F340763

General Info

Members Datasets Scaffolds Average Seq Length
228 130 456 195

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100011144|Ga0070686_1000111444
Length 220
Sequence MPRTADLGHQAAVTLWIPERGSAMATLWKNDSAEEWQAALARYEEVIEQQSSAKLPELDRWYRDELPGLIAARKTPHVTHAEMVRLTEWKMARGIWRPRNLALVRGNDAALVERTSAAALAKIPHPSEPIATLAKLAGVGPATASAVASAAAPDVYPFFDELVAAQIPEMGQVTFTPKEYVRYAEALRERAARLGAEWTPVMVERALWAHVGGKAGTRRS

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100011144 3300005544 Bacteria 5094
2 SwRhRL2b_contig_2823054 2162886007 Unclassified 2656
3 Ga0065704_10003300 3300005289 Bacteria 4360
4 Ga0070658_10000859 3300005327 Bacteria 25955
5 Ga0070658_10009092 3300005327 Bacteria 7990
6 Ga0070658_10020352 3300005327 Bacteria 5318
7 Ga0070658_10554130 3300005327 Bacteria 995
8 Ga0070658_10794829 3300005327 Bacteria 822
9 Ga0070676_10056525 3300005328 Bacteria 2319
10 Ga0070676_10293778 3300005328 Bacteria 1099
11 Ga0070683_100003157 3300005329 Bacteria 13282
12 Ga0070683_100041003 3300005329 Bacteria 4257
13 Ga0070683_100119195 3300005329 Bacteria 2492
14 Ga0070690_100154925 3300005330 Bacteria 1566
15 Ga0070670_100156887 3300005331 Bacteria 1971
16 Ga0070670_100411917 3300005331 Bacteria 1194
17 Ga0070680_100011290 3300005336 Bacteria 6908
18 Ga0070682_100363197 3300005337 Unclassified 1083
19 Ga0068868_100448243 3300005338 Bacteria 1122
20 Ga0070687_100032046 3300005343 Bacteria 2583
21 Ga0070661_100072901 3300005344 Bacteria 2528
22 Ga0070668_100011811 3300005347 Bacteria 6504
23 Ga0070668_100995834 3300005347 Bacteria 753
24 Ga0070669_100051525 3300005353 Bacteria 3009
25 Ga0070669_100106140 3300005353 Bacteria 2126
26 Ga0070675_100382686 3300005354 Bacteria 1253
27 Ga0070671_100059351 3300005355 Bacteria 3183
28 Ga0070671_100320959 3300005355 Bacteria 1320
29 Ga0070673_100253305 3300005364 Bacteria 1535
30 Ga0070688_100008142 3300005365 Bacteria 5681
31 Ga0070659_100018226 3300005366 Bacteria 5297
32 Ga0070659_100056067 3300005366 Bacteria 3107
33 Ga0070667_100205187 3300005367 Bacteria 1750
34 Ga0070705_100098078 3300005440 Unclassified 1843
35 Ga0070663_100199267 3300005455 Bacteria 1561
36 Ga0070663_100321001 3300005455 Unclassified 1245
37 Ga0068867_100013823 3300005459 Bacteria 5714
38 Ga0070685_10001114 3300005466 Bacteria 14365
39 Ga0070707_100010425 3300005468 Bacteria 8655
40 Ga0070698_100079026 3300005471 Unclassified 3287
41 Ga0070679_100004035 3300005530 Bacteria 13533
42 Ga0070679_100074469 3300005530 Bacteria 3386
43 Ga0070679_100167650 3300005530 Bacteria 2169
44 Ga0070684_100112090 3300005535 Bacteria 2447
45 Ga0070684_100939233 3300005535 Bacteria 811
46 Ga0068853_100258913 3300005539 Bacteria 1599
47 Ga0070672_100005897 3300005543 Bacteria 8174
48 Ga0070672_100191136 3300005543 Bacteria 1709
49 Ga0070672_101196080 3300005543 Bacteria 677
50 Ga0070696_100413017 3300005546 Unclassified 1058
51 Ga0070693_100238677 3300005547 Bacteria 1199
52 Ga0070704_100006397 3300005549 Bacteria 6944
53 Ga0070664_100003727 3300005564 Bacteria 12289
54 Ga0070664_100020968 3300005564 Bacteria 5383
