F340804

General Info

Members Datasets Scaffolds Average Seq Length
228 108 456 291

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10052531|Ga0070717_100525311
Length 349
Sequence MRSMTLWLARDRSFTKSAAWIFVRGKIGSVGATLPPGLYVIYSGFRMSSTGERFERAVAIMERLRAPGGCPWDREQTFDSIKPYTLEETYEVLEAIDNRDWPELAGELGDLLLQVLFYAEMAKEQASFSIDDVLDRLSSKLINRHPHVFGDVKADTSDEVKRNWEALKVQERKQWQDAVAAGNSAESKKDEVQSILAGVSSAMPSLLEASKLSSRAAQAGFDWPDIEGLFDKLKEETNELREQLEDFPAPGPRPQGRGVAGSGRTAVPEELQAKLEDEVGDLFFVMVNIARYLSVDPESALRKTNRKFKRRFQWMENRLQQSGRSAEEAPMEELESLWQKAKREERRGA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
42 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10052531 3300006028 Bacteria 3358
2 Ga0070683_100517763 3300005329 Unclassified 1140
3 Ga0070680_100053057 3300005336 Bacteria 3309
4 Ga0070691_10110199 3300005341 Bacteria 1376
5 Ga0070667_100323409 3300005367 Bacteria 1392
6 Ga0070709_10000644 3300005434 Bacteria 19817
7 Ga0070709_10003766 3300005434 Bacteria 8154
8 Ga0070709_10046225 3300005434 Unclassified 2706
9 Ga0070709_10162491 3300005434 Bacteria 1554
10 Ga0070709_10199028 3300005434 Bacteria 1418
11 Ga0070709_10249007 3300005434 Bacteria 1279
12 Ga0070714_100000567 3300005435 Bacteria 26632
13 Ga0070714_100402189 3300005435 Unclassified 1294
14 Ga0070713_100000152 3300005436 Bacteria 46434
15 Ga0070713_100000169 3300005436 Bacteria 43634
16 Ga0070713_100003382 3300005436 Bacteria 10540
17 Ga0070713_100029422 3300005436 Bacteria 4351
18 Ga0070713_100223955 3300005436 Bacteria 1707
19 Ga0070713_100247325 3300005436 Bacteria 1625
20 Ga0070710_10023933 3300005437 Bacteria 3216
21 Ga0070710_10050982 3300005437 Bacteria 2322
22 Ga0070710_10062825 3300005437 Unclassified 2120
23 Ga0070711_100000091 3300005439 Bacteria 49261
24 Ga0070711_100021445 3300005439 Bacteria 4177
25 Ga0070711_100022333 3300005439 Bacteria 4100
26 Ga0070711_100022752 3300005439 Unclassified 4067
27 Ga0070711_100025638 3300005439 Bacteria 3859
28 Ga0070711_100089534 3300005439 Bacteria 2214
29 Ga0070711_100318885 3300005439 Unclassified 1241
30 Ga0070711_100382703 3300005439 Bacteria 1138
31 Ga0070708_100000206 3300005445 Bacteria 43568
32 Ga0070708_100003088 3300005445 Bacteria 12952
33 Ga0070708_100005132 3300005445 Bacteria 10368
34 Ga0070706_100016251 3300005467 Bacteria 6875
35 Ga0070706_100016501 3300005467 Bacteria 6824
36 Ga0070706_100067565 3300005467 Bacteria 3306
37 Ga0070707_100000305 3300005468 Bacteria 48093
38 Ga0070707_100003328 3300005468 Bacteria 15180
39 Ga0070698_100000324 3300005471 Bacteria 48802
40 Ga0070698_100000638 3300005471 Bacteria 37638
41 Ga0070698_100169154 3300005471 Bacteria 2127
42 Ga0070699_100000336 3300005518 Bacteria 45557
43 Ga0070699_100005968 3300005518 Bacteria 10636
44 Ga0070699_100017808 3300005518 Bacteria 6100
45 Ga0070679_100075295 3300005530 Unclassified 3365
46 Ga0070697_100000232 3300005536 Bacteria 45220
47 Ga0070697_100001593 3300005536 Bacteria 17302
48 Ga0070697_100004381 3300005536 Bacteria 10834
49 Ga0070697_100005987 3300005536 Bacteria 9404
50 Ga0070697_100022093 3300005536 Bacteria 5048
51 Ga0070686_100417567 3300005544 Bacteria 1024
