F340966

General Info

Members Datasets Scaffolds Average Seq Length
228 160 207 293

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10398843|Ga0157370_103988432
Length 317
Sequence VSDTVTLVTASGAGPRGLRRSAAAPRRAAGRHQARYGYIFVSGYTLFLLAFGIFPTLYAVYLAFTKNGQWAGIDNFVKVVGDYRFLPAVGHVALYVFFWLISLLVLVTVLALVVHAVRVRWLSDASRFLFYIPGAIAGASSVLLWLFVLDPSVSPVSGLLHAMGFEKLVNVVAVENLPVVFTVIAFWAGAGGWIVIMYGALNNVSADVIEAARIDGANGVQLAIHIQLPMLRKWIAYMGVMSLAAGTQLFVEPQLLSQASNAVVPNDYSLNQLAYQYAFQQNDFNGAAAISLILLVVALLLSWVFVTRGGLFETDVP

Samples

Sample ID Description Type Environment
1 2643221572 Leifsonia sp. Root60 Isolate Unclassified
2 2643221597 Microbacterium sp. Root180 Isolate Unclassified
3 2643221629 Devosia sp. Root105 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2643221662 Devosia sp. Root413D1 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
8 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
11 2808606372 Agromyces sp. 23-23 Isolate Unclassified
12 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
13 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
14 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
15 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
16 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
17 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
18 2928153084 Leifsonia sp. 563 Isolate Unclassified
19 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
20 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.6
Metatranscriptomes 2.19
Isolates 9.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0
Rhizoplane 7.89
Rhizosphere 72.81
Stem 0
Stem Tuber 0.44
Unclassified 9.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013673 3300001979 Bacteria 3019
2 JGI24739J22299_10010529 3300001989 Bacteria 3432
3 JGI24737J22298_10001213 3300001990 Bacteria 9095
4 JGI24735J21928_10001402 3300002067 Bacteria 8522
5 JGI25162J39368_1008922 3300002737 Bacteria 1390
6 JGI25164J39214_1001001 3300002772 Bacteria 8828
7 JGI25165J46597_1000107 3300003214 Bacteria 150846
8 Ga0006562J51391_1140953 3300003578 Bacteria 1870
9 Ga0055539_1000006 3300003752 Bacteria 580055
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055525_1001022 3300003759 Bacteria 7341
12 Ga0055541_1001131 3300003841 Bacteria 5992
13 Ga0070658_10000322 3300005327 Bacteria 40935
14 Ga0070658_10002931 3300005327 Bacteria 14146
15 Ga0070658_10031574 3300005327 Bacteria 4254
16 Ga0070683_100102129 3300005329 Bacteria 2701
17 Ga0070660_100059497 3300005339 Bacteria 2962
18 Ga0070661_100046695 3300005344 Bacteria 3169
19 Ga0070659_100082686 3300005366 Bacteria 2565
20 Ga0070667_100010911 3300005367 Bacteria 7515
21 Ga0070713_100117473 3300005436 Bacteria 2327
22 Ga0070710_10310364 3300005437 Bacteria 1032
23 Ga0070663_100037056 3300005455 Bacteria 3392
24 Ga0070678_100373170 3300005456 Bacteria 1232
25 Ga0070681_10285677 3300005458 Bacteria 1560
26 Ga0070679_100269067 3300005530 Unclassified 1658
27 Ga0070684_100221705 3300005535 Bacteria 1725
28 Ga0068853_100019005 3300005539 Bacteria 5693
29 Ga0068853_100042524 3300005539 Bacteria 3885
30 Ga0070665_100206177 3300005548 Bacteria 1966