55 Ga0070664_100023979 3300005564 Bacteria 5041
56 Ga0070664_100033329 3300005564 Bacteria 4314
57 Ga0070664_100720925 3300005564 Bacteria 930
58 Ga0070664_101024340 3300005564 Bacteria 776
59 Ga0068857_100006857 3300005577 Bacteria 9801
60 Ga0068857_100030601 3300005577 Bacteria 4754
61 Ga0068857_100204298 3300005577 Bacteria 1801
62 Ga0068859_100021803 3300005617 Bacteria 6424
63 Ga0068859_100170260 3300005617 Unclassified 2259
64 Ga0068864_100469588 3300005618 Bacteria 1206
65 Ga0068866_10080954 3300005718 Bacteria 1743
66 Ga0068861_100210042 3300005719 Bacteria 1639
67 Ga0068851_10075671 3300005834 Bacteria 1750
68 Ga0068870_10004881 3300005840 Bacteria 5801
69 Ga0068863_100394378 3300005841 Bacteria 1353
70 Ga0068858_100386920 3300005842 Bacteria 1342
71 Ga0068860_100078332 3300005843 Bacteria 3143
72 Ga0068860_100645474 3300005843 Unclassified 1066
73 Ga0068862_100699036 3300005844 Bacteria 982
74 Ga0081539_10042362 3300005985 Bacteria 2653
75 Ga0097621_100469491 3300006237 Unclassified 1136
76 Ga0097620_100021803 3300006931 Bacteria 6424
77 Ga0097620_100170257 3300006931 Unclassified 2259
78 Ga0105245_10166284 3300009098 Bacteria 2097
79 Ga0105245_11051725 3300009098 Unclassified 859
80 Ga0105243_10164607 3300009148 Bacteria 1915
81 Ga0105243_10794521 3300009148 Bacteria 932
82 Ga0105242_10007177 3300009176 Bacteria 8592
83 Ga0105248_10113537 3300009177 Bacteria 3055
84 Ga0105238_10000855 3300009551 Bacteria 31385
85 Ga0105246_10101719 3300011119 Bacteria 2094
86 Ga0157373_10203210 3300013100 Bacteria 1397
87 Ga0157371_10177304 3300013102 Bacteria 1524
88 Ga0157372_10054354 3300013307 Bacteria 4466
89 Ga0157372_10413423 3300013307 Bacteria 1572
90 Ga0157372_11300930 3300013307 Bacteria 839
91 Ga0157375_10089228 3300013308 Bacteria 3139
92 Ga0157375_10354050 3300013308 Bacteria 1634
93 Ga0157377_10177696 3300014745 Bacteria 1336
94 Ga0207656_10072628 3300025321 Bacteria 1532
95 Ga0207688_10076103 3300025901 Bacteria 1911
96 Ga0207643_10004838 3300025908 Bacteria 7210
97 Ga0207705_10040607 3300025909 Bacteria 3338
98 Ga0207705_10049112 3300025909 Bacteria 3037
99 Ga0207705_10054553 3300025909 Bacteria 2880
100 Ga0207705_10124414 3300025909 Bacteria 1916
101 Ga0207705_10163713 3300025909 Unclassified 1672
102 Ga0207707_10006391 3300025912 Bacteria 10289
103 Ga0207660_10064337 3300025917 Unclassified 2647
104 Ga0207662_10000706 3300025918 Bacteria 15281
105 Ga0207662_10022166 3300025918 Bacteria 3637
106 Ga0207662_10323867 3300025918 Bacteria 1029
107 Ga0207652_10005682 3300025921 Bacteria 10124
108 Ga0207652_10011088 3300025921 Bacteria 7265
109 Ga0207646_10027146 3300025922 Bacteria 5221
110 Ga0207681_10047513 3300025923 Bacteria 2892
111 Ga0207694_10000629 3300025924 Bacteria 31992
112 Ga0207650_10082406 3300025925 Bacteria 2442
113 Ga0207650_10338212 3300025925 Bacteria 1236
114 Ga0207659_10043274 3300025926 Bacteria 3162
115 Ga0207644_10251833 3300025931 Bacteria 1409
116 Ga0207644_10257194 3300025931 Bacteria 1395
117 Ga0207690_10034802 3300025932 Bacteria 3248
118 Ga0207690_10287938 3300025932 Bacteria 1281
119 Ga0207706_10000731 3300025933 Bacteria 34297
120 Ga0207706_10168053 3300025933 Bacteria 1927
121 Ga0207670_10015547 3300025936 Bacteria 4550
122 Ga0207669_10979664 3300025937 Bacteria 710
123 Ga0207704_10461276 3300025938 Bacteria 1016
124 Ga0207691_10004665 3300025940 Bacteria 13267
125 Ga0207691_10046123 3300025940 Bacteria 4007
126 Ga0207691_10402607 3300025940 Bacteria 1167
127 Ga0207661_10013463 3300025944 Bacteria 5975
128 Ga0207661_10031809 3300025944 Unclassified 4081
129 Ga0207661_10205284 3300025944 Bacteria 1734
130 Ga0207661_10514103 3300025944 Bacteria 1095
131 Ga0207679_10004146 3300025945 Bacteria 9008
132 Ga0207679_10147492 3300025945 Bacteria 1910
133 Ga0207679_10212677 3300025945 Unclassified 1622
134 Ga0207679_10492283 3300025945 Bacteria 1093
135 Ga0207679_10893434 3300025945 Bacteria 812
136 Ga0207651_10032738 3300025960 Bacteria 3343
137 Ga0207658_10494260 3300025986 Bacteria 1089
138 Ga0207677_10098728 3300026023 Unclassified 2143
139 Ga0207703_10726708 3300026035 Bacteria 945
140 Ga0207639_10529382 3300026041 Bacteria 1080
141 Ga0207641_10205907 3300026088 Bacteria 1817
142 Ga0207648_10021333 3300026089 Bacteria 5822
143 Ga0207676_10036628 3300026095 Bacteria 3734
144 Ga0207676_10203811 3300026095 Unclassified 1750
145 Ga0207676_10978039 3300026095 Bacteria 833
146 Ga0207674_10004844 3300026116 Bacteria 16115
147 Ga0207674_10009304 3300026116 Bacteria 11253
148 Ga0207674_10413748 3300026116 Bacteria 1303
149 Ga0207675_100338918 3300026118 Bacteria 1471
150 Ga0207675_100844002 3300026118 Bacteria 931
151 Ga0207683_10384587 3300026121 Bacteria 1290
152 Ga0207698_10624409 3300026142 Bacteria 1065
153 Ga0207698_11024504 3300026142 Bacteria 837
154 Ga0268265_10112794 3300028380 Bacteria 2223
155 Ga0268264_10281026 3300028381 Bacteria 1559
156 Ga0307408_100036940 3300031548 Bacteria 3437
157 Ga0307408_100047014 3300031548 Bacteria 3088
158 Ga0307408_100627370 3300031548 Bacteria 958
159 Ga0307408_100680308 3300031548 Unclassified 923
160 Ga0307405_10066427 3300031731 Bacteria 2299
161 Ga0307405_10073746 3300031731 Bacteria 2205
162 Ga0307405_10127132 3300031731 Bacteria 1754
163 Ga0307413_10001178 3300031824 Bacteria 9633
164 Ga0307413_10004178 3300031824 Bacteria 6237
165 Ga0307413_10052169 3300031824 Bacteria 2468
166 Ga0307410_10000373 3300031852 Bacteria 17507
167 Ga0307410_10007976 3300031852 Bacteria 5838
168 Ga0307410_10589187 3300031852 Bacteria 926
169 Ga0307406_10002202 3300031901 Bacteria 10602
170 Ga0307406_10015356 3300031901 Bacteria 4429
171 Ga0307406_10046085 3300031901 Bacteria 2741
172 Ga0307406_10294516 3300031901 Unclassified 1244
173 Ga0307407_10001343 3300031903 Bacteria 8832
174 Ga0307407_10020954 3300031903 Bacteria 3360
175 Ga0307407_10056432 3300031903 Bacteria 2274
176 Ga0307407_10252840 3300031903 Bacteria 1208
177 Ga0307407_10581555 3300031903 Bacteria 831
178 Ga0307407_10583112 3300031903 Bacteria 830
179 Ga0307407_10652689 3300031903 Bacteria 788
180 Ga0307412_10001008 3300031911 Bacteria 16104
181 Ga0307412_10785205 3300031911 Bacteria 825
182 Ga0307409_100002598 3300031995 Bacteria 9496
183 Ga0307409_100098909 3300031995 Bacteria 2414
184 Ga0307409_100202918 3300031995 Bacteria 1775
185 Ga0307409_100316058 3300031995 Bacteria 1460
186 Ga0307409_100475456 3300031995 Bacteria 1211
187 Ga0307409_100651140 3300031995 Bacteria 1047
188 Ga0307416_100000129 3300032002 Bacteria 45777
189 Ga0307416_100036207 3300032002 Bacteria 3781
190 Ga0307416_100375891 3300032002 Bacteria 1449
191 Ga0307416_100451725 3300032002 Unclassified 1338
192 Ga0307416_100934237 3300032002 Bacteria 969
193 Ga0307414_10054957 3300032004 Bacteria 2785
194 Ga0307414_10092345 3300032004 Bacteria 2253
195 Ga0307414_10263533 3300032004 Bacteria 1439
196 Ga0307414_10308143 3300032004 Bacteria 1343
197 Ga0307411_10000229 3300032005 Bacteria 18237
198 Ga0307411_10064689 3300032005 Bacteria 2450
199 Ga0307411_10078815 3300032005 Bacteria 2259
200 Ga0307411_10703272 3300032005 Unclassified 881
201 Ga0307415_100044356 3300032126 Bacteria 2972
202 Ga0307415_100162824 3300032126 Bacteria 1731
203 Ga0307415_100168811 3300032126 Bacteria 1704
204 Ga0307415_100270975 3300032126 Bacteria 1390
205 Ga0307415_101118753 3300032126 Bacteria 738
206 Ga0373959_0000168 3300034820 Bacteria 14759
207 Ga0373937_0203097 3300036401 Bacteria 1863
208 Ga0395899_0027789 3300037312 Bacteria 4262
209 Ga0395898_0305431 3300037466 Bacteria 1518
210 Ga0395905_0053339 3300037471 Bacteria 3784
211 Ga0436365_0932858 3300039437 Bacteria 761
212 Ga0451577_0571629 3300042876 Bacteria 1026
213 Ga0451577_0680764 3300042876 Bacteria 932
214 Ga0466965_0173866 3300044683 Bacteria 1134
215 Ga0466961_0001125 3300044693 Bacteria 16404
216 Ga0495596_0051359 3300046500 Bacteria 1615
217 Ga0495669_0197735 3300046684 Unclassified 960
218 Ga0495675_0082783 3300047444 Bacteria 2020
219 Ga0496100_0924965 3300048903 Bacteria 685
220 Ga0496101_0191991 3300048904 Bacteria 1576
221 Ga0496105_0196712 3300048908 Unclassified 1647
222 Ga0496108_0177183 3300048911 Bacteria 1846
223 Ga0496109_0134810 3300048912 Bacteria 2307
224 Ga0496110_0226503 3300048913 Bacteria 1700
225 Ga0496112_0013668 3300048915 Bacteria 7501
226 Ga0496113_0091058 3300048916 Bacteria 2350
227 Ga0501217_036148 3300049661 Bacteria 1239
228 nmdc:mga0qj67_1095678_c1 3300050509 Bacteria 622
229 Ga0070686_100011144
230 SwRhRL2b_contig_2823054
231 Ga0065704_10003300
232 Ga0070658_10000859
233 Ga0070658_10009092
234 Ga0070658_10020352
235 Ga0070658_10554130
236 Ga0070658_10794829
237 Ga0070676_10056525
238 Ga0070676_10293778
239 Ga0070683_100003157
240 Ga0070683_100041003
241 Ga0070683_100119195
242 Ga0070690_100154925
243 Ga0070670_100156887
244 Ga0070670_100411917
245 Ga0070680_100011290
246 Ga0070682_100363197
247 Ga0068868_100448243
248 Ga0070687_100032046
249 Ga0070661_100072901
250 Ga0070668_100011811
251 Ga0070668_100995834
252 Ga0070669_100051525
253 Ga0070669_100106140
254 Ga0070675_100382686
255 Ga0070671_100059351
256 Ga0070671_100320959
257 Ga0070673_100253305
258 Ga0070688_100008142
259 Ga0070659_100018226
260 Ga0070659_100056067
261 Ga0070667_100205187
262 Ga0070705_100098078
263 Ga0070663_100199267
264 Ga0070663_100321001
265 Ga0068867_100013823
266 Ga0070685_10001114
267 Ga0070707_100010425
268 Ga0070698_100079026
269 Ga0070679_100004035
270 Ga0070679_100074469
271 Ga0070679_100167650
272 Ga0070684_100112090
273 Ga0070684_100939233
274 Ga0068853_100258913
275 Ga0070672_100005897
276 Ga0070672_100191136
277 Ga0070672_101196080
278 Ga0070696_100413017
279 Ga0070693_100238677
280 Ga0070704_100006397
281 Ga0070664_100003727
282 Ga0070664_100020968
283 Ga0070664_100023979
284 Ga0070664_100033329
285 Ga0070664_100720925
286 Ga0070664_101024340
287 Ga0068857_100006857
288 Ga0068857_100030601
289 Ga0068857_100204298
290 Ga0068859_100021803
291 Ga0068859_100170260
292 Ga0068864_100469588
293 Ga0068866_10080954
294 Ga0068861_100210042
295 Ga0068851_10075671
296 Ga0068870_10004881
297 Ga0068863_100394378
298 Ga0068858_100386920
299 Ga0068860_100078332
300 Ga0068860_100645474
301 Ga0068862_100699036
302 Ga0081539_10042362
303 Ga0097621_100469491
304 Ga0097620_100021803
305 Ga0097620_100170257
306 Ga0105245_10166284
307 Ga0105245_11051725
308 Ga0105243_10164607
309 Ga0105243_10794521
310 Ga0105242_10007177
311 Ga0105248_10113537
312 Ga0105238_10000855
313 Ga0105246_10101719
314 Ga0157373_10203210
315 Ga0157371_10177304
316 Ga0157372_10054354
317 Ga0157372_10413423
318 Ga0157372_11300930
319 Ga0157375_10089228
320 Ga0157375_10354050
321 Ga0157377_10177696
322 Ga0207656_10072628
323 Ga0207688_10076103
324 Ga0207643_10004838
325 Ga0207705_10040607
326 Ga0207705_10049112
327 Ga0207705_10054553
328 Ga0207705_10124414
329 Ga0207705_10163713
330 Ga0207707_10006391
331 Ga0207660_10064337
332 Ga0207662_10000706
333 Ga0207662_10022166
334 Ga0207662_10323867
335 Ga0207652_10005682
336 Ga0207652_10011088
337 Ga0207646_10027146
338 Ga0207681_10047513
339 Ga0207694_10000629
340 Ga0207650_10082406
341 Ga0207650_10338212
342 Ga0207659_10043274
343 Ga0207644_10251833
344 Ga0207644_10257194
345 Ga0207690_10034802
346 Ga0207690_10287938
347 Ga0207706_10000731
348 Ga0207706_10168053
349 Ga0207670_10015547
350 Ga0207669_10979664
351 Ga0207704_10461276
352 Ga0207691_10004665
353 Ga0207691_10046123
354 Ga0207691_10402607
355 Ga0207661_10013463
356 Ga0207661_10031809
357 Ga0207661_10205284
358 Ga0207661_10514103
359 Ga0207679_10004146
360 Ga0207679_10147492
361 Ga0207679_10212677
362 Ga0207679_10492283
363 Ga0207679_10893434
364 Ga0207651_10032738
365 Ga0207658_10494260
366 Ga0207677_10098728
367 Ga0207703_10726708
368 Ga0207639_10529382
369 Ga0207641_10205907
370 Ga0207648_10021333
371 Ga0207676_10036628
372 Ga0207676_10203811
373 Ga0207676_10978039
374 Ga0207674_10004844
375 Ga0207674_10009304
376 Ga0207674_10413748
377 Ga0207675_100338918
378 Ga0207675_100844002
379 Ga0207683_10384587
380 Ga0207698_10624409
381 Ga0207698_11024504
382 Ga0268265_10112794
383 Ga0268264_10281026
384 Ga0307408_100036940
385 Ga0307408_100047014
386 Ga0307408_100627370
387 Ga0307408_100680308