52 Ga0070695_100102357 3300005545 Bacteria 1931
53 Ga0070696_100138176 3300005546 Bacteria 1778
54 Ga0068855_100627337 3300005563 Bacteria 1157
55 Ga0068856_100003818 3300005614 Bacteria 15102
56 Ga0068860_100273534 3300005843 Bacteria 1649
57 Ga0070717_10008353 3300006028 Bacteria 7732
58 Ga0070717_10008877 3300006028 Bacteria 7528
59 Ga0070717_10014253 3300006028 Bacteria 6113
60 Ga0070717_10064913 3300006028 Bacteria 3033
61 Ga0070717_10079479 3300006028 Bacteria 2750
62 Ga0070717_10091131 3300006028 Bacteria 2574
63 Ga0070717_10143804 3300006028 Bacteria 2059
64 Ga0070715_10039773 3300006163 Bacteria 1961
65 Ga0070715_10150962 3300006163 Bacteria 1138
66 Ga0070716_100001434 3300006173 Bacteria 10600
67 Ga0070716_100003939 3300006173 Bacteria 7044
68 Ga0070716_100010065 3300006173 Bacteria 4731
69 Ga0070716_100011794 3300006173 Bacteria 4409
70 Ga0070716_100026921 3300006173 Bacteria 3083
71 Ga0070716_100127280 3300006173 Bacteria 1604
72 Ga0070712_100000087 3300006175 Bacteria 48016
73 Ga0070712_100000112 3300006175 Bacteria 42756
74 Ga0070712_100001387 3300006175 Bacteria 14707
75 Ga0070712_100053561 3300006175 Unclassified 2817
76 Ga0070712_100144923 3300006175 Bacteria 1817
77 Ga0075433_10000697 3300006852 Bacteria 22941
78 Ga0075433_10229595 3300006852 Bacteria 1648
79 Ga0075434_100000303 3300006871 Bacteria 34918
80 Ga0075434_100000455 3300006871 Bacteria 30483
81 Ga0075434_100009009 3300006871 Bacteria 9297
82 Ga0075434_100425403 3300006871 Bacteria 1349
83 Ga0068865_100271403 3300006881 Bacteria 1347
84 Ga0075436_100002179 3300006914 Bacteria 13504
85 Ga0075436_100034997 3300006914 Bacteria 3464
86 Ga0075435_100000142 3300007076 Bacteria 40637
87 Ga0075435_100023349 3300007076 Bacteria 4782
88 Ga0075435_100052883 3300007076 Bacteria 3273
89 Ga0075435_100061083 3300007076 Bacteria 3057
90 Ga0075435_100256168 3300007076 Bacteria 1490
91 Ga0099795_10083321 3300007788 Bacteria 1227
92 Ga0105240_10267200 3300009093 Bacteria 1971
93 Ga0114129_10040392 3300009147 Bacteria 6576
94 Ga0105237_10553922 3300009545 Bacteria 1156
95 Ga0099796_10048985 3300010159 Bacteria 1459
96 Ga0157369_10002403 3300013105 Bacteria 22497
97 Ga0157369_10214436 3300013105 Bacteria 2017
98 Ga0157369_10291463 3300013105 Bacteria 1699
99 Ga0157369_10380706 3300013105 Bacteria 1465
100 Ga0157372_10065634 3300013307 Bacteria 4076
101 Ga0157372_10661854 3300013307 Bacteria 1216
102 Ga0182007_10002880 3300015262 Bacteria 8370
103 Ga0154015_1124207 3300020610 Bacteria 1103
104 Ga0224572_1008431 3300024225 Bacteria 1905
105 Ga0228598_1000493 3300024227 Bacteria 8144
106 Ga0228598_1006235 3300024227 Bacteria 2470
107 Ga0207692_10015485 3300025898 Bacteria 3357
108 Ga0207692_10022361 3300025898 Bacteria 2909
109 Ga0207692_10041280 3300025898 Bacteria 2283
110 Ga0207685_10082367 3300025905 Bacteria 1335
111 Ga0207685_10115433 3300025905 Bacteria 1170
112 Ga0207699_10005012 3300025906 Bacteria 6333
113 Ga0207699_10015663 3300025906 Bacteria 3944
114 Ga0207699_10025546 3300025906 Unclassified 3244
115 Ga0207684_10000384 3300025910 Bacteria 59609
116 Ga0207684_10012254 3300025910 Bacteria 7465
117 Ga0207654_10077234 3300025911 Bacteria 1996
118 Ga0207707_10313445 3300025912 Unclassified 1355
119 Ga0207693_10000090 3300025915 Bacteria 81069
120 Ga0207693_10000273 3300025915 Bacteria 47746
121 Ga0207693_10004495 3300025915 Bacteria 11798
122 Ga0207693_10006598 3300025915 Bacteria 9593
123 Ga0207693_10139496 3300025915 Unclassified 1906
124 Ga0207663_10006844 3300025916 Bacteria 5868
125 Ga0207663_10007031 3300025916 Bacteria 5810
126 Ga0207663_10058566 3300025916 Bacteria 2432
127 Ga0207663_10173158 3300025916 Bacteria 1535
128 Ga0207652_10196224 3300025921 Unclassified 1816
129 Ga0207652_10323633 3300025921 Bacteria 1392
130 Ga0207646_10000620 3300025922 Bacteria 46137
131 Ga0207646_10002365 3300025922 Bacteria 22291
132 Ga0207700_10000533 3300025928 Bacteria 22346
133 Ga0207700_10000993 3300025928 Bacteria 16359
134 Ga0207700_10078622 3300025928 Bacteria 2567
135 Ga0207700_10107697 3300025928 Bacteria 2236
136 Ga0207700_10203450 3300025928 Bacteria 1670
137 Ga0207700_10274383 3300025928 Bacteria 1448
138 Ga0207700_10457506 3300025928 Bacteria 1125
139 Ga0207664_10000052 3300025929 Bacteria 131431
140 Ga0207664_10463905 3300025929 Unclassified 1131
141 Ga0207664_10500671 3300025929 Bacteria 1088
142 Ga0207704_10121204 3300025938 Bacteria 1790
143 Ga0207665_10001737 3300025939 Bacteria 14655
144 Ga0207665_10002175 3300025939 Bacteria 13240
145 Ga0207665_10015767 3300025939 Bacteria 4959
146 Ga0207665_10019863 3300025939 Bacteria 4415
147 Ga0207665_10020093 3300025939 Bacteria 4386
148 Ga0207665_10034611 3300025939 Bacteria 3351
149 Ga0207661_10316454 3300025944 Unclassified 1402
150 Ga0207712_10013559 3300025961 Bacteria 5226
151 Ga0207702_10004127 3300026078 Bacteria 13020
152 Ga0207702_10708268 3300026078 Bacteria 992
153 Ga0207683_10007745 3300026121 Bacteria 9195
154 Ga0265356_1000607 3300028017 Bacteria 6276
155 Ga0265338_10000352 3300028800 Bacteria 83563
156 Ga0265338_10024535 3300028800 Bacteria 6156
157 Ga0265338_10108170 3300028800 Bacteria 2246
158 Ga0265762_1000165 3300030760 Bacteria 10436
159 Ga0265762_1002406 3300030760 Bacteria 3391
160 Ga0265760_10002723 3300031090 Bacteria 5173
161 Ga0265328_10012542 3300031239 Unclassified 3371
162 Ga0265325_10011372 3300031241 Bacteria 5115
163 Ga0265340_10073379 3300031247 Bacteria 1619
164 Ga0265340_10114611 3300031247 Bacteria 1243
165 Ga0265339_10017173 3300031249 Bacteria 4290
166 Ga0265316_10206525 3300031344 Unclassified 1454
167 Ga0265342_10083883 3300031712 Bacteria 1836
168 Ga0373926_0014303 3300035083 Bacteria 2697
169 Ga0373944_0058668 3300035089 Bacteria 1230
170 Ga0373945_0068047 3300035116 Bacteria 1342
171 Ga0373953_0086957 3300035117 Bacteria 1305
172 Ga0373943_0041242 3300035170 Bacteria 2231
173 Ga0373955_0099216 3300035172 Bacteria 1669
174 Ga0373935_0007938 3300035692 Bacteria 6365
175 Ga0373935_0011506 3300035692 Bacteria 5312
176 Ga0373947_0028981 3300035725 Unclassified 3248
177 Ga0373947_0029408 3300035725 Bacteria 3224
178 Ga0373947_0116953 3300035725 Bacteria 1691
179 Ga0373947_0309807 3300035725 Unclassified 1054
180 Ga0373937_0042725 3300036401 Bacteria 4136
181 Ga0373937_0315671 3300036401 Bacteria 1478
182 Ga0373925_0019007 3300037068 Bacteria 4994
183 Ga0373925_0019763 3300037068 Bacteria 4902
184 Ga0373925_0135440 3300037068 Bacteria 1924
185 Ga0395905_0016086 3300037471 Bacteria 7111
186 Ga0395905_0081877 3300037471 Bacteria 3025
187 Ga0395905_0095566 3300037471 Bacteria 2789
188 Ga0436364_0502452 3300037853 Bacteria 3588
189 Ga0453683_0008837 3300044673 Bacteria 6745
190 Ga0451576_0162803 3300045051 Bacteria 2328
191 Ga0466967_0172610 3300045976 Bacteria 2035
192 Ga0466967_0197480 3300045976 Bacteria 1904
193 Ga0495603_0077499 3300046455 Bacteria 1950
194 Ga0495629_0010828 3300046459 Bacteria 6633
195 Ga0495580_0005778 3300046472 Bacteria 10154
196 Ga0495580_0009401 3300046472 Bacteria 7690
197 Ga0495580_0028497 3300046472 Bacteria 4059
198 Ga0495580_0130840 3300046472 Bacteria 1741
199 Ga0495582_0000360 3300046473 Bacteria 24917
200 Ga0495582_0019723 3300046473 Bacteria 3687
201 Ga0495639_0144494 3300046475 Bacteria 1145
202 Ga0495630_0122847 3300046517 Bacteria 1970
203 Ga0495665_0018279 3300046531 Bacteria 3767
204 Ga0495645_0112817 3300046543 Bacteria 1922
205 Ga0495658_0084199 3300046683 Bacteria 1872
206 Ga0495669_0042187 3300046684 Bacteria 2028
207 Ga0495581_0056224 3300047315 Bacteria 2271
208 Ga0495674_0013906 3300047319 Bacteria 7550
209 Ga0496102_0473067 3300048905 Bacteria 1174
210 Ga0496104_0059864 3300048907 Bacteria 3606
211 Ga0496105_0150083 3300048908 Bacteria 1916
212 Ga0496106_0022680 3300048909 Bacteria 4665
213 Ga0501083_0024432 3300049744 Bacteria 4186
214 Ga0501083_0153972 3300049744 Bacteria 1505
215 nmdc:mga05p37_61797_c1 3300050507 Bacteria 4610
216 nmdc:mga0n895_3115_c1 3300050512 Bacteria 13216
217 nmdc:mga0n895_5385_c1 3300050512 Bacteria 10680
218 nmdc:mga0n895_5458_c1 3300050512 Bacteria 10635
219 nmdc:mga0rr50_11592_c1 3300050513 Bacteria 5652
220 nmdc:mga0rr50_1173_c1 3300050513 Bacteria 14242
221 nmdc:mga0rr50_1791_c1 3300050513 Bacteria 11865
222 nmdc:mga0rr50_94466_c1 3300050513 Unclassified 2335
223 nmdc:mga08x19_3308_c1 3300050514 Bacteria 9632
224 nmdc:mga08x19_6088_c1 3300050514 Bacteria 7129
225 nmdc:mga0a205_1620_c1 3300050515 Bacteria 19362
226 nmdc:mga0a205_24419_c1 3300050515 Bacteria 5748
227 nmdc:mga0a205_418667_c1 3300050515 Bacteria 1202
228 Ga0495601_0066269 3300053077 Bacteria 2299
229 Ga0070717_10052531
230 Ga0070683_100517763
231 Ga0070680_100053057
232 Ga0070691_10110199
233 Ga0070667_100323409
234 Ga0070709_10000644
235 Ga0070709_10003766
236 Ga0070709_10046225
237 Ga0070709_10162491
238 Ga0070709_10199028
239 Ga0070709_10249007
240 Ga0070714_100000567
241 Ga0070714_100402189
242 Ga0070713_100000152
243 Ga0070713_100000169
244 Ga0070713_100003382
245 Ga0070713_100029422
246 Ga0070713_100223955
247 Ga0070713_100247325
248 Ga0070710_10023933
249 Ga0070710_10050982
250 Ga0070710_10062825
251 Ga0070711_100000091
252 Ga0070711_100021445
253 Ga0070711_100022333
254 Ga0070711_100022752
255 Ga0070711_100025638
256 Ga0070711_100089534
257 Ga0070711_100318885
258 Ga0070711_100382703
259 Ga0070708_100000206
260 Ga0070708_100003088
261 Ga0070708_100005132
262 Ga0070706_100016251
263 Ga0070706_100016501
264 Ga0070706_100067565
265 Ga0070707_100000305
266 Ga0070707_100003328
267 Ga0070698_100000324
268 Ga0070698_100000638
269 Ga0070698_100169154
270 Ga0070699_100000336
271 Ga0070699_100005968
272 Ga0070699_100017808
273 Ga0070679_100075295
274 Ga0070697_100000232
275 Ga0070697_100001593
276 Ga0070697_100004381
277 Ga0070697_100005987
278 Ga0070697_100022093
279 Ga0070686_100417567
280 Ga0070695_100102357
281 Ga0070696_100138176
282 Ga0068855_100627337
283 Ga0068856_100003818
284 Ga0068860_100273534
285 Ga0070717_10008353
286 Ga0070717_10008877
287 Ga0070717_10014253
288 Ga0070717_10064913
289 Ga0070717_10079479
290 Ga0070717_10091131
291 Ga0070717_10143804
292 Ga0070715_10039773
293 Ga0070715_10150962
294 Ga0070716_100001434
295 Ga0070716_100003939
296 Ga0070716_100010065
297 Ga0070716_100011794
298 Ga0070716_100026921
299 Ga0070716_100127280
300 Ga0070712_100000087
301 Ga0070712_100000112
302 Ga0070712_100001387
303 Ga0070712_100053561
304 Ga0070712_100144923
305 Ga0075433_10000697
306 Ga0075433_10229595
307 Ga0075434_100000303
308 Ga0075434_100000455
309 Ga0075434_100009009
310 Ga0075434_100425403
311 Ga0068865_100271403
312 Ga0075436_100002179
313 Ga0075436_100034997
314 Ga0075435_100000142
315 Ga0075435_100023349
316 Ga0075435_100052883
317 Ga0075435_100061083
318 Ga0075435_100256168
319 Ga0099795_10083321
320 Ga0105240_10267200
321 Ga0114129_10040392
322 Ga0105237_10553922
323 Ga0099796_10048985
324 Ga0157369_10002403
325 Ga0157369_10214436
326 Ga0157369_10291463
327 Ga0157369_10380706
328 Ga0157372_10065634
329 Ga0157372_10661854
330 Ga0182007_10002880
331 Ga0154015_1124207
332 Ga0224572_1008431
333 Ga0228598_1000493
334 Ga0228598_1006235
335 Ga0207692_10015485
336 Ga0207692_10022361
337 Ga0207692_10041280
338 Ga0207685_10082367
339 Ga0207685_10115433
340 Ga0207699_10005012
341 Ga0207699_10015663
342 Ga0207699_10025546
343 Ga0207684_10000384
344 Ga0207684_10012254
345 Ga0207654_10077234
346 Ga0207707_10313445
347 Ga0207693_10000090
348 Ga0207693_10000273
349 Ga0207693_10004495
350 Ga0207693_10006598
351 Ga0207693_10139496
352 Ga0207663_10006844
353 Ga0207663_10007031
354 Ga0207663_10058566
355 Ga0207663_10173158
356 Ga0207652_10196224
357 Ga0207652_10323633
358 Ga0207646_10000620
359 Ga0207646_10002365
360 Ga0207700_10000533
361 Ga0207700_10000993
362 Ga0207700_10078622
363 Ga0207700_10107697
364 Ga0207700_10203450
365 Ga0207700_10274383
366 Ga0207700_10457506
367 Ga0207664_10000052
368 Ga0207664_10463905
369 Ga0207664_10500671
370 Ga0207704_10121204
371 Ga0207665_10001737
372 Ga0207665_10002175
373 Ga0207665_10015767
374 Ga0207665_10019863
375 Ga0207665_10020093
376 Ga0207665_10034611
377 Ga0207661_10316454
378 Ga0207712_10013559
379 Ga0207702_10004127
380 Ga0207702_10708268
381 Ga0207683_10007745
382 Ga0265356_1000607
383 Ga0265338_10000352
384 Ga0265338_10024535
385 Ga0265338_10108170
386 Ga0265762_1000165
387 Ga0265762_1002406
388 Ga0265760_10002723
389 Ga0265328_10012542
390 Ga0265325_10011372
391 Ga0265340_10073379
392 Ga0265340_10114611
393 Ga0265339_10017173
394 Ga0265316_10206525
395 Ga0265342_10083883
396 Ga0373926_0014303
397 Ga0373944_0058668
398 Ga0373945_0068047
399 Ga0373953_0086957
400 Ga0373943_0041242
401 Ga0373955_0099216
402 Ga0373935_0007938
403 Ga0373935_0011506
404 Ga0373947_0028981
405 Ga0373947_0029408
406 Ga0373947_0116953
407 Ga0373947_0309807
408 Ga0373937_0042725
409 Ga0373937_0315671
410 Ga0373925_0019007
411 Ga0373925_0019763
412 Ga0373925_0135440
413 Ga0395905_0016086
414 Ga0395905_0081877
415 Ga0395905_0095566
416 Ga0436364_0502452
417 Ga0453683_0008837
418 Ga0451576_0162803
419 Ga0466967_0172610
420 Ga0466967_0197480
421 Ga0495603_0077499
422 Ga0495629_0010828
423 Ga0495580_0005778
424 Ga0495580_0009401
425 Ga0495580_0028497
426 Ga0495580_0130840
427 Ga0495582_0000360
428 Ga0495582_0019723
429 Ga0495639_0144494
430 Ga0495630_0122847
431 Ga0495665_0018279
432 Ga0495645_0112817
433 Ga0495658_0084199
434 Ga0495669_0042187
435 Ga0495581_0056224
436 Ga0495674_0013906
437 Ga0496102_0473067
438 Ga0496104_0059864
439 Ga0496105_0150083
440 Ga0496106_0022680
441 Ga0501083_0024432
442 Ga0501083_0153972
443 nmdc:mga05p37_61797_c1
444 nmdc:mga0n895_3115_c1
445 nmdc:mga0n895_5385_c1
446 nmdc:mga0n895_5458_c1
447 nmdc:mga0rr50_11592_c1
448 nmdc:mga0rr50_1173_c1
449 nmdc:mga0rr50_1791_c1
450 nmdc:mga0rr50_94466_c1
451 nmdc:mga08x19_3308_c1
452 nmdc:mga08x19_6088_c1
453 nmdc:mga0a205_1620_c1
454 nmdc:mga0a205_24419_c1
455 nmdc:mga0a205_418667_c1
456 Ga0495601_0066269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

76

149

0.99

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

225

315

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.8626 1 95
7yh5-assembly3.cif.gz_F-2 mazg(mycobacterium tuberculosis) 0.8595 11 92
7yh5-assembly2.cif.gz_D mazg(mycobacterium tuberculosis) 0.8572 1 95
1yxb-assembly1.cif.gz_C crystal structure of phosphoribosyl-atp pyrophosphatase from streptomyces coelicolor. nesg target rr8. 0.8495 176 253
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8165 155 255
ID Description Score Start End Superfamily
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9182 7 127 1.10.287.1080
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9007 7 100 1.10.287.1080
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.898 7 95 1.10.287.1080
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8841 7 127 1.10.287.1080
af_Q2G0R6_232_355_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8757 8 126 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A7C3SWN0-F1-model_v4 MazG family protein 0.9525 8 127 GO:0006203
GO:0008168
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A7V0YTZ2-F1-model_v4 MazG family protein 0.9466 5 133 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A1F5A4F6-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9459 5 131 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A842X0Q1-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9458 1 128 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A2V9NV41-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase (EC 3.6.1.9) 0.9437 1 119 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0106379

Map