31 Ga0068855_100004607 3300005563 Bacteria 16830
32 Ga0068855_100009946 3300005563 Bacteria 11469
33 Ga0068855_100011238 3300005563 Bacteria 10812
34 Ga0068855_100039054 3300005563 Bacteria 5636
35 Ga0070664_100043326 3300005564 Bacteria 3797
36 Ga0070664_100226678 3300005564 Bacteria 1674
37 Ga0068857_100023832 3300005577 Bacteria 5388
38 Ga0068857_100142795 3300005577 Bacteria 2165
39 Ga0068854_100030832 3300005578 Bacteria 3722
40 Ga0068856_100015661 3300005614 Bacteria 7330
41 Ga0068856_100025144 3300005614 Bacteria 5802
42 Ga0068856_100070332 3300005614 Bacteria 3462
43 Ga0068856_100107619 3300005614 Bacteria 2784
44 Ga0068856_100136282 3300005614 Bacteria 2460
45 Ga0068856_100247973 3300005614 Bacteria 1796
46 Ga0068856_100274122 3300005614 Unclassified 1703
47 Ga0068852_100005809 3300005616 Bacteria 8859
48 Ga0068852_100208054 3300005616 Bacteria 1854
49 Ga0068851_10068450 3300005834 Bacteria 1832
50 Ga0081539_10022861 3300005985 Bacteria 4119
51 Ga0070717_10027403 3300006028 Bacteria 4554
52 Ga0075369_10054399 3300006186 Bacteria 1738
53 Ga0105240_10038021 3300009093 Bacteria 6178
54 Ga0105240_10376879 3300009093 Bacteria 1603
55 Ga0105241_10010585 3300009174 Bacteria 6766
56 Ga0105237_10041504 3300009545 Bacteria 4639
57 Ga0105238_10054773 3300009551 Bacteria 4005
58 Ga0105239_10158515 3300010375 Bacteria 2528
59 Ga0157373_10066092 3300013100 Bacteria 2559
60 Ga0157370_10029874 3300013104 Bacteria 5343
61 Ga0157370_10064382 3300013104 Bacteria 3471
62 Ga0157370_10068673 3300013104 Bacteria 3349
63 Ga0157370_10087109 3300013104 Bacteria 2933
64 Ga0157370_10398843 3300013104 Bacteria 1266
65 Ga0157370_10544116 3300013104 Bacteria 1065
66 Ga0157369_10002346 3300013105 Bacteria 22770
67 Ga0157369_10022707 3300013105 Bacteria 6997
68 Ga0157369_10069256 3300013105 Bacteria 3791
69 Ga0157369_10367778 3300013105 Bacteria 1493
70 Ga0157369_10532081 3300013105 Bacteria 1215
71 Ga0157372_10048733 3300013307 Bacteria 4709
72 Ga0157372_10179497 3300013307 Bacteria 2451
73 Ga0163163_10166727 3300014325 Bacteria 2249
74 Ga0197907_10570955 3300020069 Bacteria 2597
75 Ga0206353_11543130 3300020082 Bacteria 6517
76 Ga0224712_10010205 3300022467 Bacteria 2863
77 Ga0224712_10015989 3300022467 Bacteria 2454
78 Ga0209566_100032 3300025225 Bacteria 338313
79 Ga0209674_100001 3300025226 Bacteria 4013750
80 Ga0209563_100001 3300025230 Bacteria 4013775
81 Ga0207427_100028 3300025231 Bacteria 388949
82 Ga0209437_100635 3300025233 Bacteria 20606
83 Ga0209677_100001 3300025253 Bacteria 4013787
84 Ga0209677_105883 3300025253 Bacteria 3070
85 Ga0209233_1000001 3300025261 Bacteria 2992747
86 Ga0207647_10008535 3300025904 Bacteria 7335
87 Ga0207647_10010377 3300025904 Bacteria 6578
88 Ga0207705_10015530 3300025909 Bacteria 5464
89 Ga0207705_10186113 3300025909 Unclassified 1569
90 Ga0207654_10009740 3300025911 Bacteria 4888
91 Ga0207707_10195123 3300025912 Bacteria 1766
92 Ga0207695_10010053 3300025913 Bacteria 11619
93 Ga0207695_10021793 3300025913 Bacteria 7299
94 Ga0207671_10006356 3300025914 Bacteria 10539
95 Ga0207657_10014102 3300025919 Bacteria 7820
96 Ga0207657_10021558 3300025919 Bacteria 6059
