F340878

General Info

Members Datasets Scaffolds Average Seq Length
228 124 228 267

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10360253|Ga0105240_103602532
Length 307
Sequence MVNRGWSDNPHPPGKRLTIQGMEDIQELPYVPCTSCMVKRIKIKKPMLVLAILICQLGAFAQTDTPWHHKKCAVVITYDDAYDQQLDNAIPVLDSLGLKATFYITAFSNSMQTRLNDWKKIAANGHELGNHTLFHPCNGGKGREWVNPDHDLSKYSVQRMIDETRMTNLFLRALDGKTKRTFAFTCGDMKIGDSSFINAMKDDFVAARAVRNQMHKINEIDLYNVDCYVVNGETGRQMIEWVKEALETNSLLVILFHGVNGGNALNVSLQAHSQLLHFLKQNEKDIWVAPMIDVAEYIKNYQSGKQK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
115 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 0.44
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10069781 3300005290 Bacteria 6664
2 Ga0065712_10077202 3300005290 Bacteria 3533
3 Ga0065712_10114367 3300005290 Bacteria 1741
4 Ga0070658_10003051 3300005327 Bacteria 13840
5 Ga0070676_10013383 3300005328 Unclassified 4495
6 Ga0070676_10014771 3300005328 Unclassified 4296
7 Ga0070690_100008836 3300005330 Bacteria 5820
8 Ga0070690_100180170 3300005330 Bacteria 1459
9 Ga0070670_100039322 3300005331 Unclassified 4068
10 Ga0070677_10111674 3300005333 Bacteria 1221
11 Ga0068869_100004083 3300005334 Bacteria 9040
12 Ga0068869_100012478 3300005334 Bacteria 5618
13 Ga0068869_100034627 3300005334 Bacteria 3574
14 Ga0068869_100058441 3300005334 Bacteria 2820
15 Ga0070666_10019086 3300005335 Bacteria 4421
16 Ga0070682_100064960 3300005337 Bacteria 2318
17 Ga0070689_100010929 3300005340 Bacteria 6487
18 Ga0070661_100075355 3300005344 Unclassified 2486
19 Ga0070668_100177617 3300005347 Bacteria 1737
20 Ga0070669_100118570 3300005353 Bacteria 2016
21 Ga0070669_100239586 3300005353 Bacteria 1441
22 Ga0070675_100119021 3300005354 Unclassified 2243
23 Ga0070675_100177642 3300005354 Bacteria 1839
24 Ga0070675_100610011 3300005354 Bacteria 990
25 Ga0070673_100003315 3300005364 Bacteria 10000
26 Ga0070673_100014649 3300005364 Bacteria 5473
27 Ga0070688_100003822 3300005365 Bacteria 7806
28 Ga0070667_100689476 3300005367 Unclassified 945
29 Ga0070700_100266958 3300005441 Bacteria 1235
30 Ga0070678_100365945 3300005456 Bacteria 1244
31 Ga0070662_100056700 3300005457 Bacteria 2845
32 Ga0070662_100057906 3300005457 Bacteria 2817
33 Ga0070662_100115568 3300005457 Bacteria 2050
34 Ga0068867_100090397 3300005459 Bacteria 2323
35 Ga0068867_100184135 3300005459 Unclassified 1662
36 Ga0070685_10002344 3300005466 Bacteria 9762
37 Ga0070699_100107997 3300005518 Bacteria 2442
38 Ga0070684_100082960 3300005535 Bacteria 2839
39 Ga0070697_100292833 3300005536 Bacteria 1398
40 Ga0068853_100005786 3300005539 Bacteria 9741
41 Ga0068853_100027117 3300005539 Bacteria 4814
42 Ga0068853_100157135 3300005539 Unclassified 2049
43 Ga0070672_100001626 3300005543 Bacteria 13977
44 Ga0070672_100254262 3300005543 Bacteria 1480
45 Ga0070665_100005267 3300005548 Bacteria 13366
46 Ga0068855_100268950 3300005563 Unclassified 1896
47 Ga0070664_100044339 3300005564 Bacteria 3755
48 Ga0068857_100048102 3300005577 Bacteria 3787
49 Ga0068857_100274050 3300005577 Bacteria 1551
50 Ga0068852_100193544 3300005616 Bacteria 1920
51 Ga0068852_100261475 3300005616 Bacteria 1662
52 Ga0068859_100053665 3300005617 Bacteria 4054
53 Ga0068859_100135992 3300005617 Bacteria 2531
54 Ga0068864_100017012 3300005618 Bacteria 6060
55 Ga0068864_100117762 3300005618 Bacteria 2371
56 Ga0068864_100169357 3300005618 Bacteria 1990
