F340878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 228 | 124 | 228 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10360253|Ga0105240_103602532 |
| Length | 307 |
| Sequence | MVNRGWSDNPHPPGKRLTIQGMEDIQELPYVPCTSCMVKRIKIKKPMLVLAILICQLGAFAQTDTPWHHKKCAVVITYDDAYDQQLDNAIPVLDSLGLKATFYITAFSNSMQTRLNDWKKIAANGHELGNHTLFHPCNGGKGREWVNPDHDLSKYSVQRMIDETRMTNLFLRALDGKTKRTFAFTCGDMKIGDSSFINAMKDDFVAARAVRNQMHKINEIDLYNVDCYVVNGETGRQMIEWVKEALETNSLLVILFHGVNGGNALNVSLQAHSQLLHFLKQNEKDIWVAPMIDVAEYIKNYQSGKQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 111 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 114 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 115 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 116 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 117 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 118 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 119 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.88 |
| Nodule | 0 |
| Rhizoplane | 0.44 |
| Rhizosphere | 98.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10069781 | 3300005290 | Bacteria | 6664 |
| 2 | Ga0065712_10077202 | 3300005290 | Bacteria | 3533 |
| 3 | Ga0065712_10114367 | 3300005290 | Bacteria | 1741 |
| 4 | Ga0070658_10003051 | 3300005327 | Bacteria | 13840 |
| 5 | Ga0070676_10013383 | 3300005328 | Unclassified | 4495 |
| 6 | Ga0070676_10014771 | 3300005328 | Unclassified | 4296 |
| 7 | Ga0070690_100008836 | 3300005330 | Bacteria | 5820 |
| 8 | Ga0070690_100180170 | 3300005330 | Bacteria | 1459 |
| 9 | Ga0070670_100039322 | 3300005331 | Unclassified | 4068 |
| 10 | Ga0070677_10111674 | 3300005333 | Bacteria | 1221 |
| 11 | Ga0068869_100004083 | 3300005334 | Bacteria | 9040 |
| 12 | Ga0068869_100012478 | 3300005334 | Bacteria | 5618 |
| 13 | Ga0068869_100034627 | 3300005334 | Bacteria | 3574 |
| 14 | Ga0068869_100058441 | 3300005334 | Bacteria | 2820 |
| 15 | Ga0070666_10019086 | 3300005335 | Bacteria | 4421 |
| 16 | Ga0070682_100064960 | 3300005337 | Bacteria | 2318 |
| 17 | Ga0070689_100010929 | 3300005340 | Bacteria | 6487 |
| 18 | Ga0070661_100075355 | 3300005344 | Unclassified | 2486 |
| 19 | Ga0070668_100177617 | 3300005347 | Bacteria | 1737 |
| 20 | Ga0070669_100118570 | 3300005353 | Bacteria | 2016 |
| 21 | Ga0070669_100239586 | 3300005353 | Bacteria | 1441 |
| 22 | Ga0070675_100119021 | 3300005354 | Unclassified | 2243 |
| 23 | Ga0070675_100177642 | 3300005354 | Bacteria | 1839 |
| 24 | Ga0070675_100610011 | 3300005354 | Bacteria | 990 |
| 25 | Ga0070673_100003315 | 3300005364 | Bacteria | 10000 |
| 26 | Ga0070673_100014649 | 3300005364 | Bacteria | 5473 |
| 27 | Ga0070688_100003822 | 3300005365 | Bacteria | 7806 |
| 28 | Ga0070667_100689476 | 3300005367 | Unclassified | 945 |
| 29 | Ga0070700_100266958 | 3300005441 | Bacteria | 1235 |
| 30 | Ga0070678_100365945 | 3300005456 | Bacteria | 1244 |
| 31 | Ga0070662_100056700 | 3300005457 | Bacteria | 2845 |
| 32 | Ga0070662_100057906 | 3300005457 | Bacteria | 2817 |
| 33 | Ga0070662_100115568 | 3300005457 | Bacteria | 2050 |
| 34 | Ga0068867_100090397 | 3300005459 | Bacteria | 2323 |
| 35 | Ga0068867_100184135 | 3300005459 | Unclassified | 1662 |
| 36 | Ga0070685_10002344 | 3300005466 | Bacteria | 9762 |
| 37 | Ga0070699_100107997 | 3300005518 | Bacteria | 2442 |
| 38 | Ga0070684_100082960 | 3300005535 | Bacteria | 2839 |
| 39 | Ga0070697_100292833 | 3300005536 | Bacteria | 1398 |
| 40 | Ga0068853_100005786 | 3300005539 | Bacteria | 9741 |
| 41 | Ga0068853_100027117 | 3300005539 | Bacteria | 4814 |
| 42 | Ga0068853_100157135 | 3300005539 | Unclassified | 2049 |
| 43 | Ga0070672_100001626 | 3300005543 | Bacteria | 13977 |
| 44 | Ga0070672_100254262 | 3300005543 | Bacteria | 1480 |
| 45 | Ga0070665_100005267 | 3300005548 | Bacteria | 13366 |
| 46 | Ga0068855_100268950 | 3300005563 | Unclassified | 1896 |
| 47 | Ga0070664_100044339 | 3300005564 | Bacteria | 3755 |
| 48 | Ga0068857_100048102 | 3300005577 | Bacteria | 3787 |
| 49 | Ga0068857_100274050 | 3300005577 | Bacteria | 1551 |
| 50 | Ga0068852_100193544 | 3300005616 | Bacteria | 1920 |
| 51 | Ga0068852_100261475 | 3300005616 | Bacteria | 1662 |