388 Ga0307405_10066427
389 Ga0307405_10073746
390 Ga0307405_10127132
391 Ga0307413_10001178
392 Ga0307413_10004178
393 Ga0307413_10052169
394 Ga0307410_10000373
395 Ga0307410_10007976
396 Ga0307410_10589187
397 Ga0307406_10002202
398 Ga0307406_10015356
399 Ga0307406_10046085
400 Ga0307406_10294516
401 Ga0307407_10001343
402 Ga0307407_10020954
403 Ga0307407_10056432
404 Ga0307407_10252840
405 Ga0307407_10581555
406 Ga0307407_10583112
407 Ga0307407_10652689
408 Ga0307412_10001008
409 Ga0307412_10785205
410 Ga0307409_100002598
411 Ga0307409_100098909
412 Ga0307409_100202918
413 Ga0307409_100316058
414 Ga0307409_100475456
415 Ga0307409_100651140
416 Ga0307416_100000129
417 Ga0307416_100036207
418 Ga0307416_100375891
419 Ga0307416_100451725
420 Ga0307416_100934237
421 Ga0307414_10054957
422 Ga0307414_10092345
423 Ga0307414_10263533
424 Ga0307414_10308143
425 Ga0307411_10000229
426 Ga0307411_10064689
427 Ga0307411_10078815
428 Ga0307411_10703272
429 Ga0307415_100044356
430 Ga0307415_100162824
431 Ga0307415_100168811
432 Ga0307415_100270975
433 Ga0307415_101118753
434 Ga0373959_0000168
435 Ga0373937_0203097
436 Ga0395899_0027789
437 Ga0395898_0305431
438 Ga0395905_0053339
439 Ga0436365_0932858
440 Ga0451577_0571629
441 Ga0451577_0680764
442 Ga0466965_0173866
443 Ga0466961_0001125
444 Ga0495596_0051359
445 Ga0495669_0197735
446 Ga0495675_0082783
447 Ga0496100_0924965
448 Ga0496101_0191991
449 Ga0496105_0196712
450 Ga0496108_0177183
451 Ga0496109_0134810
452 Ga0496110_0226503
453 Ga0496112_0013668
454 Ga0496113_0091058
455 Ga0501217_036148
456 nmdc:mga0qj67_1095678_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhg-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 8-oxoguanine dna glycosylase (ssogg) 0.4596 6 181
3i0w-assembly1.cif.gz_A crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing cytosine opposite to 8-oxog 0.4351 8 184
3fhg-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 8-oxoguanine dna glycosylase (ssogg) 0.4256 6 181
7zg3-assembly1.cif.gz_A structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th011228 0.4234 8 183
6g40-assembly3.cif.gz_C structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th9525 0.4149 4 183
ID Description Score Start End Superfamily
af_K7TQI4_11_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3133 4 108 1.10.10.10
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.2898 8 183 1.10.3470.10
af_P23877_5_330_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.2699 8 183 1.10.3470.10
af_K7TQI4_11_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.2541 4 108 1.10.10.10
6o0aA01 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.2423 6 172 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A7W1SHQ8-F1-model_v4 DUF4332 domain-containing protein 0.9729 7 190
AF-A0A7V9Q9R2-F1-model_v4 Uncharacterized protein 0.9639 1 193
AF-A0A521U1W5-F1-model_v4 Uncharacterized protein 0.9583 7 192
AF-A0A1B6GM20-F1-model_v4 HhH-GPD domain-containing protein 0.9574 27 183
AF-A0A1X7VT75-F1-model_v4 HhH-GPD domain-containing protein 0.9571 7 183

Map