57 Ga0068866_10201470 3300005718 Bacteria 1189
58 Ga0068861_100102127 3300005719 Bacteria 2282
59 Ga0068851_10050063 3300005834 Bacteria 2121
60 Ga0068863_100007139 3300005841 Bacteria 10956
61 Ga0068863_100029012 3300005841 Bacteria 5285
62 Ga0068863_100185612 3300005841 Bacteria 1997
63 Ga0068863_100321162 3300005841 Bacteria 1504
64 Ga0068863_100382347 3300005841 Bacteria 1375
65 Ga0068863_100457033 3300005841 Bacteria 1254
66 Ga0068863_100750113 3300005841 Bacteria 972
67 Ga0068858_100088635 3300005842 Unclassified 2879
68 Ga0068858_100121031 3300005842 Bacteria 2448
69 Ga0068860_100028752 3300005843 Bacteria 5350
70 Ga0081539_10010553 3300005985 Bacteria 7481
71 Ga0097621_100054673 3300006237 Bacteria 3257
72 Ga0097621_100078043 3300006237 Unclassified 2750
73 Ga0097621_100099570 3300006237 Unclassified 2443
74 Ga0097621_100210567 3300006237 Bacteria 1691
75 Ga0068871_100020912 3300006358 Bacteria 5019
76 Ga0068871_100051836 3300006358 Bacteria 3322
77 Ga0068871_100092537 3300006358 Unclassified 2522
78 Ga0068871_100123508 3300006358 Bacteria 2189
79 Ga0068871_100129566 3300006358 Unclassified 2138
80 Ga0075430_100111564 3300006846 Unclassified 2280
81 Ga0075434_100216717 3300006871 Unclassified 1934
82 Ga0068865_100006650 3300006881 Bacteria 7074
83 Ga0097620_100053664 3300006931 Bacteria 4054
84 Ga0097620_100135986 3300006931 Bacteria 2531
85 Ga0105240_10360253 3300009093 Bacteria 1647
86 Ga0111539_10451290 3300009094 Bacteria 1497
87 Ga0111539_10505551 3300009094 Bacteria 1407
88 Ga0105247_10014052 3300009101 Bacteria 4802
89 Ga0114129_10422104 3300009147 Bacteria 1754
90 Ga0105241_10511341 3300009174 Bacteria 1072
91 Ga0105242_10069042 3300009176 Unclassified 2926
92 Ga0105242_10618366 3300009176 Bacteria 1049
93 Ga0105249_10001461 3300009553 Bacteria 20711
94 Ga0105249_10044746 3300009553 Bacteria 4025
95 Ga0105249_10316555 3300009553 Bacteria 1570
96 Ga0105239_10263124 3300010375 Bacteria 1939
97 Ga0105246_10160988 3300011119 Bacteria 1710
98 Ga0157373_10094767 3300013100 Bacteria 2101
99 Ga0157371_10045875 3300013102 Bacteria 3109
100 Ga0157370_10124684 3300013104 Bacteria 2405
101 Ga0157374_10097420 3300013296 Bacteria 2814
102 Ga0157374_10511764 3300013296 Bacteria 1206
103 Ga0157378_10031985 3300013297 Bacteria 4648
104 Ga0157378_10117305 3300013297 Unclassified 2449
105 Ga0157378_10140382 3300013297 Unclassified 2243
106 Ga0163162_10010873 3300013306 Bacteria 8857
107 Ga0163162_10015649 3300013306 Bacteria 7413
108 Ga0163162_10030960 3300013306 Bacteria 5304
109 Ga0163162_10042156 3300013306 Bacteria 4567
110 Ga0163162_10081821 3300013306 Bacteria 3300
111 Ga0163162_10124531 3300013306 Unclassified 2683
112 Ga0163162_10260443 3300013306 Bacteria 1866
113 Ga0163162_10261497 3300013306 Bacteria 1862
114 Ga0157372_10052311 3300013307 Bacteria 4547
115 Ga0157372_10587300 3300013307 Bacteria 1298
116 Ga0157375_10018626 3300013308 Bacteria 6300
117 Ga0157375_10028400 3300013308 Bacteria 5243
118 Ga0157375_10575718 3300013308 Bacteria 1286
119 Ga0157375_10851211 3300013308 Bacteria 1058
120 Ga0163163_10299969 3300014325 Bacteria 1659
121 Ga0163163_10471508 3300014325 Bacteria 1316
122 Ga0163163_10724088 3300014325 Bacteria 1058
123 Ga0157380_10049792 3300014326 Bacteria 3306
124 Ga0157380_10348425 3300014326 Bacteria 1385
125 Ga0157380_10558346 3300014326 Bacteria 1125