| 52 | Ga0068859_100053665 | 3300005617 | Bacteria | 4054 |
| 53 | Ga0068859_100135992 | 3300005617 | Bacteria | 2531 |
| 54 | Ga0068864_100017012 | 3300005618 | Bacteria | 6060 |
| 55 | Ga0068864_100117762 | 3300005618 | Bacteria | 2371 |
| 56 | Ga0068864_100169357 | 3300005618 | Bacteria | 1990 |
| 57 | Ga0068866_10201470 | 3300005718 | Bacteria | 1189 |
| 58 | Ga0068861_100102127 | 3300005719 | Bacteria | 2282 |
| 59 | Ga0068851_10050063 | 3300005834 | Bacteria | 2121 |
| 60 | Ga0068863_100007139 | 3300005841 | Bacteria | 10956 |
| 61 | Ga0068863_100029012 | 3300005841 | Bacteria | 5285 |
| 62 | Ga0068863_100185612 | 3300005841 | Bacteria | 1997 |
| 63 | Ga0068863_100321162 | 3300005841 | Bacteria | 1504 |
| 64 | Ga0068863_100382347 | 3300005841 | Bacteria | 1375 |
| 65 | Ga0068863_100457033 | 3300005841 | Bacteria | 1254 |
| 66 | Ga0068863_100750113 | 3300005841 | Bacteria | 972 |
| 67 | Ga0068858_100088635 | 3300005842 | Unclassified | 2879 |
| 68 | Ga0068858_100121031 | 3300005842 | Bacteria | 2448 |
| 69 | Ga0068860_100028752 | 3300005843 | Bacteria | 5350 |
| 70 | Ga0081539_10010553 | 3300005985 | Bacteria | 7481 |
| 71 | Ga0097621_100054673 | 3300006237 | Bacteria | 3257 |
| 72 | Ga0097621_100078043 | 3300006237 | Unclassified | 2750 |
| 73 | Ga0097621_100099570 | 3300006237 | Unclassified | 2443 |
| 74 | Ga0097621_100210567 | 3300006237 | Bacteria | 1691 |
| 75 | Ga0068871_100020912 | 3300006358 | Bacteria | 5019 |
| 76 | Ga0068871_100051836 | 3300006358 | Bacteria | 3322 |
| 77 | Ga0068871_100092537 | 3300006358 | Unclassified | 2522 |
| 78 | Ga0068871_100123508 | 3300006358 | Bacteria | 2189 |
| 79 | Ga0068871_100129566 | 3300006358 | Unclassified | 2138 |
| 80 | Ga0075430_100111564 | 3300006846 | Unclassified | 2280 |
| 81 | Ga0075434_100216717 | 3300006871 | Unclassified | 1934 |
| 82 | Ga0068865_100006650 | 3300006881 | Bacteria | 7074 |
| 83 | Ga0097620_100053664 | 3300006931 | Bacteria | 4054 |
| 84 | Ga0097620_100135986 | 3300006931 | Bacteria | 2531 |
| 85 | Ga0105240_10360253 | 3300009093 | Bacteria | 1647 |
| 86 | Ga0111539_10451290 | 3300009094 | Bacteria | 1497 |
| 87 | Ga0111539_10505551 | 3300009094 | Bacteria | 1407 |
| 88 | Ga0105247_10014052 | 3300009101 | Bacteria | 4802 |
| 89 | Ga0114129_10422104 | 3300009147 | Bacteria | 1754 |
| 90 | Ga0105241_10511341 | 3300009174 | Bacteria | 1072 |
| 91 | Ga0105242_10069042 | 3300009176 | Unclassified | 2926 |
| 92 | Ga0105242_10618366 | 3300009176 | Bacteria | 1049 |
| 93 | Ga0105249_10001461 | 3300009553 | Bacteria | 20711 |
| 94 | Ga0105249_10044746 | 3300009553 | Bacteria | 4025 |
| 95 | Ga0105249_10316555 | 3300009553 | Bacteria | 1570 |
| 96 | Ga0105239_10263124 | 3300010375 | Bacteria | 1939 |
| 97 | Ga0105246_10160988 | 3300011119 | Bacteria | 1710 |
| 98 | Ga0157373_10094767 | 3300013100 | Bacteria | 2101 |
| 99 | Ga0157371_10045875 | 3300013102 | Bacteria | 3109 |
| 100 | Ga0157370_10124684 | 3300013104 | Bacteria | 2405 |
| 101 | Ga0157374_10097420 | 3300013296 | Bacteria | 2814 |
| 102 | Ga0157374_10511764 | 3300013296 | Bacteria | 1206 |
| 103 | Ga0157378_10031985 | 3300013297 | Bacteria | 4648 |
| 104 | Ga0157378_10117305 | 3300013297 | Unclassified | 2449 |
| 105 | Ga0157378_10140382 | 3300013297 | Unclassified | 2243 |
| 106 | Ga0163162_10010873 | 3300013306 | Bacteria | 8857 |
| 107 | Ga0163162_10015649 | 3300013306 | Bacteria | 7413 |
| 108 | Ga0163162_10030960 | 3300013306 | Bacteria | 5304 |
| 109 | Ga0163162_10042156 | 3300013306 | Bacteria | 4567 |
| 110 | Ga0163162_10081821 | 3300013306 | Bacteria | 3300 |
| 111 | Ga0163162_10124531 | 3300013306 | Unclassified | 2683 |
| 112 | Ga0163162_10260443 | 3300013306 | Bacteria | 1866 |
| 113 | Ga0163162_10261497 | 3300013306 | Bacteria | 1862 |
| 114 | Ga0157372_10052311 | 3300013307 | Bacteria | 4547 |
| 115 | Ga0157372_10587300 | 3300013307 | Bacteria | 1298 |
| 116 | Ga0157375_10018626 | 3300013308 | Bacteria | 6300 |
| 117 | Ga0157375_10028400 | 3300013308 | Bacteria | 5243 |
| 118 | Ga0157375_10575718 | 3300013308 | Bacteria | 1286 |