97 Ga0207649_10013127 3300025920 Bacteria 4621
98 Ga0207649_10055351 3300025920 Bacteria 2472
99 Ga0207652_10197226 3300025921 Bacteria 1811
100 Ga0207694_10020385 3300025924 Bacteria 5016
101 Ga0207694_10136030 3300025924 Bacteria 1973
102 Ga0207694_10282552 3300025924 Bacteria 1364
103 Ga0207694_10293005 3300025924 Bacteria 1338
104 Ga0207664_10346735 3300025929 Bacteria 1314
105 Ga0207690_10023470 3300025932 Bacteria 3849
106 Ga0207661_10028413 3300025944 Bacteria 4282
107 Ga0207679_10048951 3300025945 Bacteria 3080
108 Ga0207667_10014524 3300025949 Bacteria 8974
109 Ga0207667_10056998 3300025949 Bacteria 4102
110 Ga0207640_10030517 3300025981 Bacteria 3320
111 Ga0207640_10248928 3300025981 Unclassified 1378
112 Ga0207658_10009927 3300025986 Bacteria 6468
113 Ga0207677_10117680 3300026023 Bacteria 1992
114 Ga0207639_10161154 3300026041 Bacteria 1890
115 Ga0207678_10049027 3300026067 Bacteria 3649
116 Ga0207678_10172172 3300026067 Bacteria 1849
117 Ga0207702_10253825 3300026078 Bacteria 1653
118 Ga0207702_10363582 3300026078 Bacteria 1387
119 Ga0207702_10367085 3300026078 Bacteria 1381
120 Ga0207702_10565373 3300026078 Unclassified 1113
121 Ga0207674_10011879 3300026116 Bacteria 9763
122 Ga0207674_10045655 3300026116 Bacteria 4504
123 Ga0207674_10101376 3300026116 Bacteria 2860
124 Ga0207698_10198483 3300026142 Bacteria 1794
125 Ga0207698_10302939 3300026142 Bacteria 1488
126 Ga0207698_10304911 3300026142 Bacteria 1484
127 Ga0207698_10660641 3300026142 Unclassified 1036
128 Ga0268266_10340610 3300028379 Bacteria 1407
129 Ga0265318_10009632 3300028577 Bacteria 4239
130 Ga0265338_10185129 3300028800 Bacteria 1584
131 Ga0265328_10025065 3300031239 Bacteria 2249
132 Ga0265340_10000718 3300031247 Bacteria 18783
133 Ga0265339_10001254 3300031249 Bacteria 19102
134 Ga0265339_10017838 3300031249 Bacteria 4195
135 Ga0265331_10062743 3300031250 Bacteria 1752
136 Ga0265316_10008617 3300031344 Bacteria 9445
137 Ga0265316_10045685 3300031344 Bacteria 3475
138 Ga0265313_10000448 3300031595 Bacteria 43625
139 Ga0265313_10015732 3300031595 Bacteria 4386
140 Ga0265314_10012171 3300031711 Bacteria 7045
141 Ga0265342_10008150 3300031712 Bacteria 7560
142 Ga0307516_10050901 3300031730 Bacteria 4062
143 Ga0307405_10084550 3300031731 Bacteria 2083
144 Ga0307413_10155635 3300031824 Bacteria 1599
145 Ga0307415_100057832 3300032126 Bacteria 2667
146 Ga0307415_100242379 3300032126 Bacteria 1459
147 Ga0373948_0004607 3300034817 Bacteria 2191
148 Ga0373951_0000041 3300035091 Bacteria 50991
149 Ga0373931_0224030 3300035691 Bacteria 1133
150 Ga0395900_0002361 3300037418 Bacteria 20877
151 Ga0395900_0501428 3300037418 Unclassified 1164
152 Ga0395898_0000321 3300037466 Bacteria 110293
153 Ga0395898_0018165 3300037466 Bacteria 7178
154 Ga0395898_0148069 3300037466 Bacteria 2247
155 Ga0395905_0017081 3300037471 Bacteria 6891
156 Ga0395901_0079268 3300038443 Bacteria 3429
157 Ga0395901_0382245 3300038443 Bacteria 1449
158 Ga0451797_1053370 3300041453 Bacteria 1823
159 Ga0439432_021423 3300042006 Bacteria 2143
160 Ga0466966_0098774 3300044684 Bacteria 1807
161 Ga0466961_0001132 3300044693 Bacteria 16350
162 Ga0466961_0018781 3300044693 Bacteria 4448