126 Ga0157377_10018443 3300014745 Bacteria 3626
127 Ga0157377_10054567 3300014745 Bacteria 2263
128 Ga0157377_10259798 3300014745 Bacteria 1129
129 Ga0157379_10222079 3300014968 Bacteria 1712
130 Ga0157379_10848595 3300014968 Bacteria 864
131 Ga0157376_10003445 3300014969 Bacteria 10895
132 Ga0157376_10397960 3300014969 Bacteria 1331
133 Ga0163161_10053265 3300017792 Unclassified 2934
134 Ga0207656_10034938 3300025321 Bacteria 2102
135 Ga0207682_10022478 3300025893 Unclassified 2485
136 Ga0207642_10008833 3300025899 Bacteria 3479
137 Ga0207642_10272354 3300025899 Bacteria 970
138 Ga0207710_10007805 3300025900 Bacteria 4531
139 Ga0207645_10006660 3300025907 Bacteria 8250
140 Ga0207705_10387556 3300025909 Bacteria 1080
141 Ga0207654_10309723 3300025911 Unclassified 1076
142 Ga0207649_10347415 3300025920 Bacteria 1097
143 Ga0207650_10034467 3300025925 Unclassified 3672
144 Ga0207659_10171079 3300025926 Bacteria 1714
145 Ga0207659_10539087 3300025926 Bacteria 991
146 Ga0207659_10699333 3300025926 Bacteria 868
147 Ga0207644_10145034 3300025931 Bacteria 1832
148 Ga0207706_10013503 3300025933 Bacteria 7422
149 Ga0207706_10015535 3300025933 Bacteria 6879
150 Ga0207706_10048326 3300025933 Bacteria 3763
151 Ga0207670_10008414 3300025936 Bacteria 5825
152 Ga0207704_10023971 3300025938 Unclassified 3299
153 Ga0207691_10001273 3300025940 Bacteria 25203
154 Ga0207691_10070900 3300025940 Bacteria 3146
155 Ga0207689_10001613 3300025942 Bacteria 21369
156 Ga0207689_10017720 3300025942 Bacteria 6019
157 Ga0207689_10046168 3300025942 Bacteria 3601
158 Ga0207689_10050936 3300025942 Bacteria 3413
159 Ga0207679_10006099 3300025945 Bacteria 7603
160 Ga0207667_10091056 3300025949 Unclassified 3151
161 Ga0207651_10014333 3300025960 Unclassified 4572
162 Ga0207651_10033327 3300025960 Unclassified 3321
163 Ga0207651_10535847 3300025960 Bacteria 1016
164 Ga0207712_10005534 3300025961 Bacteria 7968
165 Ga0207712_10008111 3300025961 Bacteria 6644
166 Ga0207712_10019092 3300025961 Bacteria 4472
167 Ga0207712_10155697 3300025961 Bacteria 1770
168 Ga0207712_10271760 3300025961 Bacteria 1379
169 Ga0207668_10000617 3300025972 Bacteria 22106
170 Ga0207640_10304879 3300025981 Unclassified 1261
171 Ga0207658_10546178 3300025986 Bacteria 1036
172 Ga0207677_10031956 3300026023 Bacteria 3377
173 Ga0207677_10041670 3300026023 Unclassified 3038
174 Ga0207677_10042677 3300026023 Bacteria 3009
175 Ga0207703_10005566 3300026035 Bacteria 10108
176 Ga0207703_10198762 3300026035 Bacteria 1780
177 Ga0207639_10016795 3300026041 Bacteria 5185
178 Ga0207639_10030276 3300026041 Unclassified 3969
179 Ga0207639_10084340 3300026041 Unclassified 2524
180 Ga0207639_10281281 3300026041 Bacteria 1463
181 Ga0207678_10519245 3300026067 Bacteria 1039
182 Ga0207708_10189119 3300026075 Unclassified 1638
183 Ga0207641_10000434 3300026088 Bacteria 47935
184 Ga0207641_10078618 3300026088 Bacteria 2857
185 Ga0207641_10161639 3300026088 Bacteria 2037
186 Ga0207641_10276716 3300026088 Bacteria 1577
187 Ga0207641_10343743 3300026088 Bacteria 1420
188 Ga0207641_10661804 3300026088 Bacteria 1026
189 Ga0207648_10013378 3300026089 Bacteria 7635
190 Ga0207648_10049267 3300026089 Bacteria 3687
191 Ga0207648_10645913 3300026089 Bacteria 978
192 Ga0207676_10049154 3300026095 Bacteria 3279
193 Ga0207676_10102421 3300026095 Bacteria 2377
194 Ga0207676_10150196 3300026095 Unclassified 2005