| 119 | Ga0157375_10851211 | 3300013308 | Bacteria | 1058 |
| 120 | Ga0163163_10299969 | 3300014325 | Bacteria | 1659 |
| 121 | Ga0163163_10471508 | 3300014325 | Bacteria | 1316 |
| 122 | Ga0163163_10724088 | 3300014325 | Bacteria | 1058 |
| 123 | Ga0157380_10049792 | 3300014326 | Bacteria | 3306 |
| 124 | Ga0157380_10348425 | 3300014326 | Bacteria | 1385 |
| 125 | Ga0157380_10558346 | 3300014326 | Bacteria | 1125 |
| 126 | Ga0157377_10018443 | 3300014745 | Bacteria | 3626 |
| 127 | Ga0157377_10054567 | 3300014745 | Bacteria | 2263 |
| 128 | Ga0157377_10259798 | 3300014745 | Bacteria | 1129 |
| 129 | Ga0157379_10222079 | 3300014968 | Bacteria | 1712 |
| 130 | Ga0157379_10848595 | 3300014968 | Bacteria | 864 |
| 131 | Ga0157376_10003445 | 3300014969 | Bacteria | 10895 |
| 132 | Ga0157376_10397960 | 3300014969 | Bacteria | 1331 |
| 133 | Ga0163161_10053265 | 3300017792 | Unclassified | 2934 |
| 134 | Ga0207656_10034938 | 3300025321 | Bacteria | 2102 |
| 135 | Ga0207682_10022478 | 3300025893 | Unclassified | 2485 |
| 136 | Ga0207642_10008833 | 3300025899 | Bacteria | 3479 |
| 137 | Ga0207642_10272354 | 3300025899 | Bacteria | 970 |
| 138 | Ga0207710_10007805 | 3300025900 | Bacteria | 4531 |
| 139 | Ga0207645_10006660 | 3300025907 | Bacteria | 8250 |
| 140 | Ga0207705_10387556 | 3300025909 | Bacteria | 1080 |
| 141 | Ga0207654_10309723 | 3300025911 | Unclassified | 1076 |
| 142 | Ga0207649_10347415 | 3300025920 | Bacteria | 1097 |
| 143 | Ga0207650_10034467 | 3300025925 | Unclassified | 3672 |
| 144 | Ga0207659_10171079 | 3300025926 | Bacteria | 1714 |
| 145 | Ga0207659_10539087 | 3300025926 | Bacteria | 991 |
| 146 | Ga0207659_10699333 | 3300025926 | Bacteria | 868 |
| 147 | Ga0207644_10145034 | 3300025931 | Bacteria | 1832 |
| 148 | Ga0207706_10013503 | 3300025933 | Bacteria | 7422 |
| 149 | Ga0207706_10015535 | 3300025933 | Bacteria | 6879 |
| 150 | Ga0207706_10048326 | 3300025933 | Bacteria | 3763 |
| 151 | Ga0207670_10008414 | 3300025936 | Bacteria | 5825 |
| 152 | Ga0207704_10023971 | 3300025938 | Unclassified | 3299 |
| 153 | Ga0207691_10001273 | 3300025940 | Bacteria | 25203 |
| 154 | Ga0207691_10070900 | 3300025940 | Bacteria | 3146 |
| 155 | Ga0207689_10001613 | 3300025942 | Bacteria | 21369 |
| 156 | Ga0207689_10017720 | 3300025942 | Bacteria | 6019 |
| 157 | Ga0207689_10046168 | 3300025942 | Bacteria | 3601 |
| 158 | Ga0207689_10050936 | 3300025942 | Bacteria | 3413 |
| 159 | Ga0207679_10006099 | 3300025945 | Bacteria | 7603 |
| 160 | Ga0207667_10091056 | 3300025949 | Unclassified | 3151 |
| 161 | Ga0207651_10014333 | 3300025960 | Unclassified | 4572 |
| 162 | Ga0207651_10033327 | 3300025960 | Unclassified | 3321 |
| 163 | Ga0207651_10535847 | 3300025960 | Bacteria | 1016 |
| 164 | Ga0207712_10005534 | 3300025961 | Bacteria | 7968 |
| 165 | Ga0207712_10008111 | 3300025961 | Bacteria | 6644 |
| 166 | Ga0207712_10019092 | 3300025961 | Bacteria | 4472 |
| 167 | Ga0207712_10155697 | 3300025961 | Bacteria | 1770 |
| 168 | Ga0207712_10271760 | 3300025961 | Bacteria | 1379 |
| 169 | Ga0207668_10000617 | 3300025972 | Bacteria | 22106 |
| 170 | Ga0207640_10304879 | 3300025981 | Unclassified | 1261 |
| 171 | Ga0207658_10546178 | 3300025986 | Bacteria | 1036 |
| 172 | Ga0207677_10031956 | 3300026023 | Bacteria | 3377 |
| 173 | Ga0207677_10041670 | 3300026023 | Unclassified | 3038 |
| 174 | Ga0207677_10042677 | 3300026023 | Bacteria | 3009 |
| 175 | Ga0207703_10005566 | 3300026035 | Bacteria | 10108 |
| 176 | Ga0207703_10198762 | 3300026035 | Bacteria | 1780 |
| 177 | Ga0207639_10016795 | 3300026041 | Bacteria | 5185 |
| 178 | Ga0207639_10030276 | 3300026041 | Unclassified | 3969 |
| 179 | Ga0207639_10084340 | 3300026041 | Unclassified | 2524 |
| 180 | Ga0207639_10281281 | 3300026041 | Bacteria | 1463 |
| 181 | Ga0207678_10519245 | 3300026067 | Bacteria | 1039 |
| 182 | Ga0207708_10189119 | 3300026075 | Unclassified | 1638 |
| 183 | Ga0207641_10000434 | 3300026088 | Bacteria | 47935 |
| 184 | Ga0207641_10078618 | 3300026088 | Bacteria | 2857 |
| 185 | Ga0207641_10161639 | 3300026088 | Bacteria | 2037 |
| 186 | Ga0207641_10276716 | 3300026088 | Bacteria | 1577 |