163 Ga0466961_0100898 3300044693 Bacteria 1818
164 Ga0466970_0003631 3300044765 Bacteria 7523
165 Ga0466970_0148002 3300044765 Bacteria 1296
166 Ga0466959_0058915 3300045049 Bacteria 2797
167 Ga0466959_0101385 3300045049 Bacteria 2060
168 Ga0466959_0302737 3300045049 Bacteria 1094
169 Ga0466958_0004458 3300045836 Bacteria 7392
170 Ga0466967_0382264 3300045976 Bacteria 1367
171 Ga0495638_0214123 3300046460 Bacteria 1080
172 Ga0496102_0034668 3300048905 Bacteria 4540
173 Ga0496104_0022193 3300048907 Bacteria 5830
174 Ga0496104_0353986 3300048907 Bacteria 1381
175 Ga0496105_0034784 3300048908 Bacteria 4145
176 Ga0496105_0051340 3300048908 Bacteria 3407
177 Ga0496105_0073184 3300048908 Bacteria 2831
178 Ga0496107_0051609 3300048910 Bacteria 2967
179 Ga0496108_0099755 3300048911 Bacteria 2476
180 Ga0496109_0094157 3300048912 Bacteria 2772
181 Ga0496110_0526842 3300048913 Bacteria 1075
182 Ga0496112_0134130 3300048915 Bacteria 2447
183 Ga0496113_0228900 3300048916 Bacteria 1482
184 Ga0496113_0266633 3300048916 Bacteria 1368
185 Ga0496114_0036283 3300048917 Bacteria 4074
186 Ga0496114_0286752 3300048917 Bacteria 1452
187 Ga0496115_0075834 3300048918 Bacteria 2732
188 Ga0496115_0333467 3300048918 Bacteria 1239
189 Ga0496117_0033470 3300048920 Bacteria 3885
190 Ga0496118_0075814 3300048921 Bacteria 2396
191 Ga0496120_0061171 3300048923 Bacteria 2103
192 Ga0496121_0070281 3300048924 Bacteria 2821
193 Ga0496122_0006468 3300048925 Bacteria 13439
194 Ga0496123_0004421 3300048926 Bacteria 14792
195 Ga0496126_0215305 3300048929 Bacteria 1616
196 Ga0501033_0135039 3300049570 Bacteria 1785
197 Ga0501034_0130813 3300049571 Bacteria 2493
198 Ga0501036_0065963 3300049572 Bacteria 3063
199 Ga0501037_0074154 3300049573 Bacteria 2473
200 Ga0501047_0059967 3300049581 Bacteria 3673
201 Ga0501070_0000508 3300049586 Bacteria 35546
202 Ga0501044_0136344 3300049823 Bacteria 2446
203 Ga0500578_0031365 3300053086 Bacteria 3415
204 Ga0500568_0020574 3300053139 Bacteria 2852
205 Ga0500616_0000207 3300053153 Bacteria 95491
206 Ga0500616_0019560 3300053153 Bacteria 3815
207 Ga0500616_0019666 3300053153 Bacteria 3804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100102129 Ga0070683_1001021293 236
2 3300005339 Ga0070660_100059497 Ga0070660_1000594973 236
3 3300005344 Ga0070661_100046695 Ga0070661_1000466952 236
4 3300005366 Ga0070659_100082686 Ga0070659_1000826862 236
5 3300005455 Ga0070663_100037056 Ga0070663_1000370564 236
6 3300005539 Ga0068853_100019005 Ga0068853_1000190055 236
7 3300005564 Ga0070664_100226678 Ga0070664_1002266782 236
8 3300013104 Ga0157370_10064382 Ga0157370_100643822 236
9 3300026023 Ga0207677_10117680 Ga0207677_101176802 236
10 3300048916 Ga0496113_0266633 Ga0496113_0266633_582_1352 237
11 3300046460 Ga0495638_0214123 Ga0495638_0214123_76_882 249
12 3300048924 Ga0496121_0070281 Ga0496121_0070281_1938_2783 249
13 3300053153 Ga0500616_0019560 Ga0500616_0019560_2922_3728 249
14 3300049572 Ga0501036_0065963 Ga0501036_0065963_71_913 251
15 3300049573 Ga0501037_0074154 Ga0501037_0074154_535_1377 251
16 3300049823 Ga0501044_0136344 Ga0501044_0136344_121_963 251
17 3300048911 Ga0496108_0099755 Ga0496108_0099755_582_1505 254
18 3300048923 Ga0496120_0061171 Ga0496120_0061171_1231_2073 255
19 3300005577 Ga0068857_100142795 Ga0068857_1001427952 256
20 3300005614 Ga0068856_100015661 Ga0068856_1000156614 256
21 3300005616 Ga0068852_100005809 Ga0068852_1000058098 256
22 3300025913 Ga0207695_10021793 Ga0207695_100217934 256
23 3300025919 Ga0207657_10014102 Ga0207657_100141024 256
24 3300025920 Ga0207649_10055351 Ga0207649_100553512 256
25 3300025924 Ga0207694_10293005 Ga0207694_102930051 256
26 3300026078 Ga0207702_10253825 Ga0207702_102538252 256
27 3300048915 Ga0496112_0134130 Ga0496112_0134130_28_873 256
28 3300010375 Ga0105239_10158515 Ga0105239_101585152 257
29 3300026116 Ga0207674_10101376 Ga0207674_101013762 257
30 iso_pu_bacteria 2758568621 2760623753 257
31 iso_pu_bacteria 2751185782 2753270118 258
32 3300038443 Ga0395901_0382245 Ga0395901_0382245_206_1066 261
33 3300009093 Ga0105240_10376879 Ga0105240_103768792 262
34 3300013104 Ga0157370_10068673 Ga0157370_100686732 262
35 3300013105 Ga0157369_10367778 Ga0157369_103677782 262
36 3300014325 Ga0163163_10166727 Ga0163163_101667273 262
37 3300026142 Ga0207698_10198483 Ga0207698_101984832 263
38 iso_pu_bacteria 2643221572 2643877184 263
39 iso_pu_bacteria 2643221669 2644384239 263
40 iso_pu_bacteria 2643221961 2645720923 268
41 iso_pu_bacteria 2643221962 2645723920 268
42 3300005437 Ga0070710_10310364 Ga0070710_103103641 270
43 3300005563 Ga0068855_100039054 Ga0068855_1000390545 272
44 3300005577 Ga0068857_100023832 Ga0068857_1000238322 272
45 3300005614 Ga0068856_100025144 Ga0068856_1000251444 272
46 3300005834 Ga0068851_10068450 Ga0068851_100684501 272
47 3300013100 Ga0157373_10066092 Ga0157373_100660922 272
48 3300013307 Ga0157372_10048733 Ga0157372_100487334 272
49 3300025919 Ga0207657_10021558 Ga0207657_100215583 272
50 3300025924 Ga0207694_10136030 Ga0207694_101360302 272
51 3300025932 Ga0207690_10023470 Ga0207690_100234703 272
52 3300025945 Ga0207679_10048951 Ga0207679_100489514 272
53 3300026067 Ga0207678_10049027 Ga0207678_100490273 272
54 3300026078 Ga0207702_10363582 Ga0207702_103635822 272
55 3300026116 Ga0207674_10011879 Ga0207674_100118796 272
56 3300026142 Ga0207698_10304911 Ga0207698_103049112 272
57 3300034817 Ga0373948_0004607 Ga0373948_0004607_119_1057 272
58 3300035691 Ga0373931_0224030 Ga0373931_0224030_11_949 272
59 3300053153 Ga0500616_0019666 Ga0500616_0019666_1231_2154 272
60 3300013104 Ga0157370_10544116 Ga0157370_105441161 273
61 3300044693 Ga0466961_0001132 Ga0466961_0001132_6911_7837 273
62 3300045049 Ga0466959_0058915 Ga0466959_0058915_1633_2559 273
63 3300041453 Ga0451797_1053370 Ga0451797_1053370_692_1636 274
64 3300048925 Ga0496122_0006468 Ga0496122_0006468_4854_5792 274
65 3300048926 Ga0496123_0004421 Ga0496123_0004421_1296_2234 274
66 3300048929 Ga0496126_0215305 Ga0496126_0215305_119_1054 274
67 3300053139 Ga0500568_0020574 Ga0500568_0020574_1128_2054 274
68 3300005327 Ga0070658_10002931 Ga0070658_100029317 275
69 3300013104 Ga0157370_10087109 Ga0157370_100871094 275
70 3300013105 Ga0157369_10069256 Ga0157369_100692565 275
71 3300013105 Ga0157369_10532081 Ga0157369_105320812 275
