0207661_10040843 3300025944 Bacteria 3649
117 Ga0207667_10000687 3300025949 Bacteria 43871
118 Ga0207667_10076263 3300025949 Bacteria 3479
119 Ga0207678_10027080 3300026067 Bacteria 4999
120 Ga0207708_10127695 3300026075 Bacteria 1986
121 Ga0207702_10046161 3300026078 Bacteria 3666
122 Ga0207702_10206395 3300026078 Bacteria 1824
123 Ga0207648_10011616 3300026089 Bacteria 8291
124 Ga0207675_100022646 3300026118 Bacteria 5847
125 Ga0265338_10006494 3300028800 Bacteria 14875
126 Ga0307413_10003839 3300031824 Bacteria 6416
127 Ga0307413_10218309 3300031824 Bacteria 1391
128 Ga0307413_10304484 3300031824 Bacteria 1210
129 Ga0307413_10515794 3300031824 Bacteria 963
130 Ga0307410_10048174 3300031852 Unclassified 2852
131 Ga0307406_10059674 3300031901 Bacteria 2457
132 Ga0307406_10126131 3300031901 Bacteria 1789
133 Ga0307407_10004516 3300031903 Bacteria 5921
134 Ga0307412_10055715 3300031911 Unclassified 2631
135 Ga0307409_100013321 3300031995 Bacteria 5286
136 Ga0307409_100181879 3300031995 Bacteria 1862
137 Ga0307416_100019474 3300032002 Bacteria 4812
138 Ga0307416_100194302 3300032002 Bacteria 1918
139 Ga0307411_10004598 3300032005 Bacteria 6640
140 Ga0307411_10164777 3300032005 Bacteria 1665
141 Ga0307415_100007207 3300032126 Bacteria 6066
142 Ga0307415_100014435 3300032126 Bacteria 4643
143 Ga0307415_100033210 3300032126 Bacteria 3349
144 Ga0373934_0007173 3300035086 Bacteria 4132
145 Ga0373934_0029782 3300035086 Bacteria 2134
146 Ga0373954_0080367 3300035118 Bacteria 1557
147 Ga0373956_0007501 3300035119 Bacteria 4393
148 Ga0373957_0007055 3300035120 Bacteria 3573
149 Ga0373957_0040413 3300035120 Bacteria 1754
150 Ga0373943_0032876 3300035170 Bacteria 2468
151 Ga0373955_0004513 3300035172 Bacteria 6163
152 Ga0373924_0062698 3300035410 Bacteria 1557
153 Ga0373935_0071667 3300035692 Bacteria 2236
154 Ga0373927_0125741 3300035695 Bacteria 1674
155 Ga0373933_0088081 3300035724 Bacteria 1912
156 Ga0373925_0331681 3300037068 Bacteria 1232
157 Ga0395899_0104848 3300037312 Bacteria 2037
158 Ga0395899_0189543 3300037312 Bacteria 1439
159 Ga0395900_0051495 3300037418 Bacteria 4240
160 Ga0395900_0312028 3300037418 Bacteria 1556
161 Ga0395898_0024946 3300037466 Bacteria 6028
162 Ga0395905_0007857 3300037471 Bacteria 10566
163 Ga0395905_0015728 3300037471 Bacteria 7187
164 Ga0395905_0032684 3300037471 Bacteria 4892
165 Ga0395905_0194918 3300037471 Unclassified 1900
166 Ga0436364_0072039 3300037853 Bacteria 1684
167 Ga0436364_1357725 3300037853 Bacteria 1089
168 Ga0395901_0084943 3300038443 Bacteria 3308
169 Ga0395901_0090533 3300038443 Bacteria 3202
170 Ga0395901_0297814 3300038443 Bacteria 1672
171 Ga0451849_0863724 3300041505 Bacteria 10913
172 Ga0453683_0002274 3300044673 Bacteria 15162
173 Ga0466963_0232050 3300044694 Bacteria 1293
174 Ga0466959_0153022 3300045049 Bacteria 1625
175 Ga0466958_0061998 3300045836 Bacteria 2279
176 Ga0466967_0012271 3300045976 Bacteria 6544
177 Ga0466967_0070165 3300045976 Bacteria 3134