| 187 | Ga0207641_10343743 | 3300026088 | Bacteria | 1420 |
| 188 | Ga0207641_10661804 | 3300026088 | Bacteria | 1026 |
| 189 | Ga0207648_10013378 | 3300026089 | Bacteria | 7635 |
| 190 | Ga0207648_10049267 | 3300026089 | Bacteria | 3687 |
| 191 | Ga0207648_10645913 | 3300026089 | Bacteria | 978 |
| 192 | Ga0207676_10049154 | 3300026095 | Bacteria | 3279 |
| 193 | Ga0207676_10102421 | 3300026095 | Bacteria | 2377 |
| 194 | Ga0207676_10150196 | 3300026095 | Unclassified | 2005 |
| 195 | Ga0207676_10230759 | 3300026095 | Bacteria | 1654 |
| 196 | Ga0207674_10055335 | 3300026116 | Bacteria | 4034 |
| 197 | Ga0207674_10140177 | 3300026116 | Bacteria | 2377 |
| 198 | Ga0207674_10713421 | 3300026116 | Unclassified | 968 |
| 199 | Ga0207675_100003656 | 3300026118 | Bacteria | 14991 |
| 200 | Ga0207675_100068349 | 3300026118 | Bacteria | 3320 |
| 201 | Ga0207675_100103361 | 3300026118 | Unclassified | 2685 |
| 202 | Ga0207675_100293540 | 3300026118 | Bacteria | 1582 |
| 203 | Ga0207675_100339287 | 3300026118 | Bacteria | 1471 |
| 204 | Ga0207683_10014693 | 3300026121 | Bacteria | 6667 |
| 205 | Ga0207698_10491224 | 3300026142 | Bacteria | 1193 |
| 206 | Ga0209974_10011062 | 3300027876 | Bacteria | 3037 |
| 207 | Ga0268266_10017042 | 3300028379 | Bacteria | 6204 |
| 208 | Ga0268264_10006594 | 3300028381 | Bacteria | 9762 |
| 209 | Ga0268264_10013513 | 3300028381 | Bacteria | 6724 |
| 210 | Ga0268264_10826769 | 3300028381 | Bacteria | 927 |
| 211 | Ga0268264_10986323 | 3300028381 | Bacteria | 849 |
| 212 | Ga0265327_10025632 | 3300031251 | Bacteria | 3433 |
| 213 | Ga0450923_006496 | 3300042125 | Bacteria | 1942 |
| 214 | Ga0495586_0224222 | 3300046535 | Bacteria | 1069 |
| 215 | Ga0495686_0012135 | 3300047472 | Bacteria | 6045 |
| 216 | Ga0495686_0014968 | 3300047472 | Bacteria | 5319 |
| 217 | Ga0496104_0495314 | 3300048907 | Bacteria | 1133 |
| 218 | Ga0501202_010835 | 3300049652 | Bacteria | 1698 |
| 219 | Ga0501206_004327 | 3300049653 | Unclassified | 1805 |
| 220 | Ga0501257_000448 | 3300049686 | Bacteria | 8141 |
| 221 | Ga0501259_008365 | 3300049688 | Bacteria | 1665 |
| 222 | nmdc:mga0k408_132418_c1 | 3300050493 | Unclassified | 1480 |
| 223 | nmdc:mga05p37_373027_c1 | 3300050507 | Bacteria | 1674 |
| 224 | nmdc:mga0qj67_261794_c1 | 3300050509 | Bacteria | 1403 |
| 225 | nmdc:mga06r32_226002_c1 | 3300050510 | Bacteria | 1860 |
| 226 | nmdc:mga08y16_744739_c1 | 3300050511 | Unclassified | 976 |
| 227 | nmdc:mga0n895_188758_c1 | 3300050512 | Unclassified | 2092 |
| 228 | Ga0500616_0002741 | 3300053153 | Bacteria | 14266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10081821 | Ga0163162_100818212 | 246 |
| 2 | 3300005335 | Ga0070666_10019086 | Ga0070666_100190863 | 252 |
| 3 | 3300026023 | Ga0207677_10042677 | Ga0207677_100426772 | 252 |
| 4 | 3300005330 | Ga0070690_100008836 | Ga0070690_1000088365 | 258 |
| 5 | 3300005334 | Ga0068869_100058441 | Ga0068869_1000584413 | 258 |
| 6 | 3300005354 | Ga0070675_100610011 | Ga0070675_1006100111 | 258 |
| 7 | 3300005364 | Ga0070673_100014649 | Ga0070673_1000146496 | 258 |
| 8 | 3300005456 | Ga0070678_100365945 | Ga0070678_1003659452 | 258 |
| 9 | 3300005457 | Ga0070662_100057906 | Ga0070662_1000579063 | 258 |
| 10 | 3300005616 | Ga0068852_100261475 | Ga0068852_1002614752 | 258 |
| 11 | 3300005718 | Ga0068866_10201470 | Ga0068866_102014702 | 258 |
| 12 | 3300006237 | Ga0097621_100054673 | Ga0097621_1000546732 | 258 |
| 13 | 3300006358 | Ga0068871_100123508 | Ga0068871_1001235082 | 258 |
| 14 | 3300025926 | Ga0207659_10539087 | Ga0207659_105390871 | 258 |
| 15 | 3300025931 | Ga0207644_10145034 | Ga0207644_101450342 | 258 |
| 16 | 3300025933 | Ga0207706_10048326 | Ga0207706_100483263 | 258 |
| 17 | 3300025960 | Ga0207651_10535847 | Ga0207651_105358471 | 258 |
| 18 | 3300025981 | Ga0207640_10304879 | Ga0207640_103048791 | 258 |
| 19 | 3300025986 | Ga0207658_10546178 | Ga0207658_105461781 | 258 |
| 20 | 3300026035 | Ga0207703_10198762 | Ga0207703_101987622 | 258 |
| 21 | 3300026041 | Ga0207639_10281281 | Ga0207639_102812811 | 258 |
| 22 | 3300005459 | Ga0068867_100184135 | Ga0068867_1001841351 | 260 |