72 3300031731 Ga0307405_10084550 Ga0307405_100845503 275
73 3300031824 Ga0307413_10155635 Ga0307413_101556352 275
74 3300032126 Ga0307415_100242379 Ga0307415_1002423792 275
75 3300049570 Ga0501033_0135039 Ga0501033_0135039_446_1357 275
76 3300049581 Ga0501047_0059967 Ga0501047_0059967_1817_2758 275
77 3300031730 Ga0307516_10050901 Ga0307516_100509013 276
78 3300035091 Ga0373951_0000041 Ga0373951_0000041_21361_22293 276
79 3300037471 Ga0395905_0017081 Ga0395905_0017081_3025_3978 276
80 3300044693 Ga0466961_0100898 Ga0466961_0100898_289_1227 276
81 3300045836 Ga0466958_0004458 Ga0466958_0004458_709_1650 276
82 3300049571 Ga0501034_0130813 Ga0501034_0130813_1214_2143 276
83 3300003752 Ga0055539_1000006 Ga0055539_1000006104 277
84 3300003756 Ga0055533_1000002 Ga0055533_1000002188 277
85 3300003759 Ga0055525_1001022 Ga0055525_10010227 277
86 3300003841 Ga0055541_1001131 Ga0055541_10011315 277
87 3300005367 Ga0070667_100010911 Ga0070667_1000109112 277
88 3300005530 Ga0070679_100269067 Ga0070679_1002690672 277
89 3300005563 Ga0068855_100004607 Ga0068855_10000460712 277
90 3300005614 Ga0068856_100247973 Ga0068856_1002479732 277
91 3300005614 Ga0068856_100274122 Ga0068856_1002741222 277
92 3300005985 Ga0081539_10022861 Ga0081539_100228613 277
93 3300009093 Ga0105240_10038021 Ga0105240_100380217 277
94 3300013104 Ga0157370_10029874 Ga0157370_100298744 277
95 3300013105 Ga0157369_10022707 Ga0157369_100227072 277
96 3300020082 Ga0206353_11543130 Ga0206353_115431302 277
97 3300022467 Ga0224712_10015989 Ga0224712_100159892 277
98 3300025225 Ga0209566_100032 Ga0209566_100032189 277
99 3300025226 Ga0209674_100001 Ga0209674_1000013376 277
100 3300025230 Ga0209563_100001 Ga0209563_1000013376 277
101 3300025253 Ga0209677_100001 Ga0209677_1000013376 277
102 3300025253 Ga0209677_105883 Ga0209677_1058833 277
103 3300025981 Ga0207640_10248928 Ga0207640_102489282 277
104 3300025986 Ga0207658_10009927 Ga0207658_100099272 277
105 3300026078 Ga0207702_10565373 Ga0207702_105653732 277
106 3300026142 Ga0207698_10660641 Ga0207698_106606412 277
107 3300037418 Ga0395900_0501428 Ga0395900_0501428_46_978 277
108 3300037466 Ga0395898_0018165 Ga0395898_0018165_1390_2322 277
109 3300037466 Ga0395898_0148069 Ga0395898_0148069_325_1266 277
110 3300038443 Ga0395901_0079268 Ga0395901_0079268_1280_2212 277
111 3300053086 Ga0500578_0031365 Ga0500578_0031365_1868_2821 277
112 3300002737 JGI25162J39368_1008922 JGI25162J39368_10089222 278
113 3300002772 JGI25164J39214_1001001 JGI25164J39214_10010013 278
114 3300003214 JGI25165J46597_1000107 JGI25165J46597_1000107124 278
115 3300025231 Ga0207427_100028 Ga0207427_100028184 278
116 3300025233 Ga0209437_100635 Ga0209437_10063514 278
117 3300025261 Ga0209233_1000001 Ga0209233_1000001682 278
118 iso_pu_bacteria 2643221629 2644167921 278
119 iso_pu_bacteria 2643221662 2644348617 278
120 iso_pu_bacteria 2852643534 2852644650 278
121 3300005327 Ga0070658_10000322 Ga0070658_1000032233 279
122 3300006028 Ga0070717_10027403 Ga0070717_100274034 279
123 3300025909 Ga0207705_10015530 Ga0207705_100155303 279
124 3300028577 Ga0265318_10009632 Ga0265318_100096322 279
125 3300031344 Ga0265316_10045685 Ga0265316_100456854 279
126 3300031711 Ga0265314_10012171 Ga0265314_100121714 279
127 3300032126 Ga0307415_100057832 Ga0307415_1000578322 279
128 3300042006 Ga0439432_021423 Ga0439432_021423_38_970 279
129 iso_pu_bacteria 2643221649 2644278298 279
130 iso_pu_bacteria 2895660088 2895662012 279
131 3300005327 Ga0070658_10031574 Ga0070658_100315744 280
132 3300005436 Ga0070713_100117473 Ga0070713_1001174732 280
133 3300005535 Ga0070684_100221705 Ga0070684_1002217052 280
134 3300005563 Ga0068855_100009946 Ga0068855_1000099468 280
135 3300013307 Ga0157372_10179497 Ga0157372_101794972 280
136 3300025909 Ga0207705_10186113 Ga0207705_101861132 280
137 3300025921 Ga0207652_10197226 Ga0207652_101972262 280
138 3300025949 Ga0207667_10014524 Ga0207667_100145247 280
139 3300031250 Ga0265331_10062743 Ga0265331_100627432 280
140 iso_pu_bacteria 2891395885 2891402067 280
141 3300044684 Ga0466966_0098774 Ga0466966_0098774_19_960 281
142 3300044693 Ga0466961_0018781 Ga0466961_0018781_64_1005 281
143 3300044765 Ga0466970_0003631 Ga0466970_0003631_1564_2505 281
144 3300045049 Ga0466959_0101385 Ga0466959_0101385_31_972 281
145 iso_pu_bacteria 2884763398 2884766888 281
146 iso_pu_bacteria 2891554331 2891560244 281
147 iso_pu_bacteria 2928153084 2928155363 281
148 iso_pu_bacteria 2954691527 2954691553 281
149 iso_pu_bacteria 2954701450 2954706630 281
150 3300013104 Ga0157370_10398843 Ga0157370_103988432 282
151 3300031249 Ga0265339_10017838 Ga0265339_100178383 282
152 3300031595 Ga0265313_10015732 Ga0265313_100157324 282
153 3300048907 Ga0496104_0353986 Ga0496104_0353986_192_1142 282
154 3300048908 Ga0496105_0051340 Ga0496105_0051340_749_1699 282
155 3300048908 Ga0496105_0073184 Ga0496105_0073184_621_1571 282
156 3300048912 Ga0496109_0094157 Ga0496109_0094157_1800_2750 282
157 3300048917 Ga0496114_0036283 Ga0496114_0036283_948_1898 282
158 3300048917 Ga0496114_0286752 Ga0496114_0286752_482_1432 282
159 3300048918 Ga0496115_0333467 Ga0496115_0333467_24_974 282
160 3300053153 Ga0500616_0000207 Ga0500616_0000207_21253_22218 282
161 iso_pu_bacteria 2643221597 2643997155 282
162 iso_pu_bacteria 2808606372 2808900174 282
163 3300044765 Ga0466970_0148002 Ga0466970_0148002_157_1083 283
164 3300045976 Ga0466967_0382264 Ga0466967_0382264_209_1141 283
165 3300005458 Ga0070681_10285677 Ga0070681_102856772 284
166 3300005564 Ga0070664_100043326 Ga0070664_1000433262 284
167 3300005614 Ga0068856_100107619 Ga0068856_1001076193 284
168 3300025912 Ga0207707_10195123 Ga0207707_101951231 284
169 3300025920 Ga0207649_10013127 Ga0207649_100131272 284
170 3300025929 Ga0207664_10346735 Ga0207664_103467352 284
171 3300025944 Ga0207661_10028413 Ga0207661_100284132 284
172 3300026116 Ga0207674_10045655 Ga0207674_100456552 284
173 3300028800 Ga0265338_10185129 Ga0265338_101851292 284
174 3300031239 Ga0265328_10025065 Ga0265328_100250652 284
175 3300031247 Ga0265340_10000718 Ga0265340_1000071813 284
176 3300031249 Ga0265339_10001254 Ga0265339_1000125413 284
177 3300031344 Ga0265316_10008617 Ga0265316_100086174 284
178 3300031595 Ga0265313_10000448 Ga0265313_1000044813 284
179 3300031712 Ga0265342_10008150 Ga0265342_1000815010 284