195 Ga0207676_10230759 3300026095 Bacteria 1654
196 Ga0207674_10055335 3300026116 Bacteria 4034
197 Ga0207674_10140177 3300026116 Bacteria 2377
198 Ga0207674_10713421 3300026116 Unclassified 968
199 Ga0207675_100003656 3300026118 Bacteria 14991
200 Ga0207675_100068349 3300026118 Bacteria 3320
201 Ga0207675_100103361 3300026118 Unclassified 2685
202 Ga0207675_100293540 3300026118 Bacteria 1582
203 Ga0207675_100339287 3300026118 Bacteria 1471
204 Ga0207683_10014693 3300026121 Bacteria 6667
205 Ga0207698_10491224 3300026142 Bacteria 1193
206 Ga0209974_10011062 3300027876 Bacteria 3037
207 Ga0268266_10017042 3300028379 Bacteria 6204
208 Ga0268264_10006594 3300028381 Bacteria 9762
209 Ga0268264_10013513 3300028381 Bacteria 6724
210 Ga0268264_10826769 3300028381 Bacteria 927
211 Ga0268264_10986323 3300028381 Bacteria 849
212 Ga0265327_10025632 3300031251 Bacteria 3433
213 Ga0450923_006496 3300042125 Bacteria 1942
214 Ga0495586_0224222 3300046535 Bacteria 1069
215 Ga0495686_0012135 3300047472 Bacteria 6045
216 Ga0495686_0014968 3300047472 Bacteria 5319
217 Ga0496104_0495314 3300048907 Bacteria 1133
218 Ga0501202_010835 3300049652 Bacteria 1698
219 Ga0501206_004327 3300049653 Unclassified 1805
220 Ga0501257_000448 3300049686 Bacteria 8141
221 Ga0501259_008365 3300049688 Bacteria 1665
222 nmdc:mga0k408_132418_c1 3300050493 Unclassified 1480
223 nmdc:mga05p37_373027_c1 3300050507 Bacteria 1674
224 nmdc:mga0qj67_261794_c1 3300050509 Bacteria 1403
225 nmdc:mga06r32_226002_c1 3300050510 Bacteria 1860
226 nmdc:mga08y16_744739_c1 3300050511 Unclassified 976
227 nmdc:mga0n895_188758_c1 3300050512 Unclassified 2092
228 Ga0500616_0002741 3300053153 Bacteria 14266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10081821 Ga0163162_100818212 246
2 3300005335 Ga0070666_10019086 Ga0070666_100190863 252
3 3300026023 Ga0207677_10042677 Ga0207677_100426772 252
4 3300005330 Ga0070690_100008836 Ga0070690_1000088365 258
5 3300005334 Ga0068869_100058441 Ga0068869_1000584413 258
6 3300005354 Ga0070675_100610011 Ga0070675_1006100111 258
7 3300005364 Ga0070673_100014649 Ga0070673_1000146496 258
8 3300005456 Ga0070678_100365945 Ga0070678_1003659452 258
9 3300005457 Ga0070662_100057906 Ga0070662_1000579063 258
10 3300005616 Ga0068852_100261475 Ga0068852_1002614752 258
11 3300005718 Ga0068866_10201470 Ga0068866_102014702 258
12 3300006237 Ga0097621_100054673 Ga0097621_1000546732 258
13 3300006358 Ga0068871_100123508 Ga0068871_1001235082 258
14 3300025926 Ga0207659_10539087 Ga0207659_105390871 258
15 3300025931 Ga0207644_10145034 Ga0207644_101450342 258
16 3300025933 Ga0207706_10048326 Ga0207706_100483263 258
17 3300025960 Ga0207651_10535847 Ga0207651_105358471 258
18 3300025981 Ga0207640_10304879 Ga0207640_103048791 258
19 3300025986 Ga0207658_10546178 Ga0207658_105461781 258
20 3300026035 Ga0207703_10198762 Ga0207703_101987622 258
21 3300026041 Ga0207639_10281281 Ga0207639_102812811 258
22 3300005459 Ga0068867_100184135 Ga0068867_1001841351 260
23 3300013306 Ga0163162_10261497 Ga0163162_102614972 260
24 3300026089 Ga0207648_10645913 Ga0207648_106459131 260
25 3300031251 Ga0265327_10025632 Ga0265327_100256324 260
26 3300047472 Ga0495686_0012135 Ga0495686_0012135_4950_5738 260
27 3300047472 Ga0495686_0014968 Ga0495686_0014968_2911_3699 260
28 3300005333 Ga0070677_10111674 Ga0070677_101116741 261
29 3300005337 Ga0070682_100064960 Ga0070682_1000649602 261