| 23 | 3300013306 | Ga0163162_10261497 | Ga0163162_102614972 | 260 |
| 24 | 3300026089 | Ga0207648_10645913 | Ga0207648_106459131 | 260 |
| 25 | 3300031251 | Ga0265327_10025632 | Ga0265327_100256324 | 260 |
| 26 | 3300047472 | Ga0495686_0012135 | Ga0495686_0012135_4950_5738 | 260 |
| 27 | 3300047472 | Ga0495686_0014968 | Ga0495686_0014968_2911_3699 | 260 |
| 28 | 3300005333 | Ga0070677_10111674 | Ga0070677_101116741 | 261 |
| 29 | 3300005337 | Ga0070682_100064960 | Ga0070682_1000649602 | 261 |
| 30 | 3300005367 | Ga0070667_100689476 | Ga0070667_1006894761 | 261 |
| 31 | 3300005518 | Ga0070699_100107997 | Ga0070699_1001079972 | 261 |
| 32 | 3300005536 | Ga0070697_100292833 | Ga0070697_1002928332 | 261 |
| 33 | 3300005577 | Ga0068857_100048102 | Ga0068857_1000481022 | 261 |
| 34 | 3300005719 | Ga0068861_100102127 | Ga0068861_1001021272 | 261 |
| 35 | 3300005841 | Ga0068863_100007139 | Ga0068863_1000071399 | 261 |
| 36 | 3300005841 | Ga0068863_100321162 | Ga0068863_1003211622 | 261 |
| 37 | 3300006846 | Ga0075430_100111564 | Ga0075430_1001115642 | 261 |
| 38 | 3300009094 | Ga0111539_10451290 | Ga0111539_104512901 | 261 |
| 39 | 3300009147 | Ga0114129_10422104 | Ga0114129_104221042 | 261 |
| 40 | 3300009553 | Ga0105249_10316555 | Ga0105249_103165552 | 261 |
| 41 | 3300014325 | Ga0163163_10471508 | Ga0163163_104715082 | 261 |
| 42 | 3300014326 | Ga0157380_10049792 | Ga0157380_100497923 | 261 |
| 43 | 3300014326 | Ga0157380_10558346 | Ga0157380_105583461 | 261 |
| 44 | 3300025961 | Ga0207712_10155697 | Ga0207712_101556972 | 261 |
| 45 | 3300025961 | Ga0207712_10271760 | Ga0207712_102717602 | 261 |
| 46 | 3300026088 | Ga0207641_10000434 | Ga0207641_1000043420 | 261 |
| 47 | 3300026116 | Ga0207674_10055335 | Ga0207674_100553352 | 261 |
| 48 | 3300026118 | Ga0207675_100003656 | Ga0207675_1000036562 | 261 |
| 49 | 3300028381 | Ga0268264_10986323 | Ga0268264_109863231 | 261 |
| 50 | 3300042125 | Ga0450923_006496 | Ga0450923_006496_849_1634 | 261 |
| 51 | 3300050507 | nmdc:mga05p37_373027_c1 | nmdc:mga05p37_373027_c1_122_907 | 261 |
| 52 | 3300050509 | nmdc:mga0qj67_261794_c1 | nmdc:mga0qj67_261794_c1_108_893 | 261 |
| 53 | 3300050510 | nmdc:mga06r32_226002_c1 | nmdc:mga06r32_226002_c1_752_1537 | 261 |
| 54 | 3300050511 | nmdc:mga08y16_744739_c1 | nmdc:mga08y16_744739_c1_127_918 | 261 |
| 55 | 3300005290 | Ga0065712_10069781 | Ga0065712_100697813 | 262 |
| 56 | 3300005290 | Ga0065712_10077202 | Ga0065712_100772022 | 262 |
| 57 | 3300005290 | Ga0065712_10114367 | Ga0065712_101143672 | 262 |
| 58 | 3300005327 | Ga0070658_10003051 | Ga0070658_1000305114 | 262 |
| 59 | 3300005328 | Ga0070676_10013383 | Ga0070676_100133833 | 262 |
| 60 | 3300005328 | Ga0070676_10014771 | Ga0070676_100147713 | 262 |
| 61 | 3300005330 | Ga0070690_100180170 | Ga0070690_1001801701 | 262 |
| 62 | 3300005331 | Ga0070670_100039322 | Ga0070670_1000393223 | 262 |
| 63 | 3300005334 | Ga0068869_100004083 | Ga0068869_1000040837 | 262 |
| 64 | 3300005334 | Ga0068869_100012478 | Ga0068869_1000124783 | 262 |
| 65 | 3300005334 | Ga0068869_100034627 | Ga0068869_1000346272 | 262 |
| 66 | 3300005340 | Ga0070689_100010929 | Ga0070689_1000109293 | 262 |
| 67 | 3300005344 | Ga0070661_100075355 | Ga0070661_1000753552 | 262 |
| 68 | 3300005347 | Ga0070668_100177617 | Ga0070668_1001776172 | 262 |
| 69 | 3300005353 | Ga0070669_100118570 | Ga0070669_1001185701 | 262 |
| 70 | 3300005353 | Ga0070669_100239586 | Ga0070669_1002395862 | 262 |
| 71 | 3300005354 | Ga0070675_100119021 | Ga0070675_1001190213 | 262 |
| 72 | 3300005354 | Ga0070675_100177642 | Ga0070675_1001776422 | 262 |
| 73 | 3300005364 | Ga0070673_100003315 | Ga0070673_1000033155 | 262 |
| 74 | 3300005365 | Ga0070688_100003822 | Ga0070688_1000038225 | 262 |
| 75 | 3300005441 | Ga0070700_100266958 | Ga0070700_1002669582 | 262 |
| 76 | 3300005457 | Ga0070662_100056700 | Ga0070662_1000567003 | 262 |
| 77 | 3300005457 | Ga0070662_100115568 | Ga0070662_1001155681 | 262 |
| 78 | 3300005459 | Ga0068867_100090397 | Ga0068867_1000903972 | 262 |
| 79 | 3300005466 | Ga0070685_10002344 | Ga0070685_100023445 | 262 |