178 Ga0466967_0146375 3300045976 Bacteria 2204
179 Ga0495641_0062696 3300046461 Bacteria 1676
180 Ga0495651_0015432 3300046462 Bacteria 5908
181 Ga0495653_0181371 3300046463 Bacteria 1444
182 Ga0495653_0322785 3300046463 Bacteria 1000
183 Ga0495664_0044197 3300046477 Bacteria 2639
184 Ga0495608_0013182 3300046511 Bacteria 5737
185 Ga0495618_0247677 3300046514 Bacteria 1118
186 Ga0495618_0299619 3300046514 Bacteria 999
187 Ga0495630_0039805 3300046517 Bacteria 3514
188 Ga0495652_0061351 3300046529 Bacteria 3174
189 Ga0495640_0025329 3300046533 Bacteria 4305
190 Ga0495586_0105149 3300046535 Bacteria 1569
191 Ga0495587_0048047 3300046536 Bacteria 2528
192 Ga0495667_0064770 3300046559 Bacteria 2390
193 Ga0495635_0040130 3300046663 Bacteria 3235
194 Ga0495657_0031077 3300046675 Bacteria 3735
195 Ga0495657_0100740 3300046675 Bacteria 1841
196 Ga0495657_0193967 3300046675 Bacteria 1240
197 Ga0495599_0393532 3300046678 Bacteria 826
198 Ga0495623_0141020 3300046679 Bacteria 1434
199 Ga0495604_0024310 3300047317 Bacteria 4833
200 Ga0495674_0150597 3300047319 Bacteria 1951
201 Ga0495674_0212578 3300047319 Bacteria 1601
202 Ga0495680_0090033 3300047322 Bacteria 2302
203 Ga0495684_0012153 3300047471 Bacteria 6641
204 Ga0495684_0022911 3300047471 Bacteria 4804
205 Ga0496101_0001309 3300048904 Bacteria 14880
206 Ga0496102_0320972 3300048905 Bacteria 1459
207 Ga0496104_0329815 3300048907 Bacteria 1439
208 Ga0496106_0056361 3300048909 Bacteria 2970
209 Ga0501041_0153203 3300049577 Bacteria 1440
210 Ga0501047_0601801 3300049581 Bacteria 921
211 Ga0501073_0152219 3300049589 Bacteria 1603
212 Ga0501073_0279536 3300049589 Bacteria 1152
213 Ga0501074_0038172 3300049590 Bacteria 3481
214 Ga0501077_0306598 3300049593 Bacteria 1012
215 Ga0501080_0094234 3300049742 Unclassified 2781
216 Ga0501080_0121243 3300049742 Bacteria 2423
217 nmdc:mga05p37_71116_c1 3300050507 Bacteria 4280
218 nmdc:mga08y16_8848_c1 3300050511 Bacteria 10567
219 nmdc:mga08x19_291309_c1 3300050514 Bacteria 1132
220 nmdc:mga0a205_76540_c1 3300050515 Bacteria 3234
221 Ga0495595_0069949 3300053084 Bacteria 1658
222 Ga0500583_0109128 3300053092 Bacteria 1361
223 Ga0500628_000107 3300053129 Bacteria 17670
224 Ga0500588_0003917 3300053146 Bacteria 3184
225 Ga0500616_0001404 3300053153 Bacteria 23214
226 2884765393 2884763398 Bacteria 4091164
227 2919526716 2919523602 Bacteria 3788128
228 2995470083 2995463766 Bacteria 8577691
229 Ga0209588_1001561
230 MBSR1b_contig_10291313
231 JGI25165J46597_1000002
232 rootH1_10059582
233 Ga0065715_10178781
234 Ga0070683_100003329
235 Ga0070683_100315949
236 Ga0070682_100476414
237 Ga0070689_100000006
238 Ga0070667_100153866
239 Ga0070709_10024842
240 Ga0070709_10036534
241 Ga0070709_10070985
242 Ga0070713_100009951
243 Ga0070713_100032422
244 Ga0070713_100058600
245 Ga0070710_10022343
246 Ga0070710_10023467
247 Ga0070710_10236966
248 Ga0070711_100001611
249 Ga0070711_100003097
250 Ga0070711_100074091
251 Ga0070711_100123294
252 Ga0070694_100051871
253 Ga0070708_100000112
254 Ga0070708_100041229
255 Ga0070708_100152662
256 Ga0068867_100007036
257 Ga0070685_10137552
258 Ga0070706_100006303
259 Ga0070706_100091981
260 Ga0070706_100102549
261 Ga0070706_100122878
262 Ga0070706_100225951
263 Ga0070707_100003903
264 Ga0070707_100524310
265 Ga0070698_100017060
266 Ga0070698_100026975
267 Ga0070698_100036837
268 Ga0070698_100054997
269 Ga0070699_100000771
270 Ga0070699_100053670
271 Ga0070699_100566650
272 Ga0070684_100002919
273 Ga0070684_100054109
274 Ga0070697_100005872
275 Ga0070697_100045649
276 Ga0070697_100265451
277 Ga0070695_100059432
278 Ga0070696_100000474
279 Ga0070696_100077495
280 Ga0070696_100103071
281 Ga0070665_100194551
282 Ga0070704_100075283
283 Ga0068855_100073517
284 Ga0070664_100049188
285 Ga0068861_100013384
286 Ga0070717_10008575
287 Ga0070717_10013275
288 Ga0070717_10063643
289 Ga0070715_10105305
290 Ga0070716_100053986
291 Ga0070716_100119853
292 Ga0070712_100002934
293 Ga0070712_100026423
294 Ga0075430_100580384
295 Ga0075433_10010407
296 Ga0075433_10073433
297 Ga0075434_100308141
298 Ga0075429_100552646
299 Ga0068865_100310877
300 Ga0099794_10001003
301 Ga0111539_10012419
302 Ga0105245_10415513
303 Ga0105241_10300895
304 Ga0105248_10500370
305 Ga0105237_10088367
306 Ga0105249_10030485
307 Ga0157370_10535759
308 Ga0157369_10131797
309 Ga0157374_10086565
310 Ga0157372_10082537
311 Ga0163163_10369328
312 Ga0157380_10166393
313 Ga0207427_100052
314 Ga0209437_100451
315 Ga0209233_1000001
316 Ga0207692_10010700
317 Ga0207685_10019778
318 Ga0207699_10044665
319 Ga0207699_10099110
320 Ga0207684_10005907
321 Ga0207684_10033067
322 Ga0207684_10197384
323 Ga0207684_10228395
324 Ga0207654_10432522
325 Ga0207695_10012235
326 Ga0207693_10002011
327 Ga0207693_10023723
328 Ga0207663_10001746
329 Ga0207663_10012583
330 Ga0207663_10094899
331 Ga0207646_10006986
332 Ga0207646_10133823
333 Ga0207646_10538739
334 Ga0207700_10033375
335 Ga0207700_10055257
336 Ga0207700_10057053
337 Ga0207700_10080069
338 Ga0207664_10123522
339 Ga0207670_10000003
340 Ga0207704_10581298
341 Ga0207665_10007468
342 Ga0207665_10311717
343 Ga0207661_10009654
344 Ga0207661_10040843
345 Ga0207667_10000687
346 Ga0207667_10076263
347 Ga0207678_10027080
348 Ga0207708_10127695
349 Ga0207702_10046161
350 Ga0207702_10206395
351 Ga0207648_10011616
352 Ga0207675_100022646
353 Ga0265338_10006494
354 Ga0307413_10003839
355 Ga0307413_10218309
356 Ga0307413_10304484
357 Ga0307413_10515794
358 Ga0307410_10048174
359 Ga0307406_10059674
360 Ga0307406_10126131
361 Ga0307407_10004516
362 Ga0307412_10055715
363 Ga0307409_100013321
364 Ga0307409_100181879
365 Ga0307416_100019474
366 Ga0307416_100194302
367 Ga0307411_10004598
368 Ga0307411_10164777
369 Ga0307415_100007207
370 Ga0307415_100014435
371 Ga0307415_100033210
372 Ga0373934_0007173
373 Ga0373934_0029782
374 Ga0373954_0080367
375 Ga0373956_0007501
376 Ga0373957_0007055
377 Ga0373957_0040413