30 3300005367 Ga0070667_100689476 Ga0070667_1006894761 261
31 3300005518 Ga0070699_100107997 Ga0070699_1001079972 261
32 3300005536 Ga0070697_100292833 Ga0070697_1002928332 261
33 3300005577 Ga0068857_100048102 Ga0068857_1000481022 261
34 3300005719 Ga0068861_100102127 Ga0068861_1001021272 261
35 3300005841 Ga0068863_100007139 Ga0068863_1000071399 261
36 3300005841 Ga0068863_100321162 Ga0068863_1003211622 261
37 3300006846 Ga0075430_100111564 Ga0075430_1001115642 261
38 3300009094 Ga0111539_10451290 Ga0111539_104512901 261
39 3300009147 Ga0114129_10422104 Ga0114129_104221042 261
40 3300009553 Ga0105249_10316555 Ga0105249_103165552 261
41 3300014325 Ga0163163_10471508 Ga0163163_104715082 261
42 3300014326 Ga0157380_10049792 Ga0157380_100497923 261
43 3300014326 Ga0157380_10558346 Ga0157380_105583461 261
44 3300025961 Ga0207712_10155697 Ga0207712_101556972 261
45 3300025961 Ga0207712_10271760 Ga0207712_102717602 261
46 3300026088 Ga0207641_10000434 Ga0207641_1000043420 261
47 3300026116 Ga0207674_10055335 Ga0207674_100553352 261
48 3300026118 Ga0207675_100003656 Ga0207675_1000036562 261
49 3300028381 Ga0268264_10986323 Ga0268264_109863231 261
50 3300042125 Ga0450923_006496 Ga0450923_006496_849_1634 261
51 3300050507 nmdc:mga05p37_373027_c1 nmdc:mga05p37_373027_c1_122_907 261
52 3300050509 nmdc:mga0qj67_261794_c1 nmdc:mga0qj67_261794_c1_108_893 261
53 3300050510 nmdc:mga06r32_226002_c1 nmdc:mga06r32_226002_c1_752_1537 261
54 3300050511 nmdc:mga08y16_744739_c1 nmdc:mga08y16_744739_c1_127_918 261
55 3300005290 Ga0065712_10069781 Ga0065712_100697813 262
56 3300005290 Ga0065712_10077202 Ga0065712_100772022 262
57 3300005290 Ga0065712_10114367 Ga0065712_101143672 262
58 3300005327 Ga0070658_10003051 Ga0070658_1000305114 262
59 3300005328 Ga0070676_10013383 Ga0070676_100133833 262
60 3300005328 Ga0070676_10014771 Ga0070676_100147713 262
61 3300005330 Ga0070690_100180170 Ga0070690_1001801701 262
62 3300005331 Ga0070670_100039322 Ga0070670_1000393223 262
63 3300005334 Ga0068869_100004083 Ga0068869_1000040837 262
64 3300005334 Ga0068869_100012478 Ga0068869_1000124783 262
65 3300005334 Ga0068869_100034627 Ga0068869_1000346272 262
66 3300005340 Ga0070689_100010929 Ga0070689_1000109293 262
67 3300005344 Ga0070661_100075355 Ga0070661_1000753552 262
68 3300005347 Ga0070668_100177617 Ga0070668_1001776172 262
69 3300005353 Ga0070669_100118570 Ga0070669_1001185701 262
70 3300005353 Ga0070669_100239586 Ga0070669_1002395862 262
71 3300005354 Ga0070675_100119021 Ga0070675_1001190213 262
72 3300005354 Ga0070675_100177642 Ga0070675_1001776422 262
73 3300005364 Ga0070673_100003315 Ga0070673_1000033155 262
74 3300005365 Ga0070688_100003822 Ga0070688_1000038225 262
75 3300005441 Ga0070700_100266958 Ga0070700_1002669582 262
76 3300005457 Ga0070662_100056700 Ga0070662_1000567003 262
77 3300005457 Ga0070662_100115568 Ga0070662_1001155681 262
78 3300005459 Ga0068867_100090397 Ga0068867_1000903972 262
79 3300005466 Ga0070685_10002344 Ga0070685_100023445 262
80 3300005535 Ga0070684_100082960 Ga0070684_1000829602 262
81 3300005539 Ga0068853_100005786 Ga0068853_1000057862 262
82 3300005539 Ga0068853_100027117 Ga0068853_1000271172 262
83 3300005539 Ga0068853_100157135 Ga0068853_1001571352 262
84 3300005543 Ga0070672_100001626 Ga0070672_1000016265 262
85 3300005543 Ga0070672_100254262 Ga0070672_1002542622 262