180 3300001979 JGI24740J21852_10013673 JGI24740J21852_100136732 285
181 3300001989 JGI24739J22299_10010529 JGI24739J22299_100105293 285
182 3300001990 JGI24737J22298_10001213 JGI24737J22298_100012133 285
183 3300002067 JGI24735J21928_10001402 JGI24735J21928_100014022 285
184 3300003578 Ga0006562J51391_1140953 Ga0006562J51391_11409532 285
185 3300005456 Ga0070678_100373170 Ga0070678_1003731702 285
186 3300005539 Ga0068853_100042524 Ga0068853_1000425243 285
187 3300005548 Ga0070665_100206177 Ga0070665_1002061772 285
188 3300005563 Ga0068855_100011238 Ga0068855_10001123812 285
189 3300005578 Ga0068854_100030832 Ga0068854_1000308322 285
190 3300005614 Ga0068856_100070332 Ga0068856_1000703323 285
191 3300005614 Ga0068856_100136282 Ga0068856_1001362822 285
192 3300005616 Ga0068852_100208054 Ga0068852_1002080542 285
193 3300006186 Ga0075369_10054399 Ga0075369_100543992 285
194 3300009174 Ga0105241_10010585 Ga0105241_100105858 285
195 3300009545 Ga0105237_10041504 Ga0105237_100415042 285
196 3300009551 Ga0105238_10054773 Ga0105238_100547732 285
197 3300013105 Ga0157369_10002346 Ga0157369_1000234621 285
198 3300020069 Ga0197907_10570955 Ga0197907_105709552 285
199 3300022467 Ga0224712_10010205 Ga0224712_100102052 285
200 3300025904 Ga0207647_10008535 Ga0207647_100085354 285
201 3300025904 Ga0207647_10010377 Ga0207647_100103772 285
202 3300025911 Ga0207654_10009740 Ga0207654_100097402 285
203 3300025913 Ga0207695_10010053 Ga0207695_100100532 285
204 3300025914 Ga0207671_10006356 Ga0207671_1000635610 285
205 3300025924 Ga0207694_10020385 Ga0207694_100203854 285
206 3300025924 Ga0207694_10282552 Ga0207694_102825522 285
207 3300025949 Ga0207667_10056998 Ga0207667_100569984 285
208 3300025981 Ga0207640_10030517 Ga0207640_100305172 285
209 3300026041 Ga0207639_10161154 Ga0207639_101611542 285
210 3300026067 Ga0207678_10172172 Ga0207678_101721723 285
211 3300026078 Ga0207702_10367085 Ga0207702_103670852 285
212 3300026142 Ga0207698_10302939 Ga0207698_103029392 285
213 3300028379 Ga0268266_10340610 Ga0268266_103406102 285
214 3300037418 Ga0395900_0002361 Ga0395900_0002361_773_1714 285
215 3300037466 Ga0395898_0000321 Ga0395898_0000321_32959_33900 285
216 3300045049 Ga0466959_0302737 Ga0466959_0302737_77_1018 285
217 3300048905 Ga0496102_0034668 Ga0496102_0034668_1092_2033 285
218 3300048907 Ga0496104_0022193 Ga0496104_0022193_1412_2353 285
219 3300048908 Ga0496105_0034784 Ga0496105_0034784_147_1088 285
220 3300048910 Ga0496107_0051609 Ga0496107_0051609_1261_2202 285
221 3300048913 Ga0496110_0526842 Ga0496110_0526842_14_955 285
222 3300048916 Ga0496113_0228900 Ga0496113_0228900_333_1274 285
223 3300048918 Ga0496115_0075834 Ga0496115_0075834_1463_2404 285
224 3300048920 Ga0496117_0033470 Ga0496117_0033470_1478_2419 285
225 3300048921 Ga0496118_0075814 Ga0496118_0075814_930_1871 285
226 3300049586 Ga0501070_0000508 Ga0501070_0000508_28308_29249 285
227 iso_pu_bacteria 2844852863 2844853139 285
228 iso_pu_bacteria 8056037122 8056038412 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

105

307

0.84

Feature Viewer

pLDDT pTM Quality
57.04 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map