378 Ga0373943_0032876
379 Ga0373955_0004513
380 Ga0373924_0062698
381 Ga0373935_0071667
382 Ga0373927_0125741
383 Ga0373933_0088081
384 Ga0373925_0331681
385 Ga0395899_0104848
386 Ga0395899_0189543
387 Ga0395900_0051495
388 Ga0395900_0312028
389 Ga0395898_0024946
390 Ga0395905_0007857
391 Ga0395905_0015728
392 Ga0395905_0032684
393 Ga0395905_0194918
394 Ga0436364_0072039
395 Ga0436364_1357725
396 Ga0395901_0084943
397 Ga0395901_0090533
398 Ga0395901_0297814
399 Ga0451849_0863724
400 Ga0453683_0002274
401 Ga0466963_0232050
402 Ga0466959_0153022
403 Ga0466958_0061998
404 Ga0466967_0012271
405 Ga0466967_0070165
406 Ga0466967_0146375
407 Ga0495641_0062696
408 Ga0495651_0015432
409 Ga0495653_0181371
410 Ga0495653_0322785
411 Ga0495664_0044197
412 Ga0495608_0013182
413 Ga0495618_0247677
414 Ga0495618_0299619
415 Ga0495630_0039805
416 Ga0495652_0061351
417 Ga0495640_0025329
418 Ga0495586_0105149
419 Ga0495587_0048047
420 Ga0495667_0064770
421 Ga0495635_0040130
422 Ga0495657_0031077
423 Ga0495657_0100740
424 Ga0495657_0193967
425 Ga0495599_0393532
426 Ga0495623_0141020
427 Ga0495604_0024310
428 Ga0495674_0150597
429 Ga0495674_0212578
430 Ga0495680_0090033
431 Ga0495684_0012153
432 Ga0495684_0022911
433 Ga0496101_0001309
434 Ga0496102_0320972
435 Ga0496104_0329815
436 Ga0496106_0056361
437 Ga0501041_0153203
438 Ga0501047_0601801
439 Ga0501073_0152219
440 Ga0501073_0279536
441 Ga0501074_0038172
442 Ga0501077_0306598
443 Ga0501080_0094234
444 Ga0501080_0121243
445 nmdc:mga05p37_71116_c1
446 nmdc:mga08y16_8848_c1
447 nmdc:mga08x19_291309_c1
448 nmdc:mga0a205_76540_c1
449 Ga0495595_0069949
450 Ga0500583_0109128
451 Ga0500628_000107
452 Ga0500588_0003917
453 Ga0500616_0001404
454 2884765393
455 2919526716
456 2995470083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

29

226

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

35

272

0.95

PF08659

KR

KR domain

29

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9718 3 244
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9689 4 252
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9678 4 244
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9671 4 244
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.966 1 244
ID Description Score Start End Superfamily
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 4 248 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9691 4 81 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 3 244 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 4 244 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.964 3 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y6PNX5-F1-model_v4 SDR family oxidoreductase 0.9948 3 244
AF-A0A387FK27-F1-model_v4 SDR family oxidoreductase 0.9943 1 244
AF-A0A534JSK3-F1-model_v4 SDR family oxidoreductase 0.9837 66 244
AF-A0A534L2X8-F1-model_v4 SDR family oxidoreductase 0.9827 36 244
AF-A0A7Z9KT01-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9757 3 185 GO:0016491

Map