| 80 | 3300005535 | Ga0070684_100082960 | Ga0070684_1000829602 | 262 |
| 81 | 3300005539 | Ga0068853_100005786 | Ga0068853_1000057862 | 262 |
| 82 | 3300005539 | Ga0068853_100027117 | Ga0068853_1000271172 | 262 |
| 83 | 3300005539 | Ga0068853_100157135 | Ga0068853_1001571352 | 262 |
| 84 | 3300005543 | Ga0070672_100001626 | Ga0070672_1000016265 | 262 |
| 85 | 3300005543 | Ga0070672_100254262 | Ga0070672_1002542622 | 262 |
| 86 | 3300005548 | Ga0070665_100005267 | Ga0070665_1000052672 | 262 |
| 87 | 3300005563 | Ga0068855_100268950 | Ga0068855_1002689502 | 262 |
| 88 | 3300005564 | Ga0070664_100044339 | Ga0070664_1000443394 | 262 |
| 89 | 3300005577 | Ga0068857_100274050 | Ga0068857_1002740502 | 262 |
| 90 | 3300005616 | Ga0068852_100193544 | Ga0068852_1001935442 | 262 |
| 91 | 3300005617 | Ga0068859_100053665 | Ga0068859_1000536653 | 262 |
| 92 | 3300005617 | Ga0068859_100135992 | Ga0068859_1001359922 | 262 |
| 93 | 3300005618 | Ga0068864_100017012 | Ga0068864_1000170128 | 262 |
| 94 | 3300005618 | Ga0068864_100117762 | Ga0068864_1001177622 | 262 |
| 95 | 3300005618 | Ga0068864_100169357 | Ga0068864_1001693572 | 262 |
| 96 | 3300005834 | Ga0068851_10050063 | Ga0068851_100500632 | 262 |
| 97 | 3300005841 | Ga0068863_100029012 | Ga0068863_1000290125 | 262 |
| 98 | 3300005841 | Ga0068863_100185612 | Ga0068863_1001856122 | 262 |
| 99 | 3300005841 | Ga0068863_100382347 | Ga0068863_1003823471 | 262 |
| 100 | 3300005841 | Ga0068863_100457033 | Ga0068863_1004570332 | 262 |
| 101 | 3300005841 | Ga0068863_100750113 | Ga0068863_1007501131 | 262 |
| 102 | 3300005842 | Ga0068858_100088635 | Ga0068858_1000886352 | 262 |
| 103 | 3300005842 | Ga0068858_100121031 | Ga0068858_1001210312 | 262 |
| 104 | 3300005843 | Ga0068860_100028752 | Ga0068860_1000287522 | 262 |
| 105 | 3300005985 | Ga0081539_10010553 | Ga0081539_100105535 | 262 |
| 106 | 3300006237 | Ga0097621_100078043 | Ga0097621_1000780432 | 262 |
| 107 | 3300006237 | Ga0097621_100099570 | Ga0097621_1000995703 | 262 |
| 108 | 3300006237 | Ga0097621_100210567 | Ga0097621_1002105671 | 262 |
| 109 | 3300006358 | Ga0068871_100020912 | Ga0068871_1000209123 | 262 |
| 110 | 3300006358 | Ga0068871_100051836 | Ga0068871_1000518362 | 262 |
| 111 | 3300006358 | Ga0068871_100092537 | Ga0068871_1000925372 | 262 |
| 112 | 3300006358 | Ga0068871_100129566 | Ga0068871_1001295664 | 262 |
| 113 | 3300006871 | Ga0075434_100216717 | Ga0075434_1002167172 | 262 |
| 114 | 3300006881 | Ga0068865_100006650 | Ga0068865_1000066509 | 262 |
| 115 | 3300006931 | Ga0097620_100053664 | Ga0097620_1000536643 | 262 |
| 116 | 3300006931 | Ga0097620_100135986 | Ga0097620_1001359862 | 262 |
| 117 | 3300009093 | Ga0105240_10360253 | Ga0105240_103602532 | 262 |
| 118 | 3300009094 | Ga0111539_10505551 | Ga0111539_105055511 | 262 |
| 119 | 3300009101 | Ga0105247_10014052 | Ga0105247_100140523 | 262 |
| 120 | 3300009174 | Ga0105241_10511341 | Ga0105241_105113411 | 262 |
| 121 | 3300009176 | Ga0105242_10069042 | Ga0105242_100690422 | 262 |
| 122 | 3300009176 | Ga0105242_10618366 | Ga0105242_106183661 | 262 |
| 123 | 3300009553 | Ga0105249_10001461 | Ga0105249_100014616 | 262 |
| 124 | 3300009553 | Ga0105249_10044746 | Ga0105249_100447462 | 262 |
| 125 | 3300010375 | Ga0105239_10263124 | Ga0105239_102631242 | 262 |
| 126 | 3300011119 | Ga0105246_10160988 | Ga0105246_101609882 | 262 |
| 127 | 3300013100 | Ga0157373_10094767 | Ga0157373_100947672 | 262 |
| 128 | 3300013102 | Ga0157371_10045875 | Ga0157371_100458753 | 262 |
| 129 | 3300013104 | Ga0157370_10124684 | Ga0157370_101246844 | 262 |
| 130 | 3300013296 | Ga0157374_10097420 | Ga0157374_100974203 | 262 |
| 131 | 3300013296 | Ga0157374_10511764 | Ga0157374_105117642 | 262 |
| 132 | 3300013297 | Ga0157378_10031985 | Ga0157378_100319856 | 262 |
| 133 | 3300013297 | Ga0157378_10117305 | Ga0157378_101173051 | 262 |
| 134 | 3300013297 | Ga0157378_10140382 | Ga0157378_101403821 | 262 |
| 135 | 3300013306 | Ga0163162_10010873 | Ga0163162_100108732 | 262 |
| 136 | 3300013306 | Ga0163162_10015649 | Ga0163162_100156492 | 262 |
| 137 | 3300013306 | Ga0163162_10030960 | Ga0163162_100309604 | 262 |