86 3300005548 Ga0070665_100005267 Ga0070665_1000052672 262
87 3300005563 Ga0068855_100268950 Ga0068855_1002689502 262
88 3300005564 Ga0070664_100044339 Ga0070664_1000443394 262
89 3300005577 Ga0068857_100274050 Ga0068857_1002740502 262
90 3300005616 Ga0068852_100193544 Ga0068852_1001935442 262
91 3300005617 Ga0068859_100053665 Ga0068859_1000536653 262
92 3300005617 Ga0068859_100135992 Ga0068859_1001359922 262
93 3300005618 Ga0068864_100017012 Ga0068864_1000170128 262
94 3300005618 Ga0068864_100117762 Ga0068864_1001177622 262
95 3300005618 Ga0068864_100169357 Ga0068864_1001693572 262
96 3300005834 Ga0068851_10050063 Ga0068851_100500632 262
97 3300005841 Ga0068863_100029012 Ga0068863_1000290125 262
98 3300005841 Ga0068863_100185612 Ga0068863_1001856122 262
99 3300005841 Ga0068863_100382347 Ga0068863_1003823471 262
100 3300005841 Ga0068863_100457033 Ga0068863_1004570332 262
101 3300005841 Ga0068863_100750113 Ga0068863_1007501131 262
102 3300005842 Ga0068858_100088635 Ga0068858_1000886352 262
103 3300005842 Ga0068858_100121031 Ga0068858_1001210312 262
104 3300005843 Ga0068860_100028752 Ga0068860_1000287522 262
105 3300005985 Ga0081539_10010553 Ga0081539_100105535 262
106 3300006237 Ga0097621_100078043 Ga0097621_1000780432 262
107 3300006237 Ga0097621_100099570 Ga0097621_1000995703 262
108 3300006237 Ga0097621_100210567 Ga0097621_1002105671 262
109 3300006358 Ga0068871_100020912 Ga0068871_1000209123 262
110 3300006358 Ga0068871_100051836 Ga0068871_1000518362 262
111 3300006358 Ga0068871_100092537 Ga0068871_1000925372 262
112 3300006358 Ga0068871_100129566 Ga0068871_1001295664 262
113 3300006871 Ga0075434_100216717 Ga0075434_1002167172 262
114 3300006881 Ga0068865_100006650 Ga0068865_1000066509 262
115 3300006931 Ga0097620_100053664 Ga0097620_1000536643 262
116 3300006931 Ga0097620_100135986 Ga0097620_1001359862 262
117 3300009093 Ga0105240_10360253 Ga0105240_103602532 262
118 3300009094 Ga0111539_10505551 Ga0111539_105055511 262
119 3300009101 Ga0105247_10014052 Ga0105247_100140523 262
120 3300009174 Ga0105241_10511341 Ga0105241_105113411 262
121 3300009176 Ga0105242_10069042 Ga0105242_100690422 262
122 3300009176 Ga0105242_10618366 Ga0105242_106183661 262
123 3300009553 Ga0105249_10001461 Ga0105249_100014616 262
124 3300009553 Ga0105249_10044746 Ga0105249_100447462 262
125 3300010375 Ga0105239_10263124 Ga0105239_102631242 262
126 3300011119 Ga0105246_10160988 Ga0105246_101609882 262
127 3300013100 Ga0157373_10094767 Ga0157373_100947672 262
128 3300013102 Ga0157371_10045875 Ga0157371_100458753 262
129 3300013104 Ga0157370_10124684 Ga0157370_101246844 262
130 3300013296 Ga0157374_10097420 Ga0157374_100974203 262
131 3300013296 Ga0157374_10511764 Ga0157374_105117642 262
132 3300013297 Ga0157378_10031985 Ga0157378_100319856 262
133 3300013297 Ga0157378_10117305 Ga0157378_101173051 262
134 3300013297 Ga0157378_10140382 Ga0157378_101403821 262
135 3300013306 Ga0163162_10010873 Ga0163162_100108732 262
136 3300013306 Ga0163162_10015649 Ga0163162_100156492 262
137 3300013306 Ga0163162_10030960 Ga0163162_100309604 262
138 3300013306 Ga0163162_10042156 Ga0163162_100421563 262
139 3300013306 Ga0163162_10124531 Ga0163162_101245315 262
140 3300013306 Ga0163162_10260443 Ga0163162_102604432 262
141 3300013307 Ga0157372_10052311 Ga0157372_100523112 262
142 3300013307 Ga0157372_10587300 Ga0157372_105873002 262