| 138 | 3300013306 | Ga0163162_10042156 | Ga0163162_100421563 | 262 |
| 139 | 3300013306 | Ga0163162_10124531 | Ga0163162_101245315 | 262 |
| 140 | 3300013306 | Ga0163162_10260443 | Ga0163162_102604432 | 262 |
| 141 | 3300013307 | Ga0157372_10052311 | Ga0157372_100523112 | 262 |
| 142 | 3300013307 | Ga0157372_10587300 | Ga0157372_105873002 | 262 |
| 143 | 3300013308 | Ga0157375_10018626 | Ga0157375_100186266 | 262 |
| 144 | 3300013308 | Ga0157375_10028400 | Ga0157375_100284005 | 262 |
| 145 | 3300013308 | Ga0157375_10575718 | Ga0157375_105757181 | 262 |
| 146 | 3300013308 | Ga0157375_10851211 | Ga0157375_108512111 | 262 |
| 147 | 3300014325 | Ga0163163_10299969 | Ga0163163_102999692 | 262 |
| 148 | 3300014325 | Ga0163163_10724088 | Ga0163163_107240881 | 262 |
| 149 | 3300014326 | Ga0157380_10348425 | Ga0157380_103484252 | 262 |
| 150 | 3300014745 | Ga0157377_10018443 | Ga0157377_100184432 | 262 |
| 151 | 3300014745 | Ga0157377_10054567 | Ga0157377_100545672 | 262 |
| 152 | 3300014745 | Ga0157377_10259798 | Ga0157377_102597981 | 262 |
| 153 | 3300014968 | Ga0157379_10222079 | Ga0157379_102220792 | 262 |
| 154 | 3300014968 | Ga0157379_10848595 | Ga0157379_108485951 | 262 |
| 155 | 3300014969 | Ga0157376_10003445 | Ga0157376_1000344511 | 262 |
| 156 | 3300014969 | Ga0157376_10397960 | Ga0157376_103979602 | 262 |
| 157 | 3300017792 | Ga0163161_10053265 | Ga0163161_100532652 | 262 |
| 158 | 3300025321 | Ga0207656_10034938 | Ga0207656_100349382 | 262 |
| 159 | 3300025893 | Ga0207682_10022478 | Ga0207682_100224782 | 262 |
| 160 | 3300025899 | Ga0207642_10008833 | Ga0207642_100088333 | 262 |
| 161 | 3300025899 | Ga0207642_10272354 | Ga0207642_102723542 | 262 |
| 162 | 3300025900 | Ga0207710_10007805 | Ga0207710_100078053 | 262 |
| 163 | 3300025907 | Ga0207645_10006660 | Ga0207645_100066607 | 262 |
| 164 | 3300025909 | Ga0207705_10387556 | Ga0207705_103875562 | 262 |
| 165 | 3300025911 | Ga0207654_10309723 | Ga0207654_103097231 | 262 |
| 166 | 3300025920 | Ga0207649_10347415 | Ga0207649_103474151 | 262 |
| 167 | 3300025925 | Ga0207650_10034467 | Ga0207650_100344673 | 262 |
| 168 | 3300025926 | Ga0207659_10171079 | Ga0207659_101710792 | 262 |
| 169 | 3300025926 | Ga0207659_10699333 | Ga0207659_106993331 | 262 |
| 170 | 3300025933 | Ga0207706_10013503 | Ga0207706_100135037 | 262 |
| 171 | 3300025933 | Ga0207706_10015535 | Ga0207706_100155357 | 262 |
| 172 | 3300025936 | Ga0207670_10008414 | Ga0207670_100084142 | 262 |
| 173 | 3300025938 | Ga0207704_10023971 | Ga0207704_100239713 | 262 |
| 174 | 3300025940 | Ga0207691_10001273 | Ga0207691_100012735 | 262 |
| 175 | 3300025940 | Ga0207691_10070900 | Ga0207691_100709002 | 262 |
| 176 | 3300025942 | Ga0207689_10001613 | Ga0207689_100016134 | 262 |
| 177 | 3300025942 | Ga0207689_10017720 | Ga0207689_100177202 | 262 |
| 178 | 3300025942 | Ga0207689_10046168 | Ga0207689_100461682 | 262 |
| 179 | 3300025942 | Ga0207689_10050936 | Ga0207689_100509362 | 262 |
| 180 | 3300025945 | Ga0207679_10006099 | Ga0207679_100060997 | 262 |
| 181 | 3300025949 | Ga0207667_10091056 | Ga0207667_100910562 | 262 |
| 182 | 3300025960 | Ga0207651_10014333 | Ga0207651_100143335 | 262 |
| 183 | 3300025960 | Ga0207651_10033327 | Ga0207651_100333273 | 262 |
| 184 | 3300025961 | Ga0207712_10005534 | Ga0207712_100055345 | 262 |
| 185 | 3300025961 | Ga0207712_10008111 | Ga0207712_100081114 | 262 |
| 186 | 3300025961 | Ga0207712_10019092 | Ga0207712_100190923 | 262 |
| 187 | 3300025972 | Ga0207668_10000617 | Ga0207668_100006175 | 262 |
| 188 | 3300026023 | Ga0207677_10031956 | Ga0207677_100319562 | 262 |
| 189 | 3300026023 | Ga0207677_10041670 | Ga0207677_100416701 | 262 |
| 190 | 3300026035 | Ga0207703_10005566 | Ga0207703_100055663 | 262 |
| 191 | 3300026041 | Ga0207639_10016795 | Ga0207639_100167953 | 262 |
| 192 | 3300026041 | Ga0207639_10030276 | Ga0207639_100302763 | 262 |
| 193 | 3300026041 | Ga0207639_10084340 | Ga0207639_100843402 | 262 |
| 194 | 3300026067 | Ga0207678_10519245 | Ga0207678_105192451 | 262 |
| 195 | 3300026075 | Ga0207708_10189119 | Ga0207708_101891192 | 262 |
| 196 | 3300026088 | Ga0207641_10078618 | Ga0207641_100786182 | 262 |