143 3300013308 Ga0157375_10018626 Ga0157375_100186266 262
144 3300013308 Ga0157375_10028400 Ga0157375_100284005 262
145 3300013308 Ga0157375_10575718 Ga0157375_105757181 262
146 3300013308 Ga0157375_10851211 Ga0157375_108512111 262
147 3300014325 Ga0163163_10299969 Ga0163163_102999692 262
148 3300014325 Ga0163163_10724088 Ga0163163_107240881 262
149 3300014326 Ga0157380_10348425 Ga0157380_103484252 262
150 3300014745 Ga0157377_10018443 Ga0157377_100184432 262
151 3300014745 Ga0157377_10054567 Ga0157377_100545672 262
152 3300014745 Ga0157377_10259798 Ga0157377_102597981 262
153 3300014968 Ga0157379_10222079 Ga0157379_102220792 262
154 3300014968 Ga0157379_10848595 Ga0157379_108485951 262
155 3300014969 Ga0157376_10003445 Ga0157376_1000344511 262
156 3300014969 Ga0157376_10397960 Ga0157376_103979602 262
157 3300017792 Ga0163161_10053265 Ga0163161_100532652 262
158 3300025321 Ga0207656_10034938 Ga0207656_100349382 262
159 3300025893 Ga0207682_10022478 Ga0207682_100224782 262
160 3300025899 Ga0207642_10008833 Ga0207642_100088333 262
161 3300025899 Ga0207642_10272354 Ga0207642_102723542 262
162 3300025900 Ga0207710_10007805 Ga0207710_100078053 262
163 3300025907 Ga0207645_10006660 Ga0207645_100066607 262
164 3300025909 Ga0207705_10387556 Ga0207705_103875562 262
165 3300025911 Ga0207654_10309723 Ga0207654_103097231 262
166 3300025920 Ga0207649_10347415 Ga0207649_103474151 262
167 3300025925 Ga0207650_10034467 Ga0207650_100344673 262
168 3300025926 Ga0207659_10171079 Ga0207659_101710792 262
169 3300025926 Ga0207659_10699333 Ga0207659_106993331 262
170 3300025933 Ga0207706_10013503 Ga0207706_100135037 262
171 3300025933 Ga0207706_10015535 Ga0207706_100155357 262
172 3300025936 Ga0207670_10008414 Ga0207670_100084142 262
173 3300025938 Ga0207704_10023971 Ga0207704_100239713 262
174 3300025940 Ga0207691_10001273 Ga0207691_100012735 262
175 3300025940 Ga0207691_10070900 Ga0207691_100709002 262
176 3300025942 Ga0207689_10001613 Ga0207689_100016134 262
177 3300025942 Ga0207689_10017720 Ga0207689_100177202 262
178 3300025942 Ga0207689_10046168 Ga0207689_100461682 262
179 3300025942 Ga0207689_10050936 Ga0207689_100509362 262
180 3300025945 Ga0207679_10006099 Ga0207679_100060997 262
181 3300025949 Ga0207667_10091056 Ga0207667_100910562 262
182 3300025960 Ga0207651_10014333 Ga0207651_100143335 262
183 3300025960 Ga0207651_10033327 Ga0207651_100333273 262
184 3300025961 Ga0207712_10005534 Ga0207712_100055345 262
185 3300025961 Ga0207712_10008111 Ga0207712_100081114 262
186 3300025961 Ga0207712_10019092 Ga0207712_100190923 262
187 3300025972 Ga0207668_10000617 Ga0207668_100006175 262
188 3300026023 Ga0207677_10031956 Ga0207677_100319562 262
189 3300026023 Ga0207677_10041670 Ga0207677_100416701 262
190 3300026035 Ga0207703_10005566 Ga0207703_100055663 262
191 3300026041 Ga0207639_10016795 Ga0207639_100167953 262
192 3300026041 Ga0207639_10030276 Ga0207639_100302763 262
193 3300026041 Ga0207639_10084340 Ga0207639_100843402 262
194 3300026067 Ga0207678_10519245 Ga0207678_105192451 262
195 3300026075 Ga0207708_10189119 Ga0207708_101891192 262
196 3300026088 Ga0207641_10078618 Ga0207641_100786182 262
197 3300026088 Ga0207641_10161639 Ga0207641_101616392 262
198 3300026088 Ga0207641_10276716 Ga0207641_102767162 262
199 3300026088 Ga0207641_10343743 Ga0207641_103437431 262
200 3300026088 Ga0207641_10661804 Ga0207641_106618041 262
201 3300026089 Ga0207648_10013378 Ga0207648_100133781 262
202 3300026089 Ga0207648_10049267 Ga0207648_100492673 262
203 3300026095 Ga0207676_10049154 Ga0207676_100491542 262
204 3300026095 Ga0207676_10102421 Ga0207676_101024212 262
205 3300026095 Ga0207676_10150196 Ga0207676_101501961 262
206 3300026095 Ga0207676_10230759 Ga0207676_102307592 262
207 3300026116 Ga0207674_10140177 Ga0207674_101401772 262
208 3300026116 Ga0207674_10713421 Ga0207674_107134211 262
209 3300026118 Ga0207675_100068349 Ga0207675_1000683492 262
210 3300026118 Ga0207675_100103361 Ga0207675_1001033612 262
211 3300026118 Ga0207675_100293540 Ga0207675_1002935402 262
212 3300026118 Ga0207675_100339287 Ga0207675_1003392872 262
213 3300026121 Ga0207683_10014693 Ga0207683_100146934 262
214 3300026142 Ga0207698_10491224 Ga0207698_104912241 262
215 3300027876 Ga0209974_10011062 Ga0209974_100110622 262
216 3300028379 Ga0268266_10017042 Ga0268266_100170426 262
217 3300028381 Ga0268264_10006594 Ga0268264_100065945 262
218 3300028381 Ga0268264_10013513 Ga0268264_100135137 262
219 3300028381 Ga0268264_10826769 Ga0268264_108267692 262
220 3300046535 Ga0495586_0224222 Ga0495586_0224222_103_891 262
221 3300048907 Ga0496104_0495314 Ga0496104_0495314_273_1079 262
222 3300049652 Ga0501202_010835 Ga0501202_010835_385_1194 262
223 3300049653 Ga0501206_004327 Ga0501206_004327_14_823 262
224 3300049686 Ga0501257_000448 Ga0501257_000448_6826_7635 262
225 3300049688 Ga0501259_008365 Ga0501259_008365_610_1419 262
226 3300050493 nmdc:mga0k408_132418_c1 nmdc:mga0k408_132418_c1_257_1051 262
227 3300050512 nmdc:mga0n895_188758_c1 nmdc:mga0n895_188758_c1_439_1233 262
228 3300053153 Ga0500616_0002741 Ga0500616_0002741_8832_9632 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

68

202

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j13-assembly1.cif.gz_A structure of a family 4 carbohydrate esterase from bacillus anthracis 0.7415 27 254
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.7167 27 252
6h8n-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s 0.7089 29 261
5n1j-assembly1.cif.gz_A crystal structure of the polysaccharide deacetylase bc1974 from bacillus cereus 0.7063 29 247
5o6y-assembly1.cif.gz_A crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide 0.7019 27 248
ID Description Score Start End Superfamily
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7415 27 254 3.20.20.370
2y8uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7013 30 252 3.20.20.370
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.6956 27 248 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.6802 30 257 3.20.20.370
5jmuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.6714 30 248 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1I1Q3U5-F1-model_v4 Polysaccharide deacetylase 0.9626 24 91 GO:0005975
GO:0016810
AF-A0A3D3DJR0-F1-model_v4 NodB homology domain-containing protein 0.961 32 96 GO:0005975
GO:0016810
AF-A0A537ICE9-F1-model_v4 Chitooligosaccharide deacetylase 0.9528 23 262 GO:0005975
GO:0016810
AF-A0A537I2T2-F1-model_v4 Chitooligosaccharide deacetylase 0.9525 18 261 GO:0005975
GO:0016810
AF-A0A1M5BSB6-F1-model_v4 Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family 0.9505 23 261 GO:0005975
GO:0016810
GO:0052689

Feature Viewer

pLDDT pTM Quality
87.01 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map