| 197 | 3300026088 | Ga0207641_10161639 | Ga0207641_101616392 | 262 |
| 198 | 3300026088 | Ga0207641_10276716 | Ga0207641_102767162 | 262 |
| 199 | 3300026088 | Ga0207641_10343743 | Ga0207641_103437431 | 262 |
| 200 | 3300026088 | Ga0207641_10661804 | Ga0207641_106618041 | 262 |
| 201 | 3300026089 | Ga0207648_10013378 | Ga0207648_100133781 | 262 |
| 202 | 3300026089 | Ga0207648_10049267 | Ga0207648_100492673 | 262 |
| 203 | 3300026095 | Ga0207676_10049154 | Ga0207676_100491542 | 262 |
| 204 | 3300026095 | Ga0207676_10102421 | Ga0207676_101024212 | 262 |
| 205 | 3300026095 | Ga0207676_10150196 | Ga0207676_101501961 | 262 |
| 206 | 3300026095 | Ga0207676_10230759 | Ga0207676_102307592 | 262 |
| 207 | 3300026116 | Ga0207674_10140177 | Ga0207674_101401772 | 262 |
| 208 | 3300026116 | Ga0207674_10713421 | Ga0207674_107134211 | 262 |
| 209 | 3300026118 | Ga0207675_100068349 | Ga0207675_1000683492 | 262 |
| 210 | 3300026118 | Ga0207675_100103361 | Ga0207675_1001033612 | 262 |
| 211 | 3300026118 | Ga0207675_100293540 | Ga0207675_1002935402 | 262 |
| 212 | 3300026118 | Ga0207675_100339287 | Ga0207675_1003392872 | 262 |
| 213 | 3300026121 | Ga0207683_10014693 | Ga0207683_100146934 | 262 |
| 214 | 3300026142 | Ga0207698_10491224 | Ga0207698_104912241 | 262 |
| 215 | 3300027876 | Ga0209974_10011062 | Ga0209974_100110622 | 262 |
| 216 | 3300028379 | Ga0268266_10017042 | Ga0268266_100170426 | 262 |
| 217 | 3300028381 | Ga0268264_10006594 | Ga0268264_100065945 | 262 |
| 218 | 3300028381 | Ga0268264_10013513 | Ga0268264_100135137 | 262 |
| 219 | 3300028381 | Ga0268264_10826769 | Ga0268264_108267692 | 262 |
| 220 | 3300046535 | Ga0495586_0224222 | Ga0495586_0224222_103_891 | 262 |
| 221 | 3300048907 | Ga0496104_0495314 | Ga0496104_0495314_273_1079 | 262 |
| 222 | 3300049652 | Ga0501202_010835 | Ga0501202_010835_385_1194 | 262 |
| 223 | 3300049653 | Ga0501206_004327 | Ga0501206_004327_14_823 | 262 |
| 224 | 3300049686 | Ga0501257_000448 | Ga0501257_000448_6826_7635 | 262 |
| 225 | 3300049688 | Ga0501259_008365 | Ga0501259_008365_610_1419 | 262 |
| 226 | 3300050493 | nmdc:mga0k408_132418_c1 | nmdc:mga0k408_132418_c1_257_1051 | 262 |
| 227 | 3300050512 | nmdc:mga0n895_188758_c1 | nmdc:mga0n895_188758_c1_439_1233 | 262 |
| 228 | 3300053153 | Ga0500616_0002741 | Ga0500616_0002741_8832_9632 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2j13-assembly1.cif.gz_A | structure of a family 4 carbohydrate esterase from bacillus anthracis | 0.7415 | 27 | 254 |
| 6hm9-assembly1.cif.gz_A | crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. | 0.7167 | 27 | 252 |
| 6h8n-assembly1.cif.gz_A | structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s | 0.7089 | 29 | 261 |
| 5n1j-assembly1.cif.gz_A | crystal structure of the polysaccharide deacetylase bc1974 from bacillus cereus | 0.7063 | 29 | 247 |
| 5o6y-assembly1.cif.gz_A | crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide | 0.7019 | 27 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j13A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7415 | 27 | 254 | 3.20.20.370 |
| 2y8uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7013 | 30 | 252 | 3.20.20.370 |
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.6956 | 27 | 248 | 3.20.20.370 |
| 2c79A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.6802 | 30 | 257 | 3.20.20.370 |
| 5jmuA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.6714 | 30 | 248 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I1Q3U5-F1-model_v4 | Polysaccharide deacetylase | 0.9626 | 24 | 91 |
GO:0005975
GO:0016810 |
| AF-A0A3D3DJR0-F1-model_v4 | NodB homology domain-containing protein | 0.961 | 32 | 96 |
GO:0005975
GO:0016810 |
| AF-A0A537ICE9-F1-model_v4 | Chitooligosaccharide deacetylase | 0.9528 | 23 | 262 |
GO:0005975
GO:0016810 |
| AF-A0A537I2T2-F1-model_v4 | Chitooligosaccharide deacetylase | 0.9525 | 18 | 261 |
GO:0005975
GO:0016810 |
| AF-A0A1M5BSB6-F1-model_v4 | Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family | 0.9505 | 23 | 261 |
GO:0005975
GO:0016810 GO:0052689 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar