F340672

General Info

Members Datasets Scaffolds Average Seq Length
228 144 456 459

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100017069|Ga0070669_1000170692
Length 509
Sequence MSSRRDFLKNLLLTGAAATFAPAIVAKTLGDGLPWLNTQADGPWEIFMPTILAGIKRPTFPNRTLNITNFGAKGDGRTDCSTAFRSAIAECTRRGGGRVVVPAGDYLTGPIHLKSNVNLEVQQGATIKFSQNPKDYLPVVFSRWEGVELFNYSPFIYALDQRNIAITGSGTLDGQSDKDHWWPWNGRAAYGWKEGMPNQRSDRNALFTMAEKGVPVRERIFGEGHYLRPQFIQPYRCQNVLIEGVTIVNSPMWENSHGPNNDGCDPESCTDVLIKNCSFDTGDDCIAIKSGRNADGRRLHAPSQNIIVQGCQMKDGHGGVTVGSEISGGVRMVFAENCQMDSPNLDHALRVKNNAMRGGLLEHLHFRDIQVGQVAHAVITIDFNYEEGAKGSFTPVVRNYTVNRLRSGKSKHALDVQGLPGAPVIDLRLTNCTFDNVAESSIVKNVKNAXXXXVKINGRVVDSFAEPDAGVQNIKTAYSAPFAVADGHRSTPASYGVASWPSATANGTE

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
138 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
139 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
140 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
141 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
142 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
143 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
144 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.88
Rhizoplane 0
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 8.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100017069 3300005353 Bacteria 5179
2 Ga0065704_10076116 3300005289 Bacteria 5247
3 Ga0065712_10078277 3300005290 Bacteria 3370
4 Ga0065715_10015726 3300005293 Unclassified 2370
5 Ga0065715_10127215 3300005293 Unclassified 2092
6 Ga0070658_10001667 3300005327 Bacteria 18738
7 Ga0070658_10015749 3300005327 Bacteria 6045
8 Ga0070683_100065978 3300005329 Bacteria 3371
9 Ga0070683_100155964 3300005329 Unclassified 2165
10 Ga0070690_100003743 3300005330 Bacteria 8380
11 Ga0070690_100008863 3300005330 Bacteria 5811
12 Ga0070690_100016601 3300005330 Bacteria 4414
13 Ga0070677_10018843 3300005333 Bacteria 2492
14 Ga0068869_100019314 3300005334 Unclassified 4653
15 Ga0068869_100109237 3300005334 Bacteria 2102
16 Ga0070666_10078768 3300005335 Unclassified 2250
17 Ga0070680_100002559 3300005336 Bacteria 13454
18 Ga0070680_100033454 3300005336 Bacteria 4144
19 Ga0070680_100038010 3300005336 Bacteria 3891
20 Ga0070689_100041403 3300005340 Bacteria 3536
21 Ga0070689_100203601 3300005340 Bacteria 1617
22 Ga0070687_100001098 3300005343 Bacteria 9300
23 Ga0070687_100014188 3300005343 Bacteria 3573
24 Ga0070668_100112971 3300005347 Bacteria 2164
25 Ga0070669_100001494 3300005353 Bacteria 16898
26 Ga0070669_100153141 3300005353 Bacteria 1786
27 Ga0070671_100005280 3300005355 Bacteria 10304
28 Ga0070671_100061226 3300005355 Bacteria 3135
29 Ga0070667_100118891 3300005367 Bacteria 2297
30 Ga0070709_10002843 3300005434 Bacteria 9352
31 Ga0070700_100000080 3300005441 Bacteria 64459
32 Ga0070700_100002066 3300005441 Bacteria 10202
33 Ga0070694_100164102 3300005444 Unclassified 1632
34 Ga0070663_100012301 3300005455 Bacteria 5408
35 Ga0070681_10000791 3300005458 Bacteria 26380
36 Ga0070681_10018164 3300005458 Bacteria 7030
37 Ga0070681_10062032 3300005458 Bacteria 3712
38 Ga0070681_10070953 3300005458 Bacteria 3448
39 Ga0070698_100113655 3300005471 Bacteria 2672
40 Ga0070679_100000011 3300005530 Bacteria 162902
41 Ga0070679_100000473 3300005530 Bacteria 34337
42 Ga0070679_100012789 3300005530 Bacteria 8029
43 Ga0070679_100027834 3300005530 Bacteria 5569
44 Ga0070679_100124190 3300005530 Bacteria 2564
45 Ga0070684_100025200 3300005535 Bacteria 4997
46 Ga0070697_100102431 3300005536 Bacteria 2379
47 Ga0068853_100001000 3300005539 Bacteria 19930
48 Ga0068853_100088037 3300005539 Bacteria 2725
49 Ga0070672_100058224 3300005543 Bacteria 3036
50 Ga0070672_100084228 3300005543 Bacteria 2553
51 Ga0070686_100013227 3300005544 Bacteria 4719
52 Ga0070686_100051164 3300005544 Bacteria 2628
53 Ga0070686_100076010 3300005544 Bacteria 2211
54 Ga0070695_100100192 3300005545 Bacteria 1950
55 Ga0070695_100126140 3300005545 Unclassified 1758
56 Ga0070695_100154307 3300005545 Bacteria 1605
57 Ga0070696_100053373 3300005546 Bacteria 2814
58 Ga0068855_100035672 3300005563 Bacteria 5923
59 Ga0068856_100253749 3300005614 Bacteria 1774
60 Ga0068852_100004531 3300005616 Bacteria 9831
61 Ga0068852_100083321 3300005616 Bacteria 2843
62 Ga0068852_100184332 3300005616 Bacteria 1965
63 Ga0068859_100001336 3300005617 Bacteria 25188
64 Ga0068859_100006652 3300005617 Bacteria 11741
65 Ga0068859_100028636 3300005617 Bacteria 5585
66 Ga0068859_100066115 3300005617 Bacteria 3650
67 Ga0068859_100108966 3300005617 Bacteria 2831
68 Ga0068864_100003407 3300005618 Bacteria 13147
69 Ga0068864_100012207 3300005618 Bacteria 7100
70 Ga0068861_100071853 3300005719 Bacteria 2683
71 Ga0068863_100165706 3300005841 Bacteria 2119
72 Ga0068858_100024409 3300005842 Bacteria 5633
73 Ga0068858_100136031 3300005842 Unclassified 2306
74 Ga0068860_100007374 3300005843 Bacteria 10996
75 Ga0068860_100008322 3300005843 Bacteria 10326
76 Ga0068860_100075197 3300005843 Unclassified 3212
77 Ga0068862_100007259 3300005844 Bacteria 9197
78 Ga0068862_100158250 3300005844 Bacteria 2020
79 Ga0068871_100002375 3300006358 Bacteria 12836
80 Ga0075433_10033670 3300006852 Bacteria 4395
81 Ga0075434_100026824 3300006871 Bacteria 5650
82 Ga0097620_100001336 3300006931 Bacteria 25188
83 Ga0097620_100006652 3300006931 Bacteria 11741
84 Ga0097620_100028637 3300006931 Bacteria 5585
85 Ga0097620_100066121 3300006931 Bacteria 3650
86 Ga0097620_100108970 3300006931 Bacteria 2831
87 Ga0099824_1010763 3300006942 Bacteria 10621
88 Ga0099826_10008133 3300006948 Bacteria 7779
89 Ga0105251_10061988 3300009011 Bacteria 1757
90 Ga0105250_10021818 3300009092 Bacteria 2583
91 Ga0105240_10000443 3300009093 Bacteria 76569
92 Ga0111539_10002522 3300009094 Bacteria 24263
93 Ga0105245_10019309 3300009098 Bacteria 5967
94 Ga0105245_10056630 3300009098 Bacteria 3524
95 Ga0105247_10003582 3300009101 Bacteria 10082
96 Ga0114129_10003544 3300009147 Bacteria 21968
97 Ga0114129_10248789 3300009147 Bacteria 2387
98 Ga0105243_10031277 3300009148 Unclassified 4103
99 Ga0105241_10047564 3300009174 Bacteria 3262
100 Ga0105242_10012277 3300009176 Bacteria 6595
101 Ga0105248_10020454 3300009177 Bacteria 7333
102 Ga0105248_10038630 3300009177 Bacteria 5343
103 Ga0105248_10169877 3300009177 Bacteria 2458
104 Ga0105249_10148192 3300009553 Unclassified 2256
105 Ga0105239_10087481 3300010375 Bacteria 3435
106 Ga0105239_10132442 3300010375 Bacteria 2774
107 Ga0105239_10318380 3300010375 Bacteria 1754
108 Ga0157373_10000008 3300013100 Bacteria 216306
109 Ga0157371_10003456 3300013102 Bacteria 14321
110 Ga0157371_10006359 3300013102 Bacteria 9769
111 Ga0157371_10017036 3300013102 Bacteria 5409
112 Ga0157370_10000029 3300013104 Bacteria 145930
113 Ga0157370_10024156 3300013104 Bacteria 6023
114 Ga0157370_10095506 3300013104 Bacteria 2789
115 Ga0157370_10236526 3300013104 Bacteria 1690
116 Ga0157374_10164037 3300013296 Unclassified 2165
117 Ga0157378_10028192 3300013297 Bacteria 4952
118 Ga0163162_10022546 3300013306 Bacteria 6206
119 Ga0163162_10176698 3300013306 Unclassified 2261
120 Ga0163162_10177743 3300013306 Bacteria 2254
121 Ga0157372_10010682 3300013307 Bacteria 9769
122 Ga0157372_10043187 3300013307 Bacteria 4990
123 Ga0157372_10083468 3300013307 Bacteria 3619
124 Ga0157375_10011643 3300013308 Bacteria 7771
125 Ga0157375_10012668 3300013308 Bacteria 7485
126 Ga0157375_10359569 3300013308 Bacteria 1622
127 Ga0163163_10017805 3300014325 Bacteria 6631
128 Ga0163163_10019364 3300014325 Bacteria 6392
129 Ga0163163_10056277 3300014325 Unclassified 3887
130 Ga0163163_10288992 3300014325 Bacteria 1692
131 Ga0157380_10002910 3300014326 Bacteria 11641
132 Ga0157377_10062815 3300014745 Unclassified 2125
133 Ga0157379_10050905 3300014968 Bacteria 3698
134 Ga0157379_10216038 3300014968 Unclassified 1737
135 Ga0157376_10012989 3300014969 Bacteria 6203
136 Ga0157376_10019578 3300014969 Bacteria 5220
137 Ga0182006_1001618 3300015261 Bacteria 13317
138 Ga0163161_10006286 3300017792 Bacteria 8223
139 Ga0213876_10000062 3300021384 Bacteria 128625
140 Ga0207697_10004077 3300025315 Bacteria 7065
141 Ga0207710_10001259 3300025900 Bacteria 12814
142 Ga0207647_10112676 3300025904 Bacteria 1607
143 Ga0207699_10006583 3300025906 Bacteria 5638
144 Ga0207645_10013219 3300025907 Bacteria 5569
145 Ga0207643_10005696 3300025908 Bacteria 6663
146 Ga0207705_10013891 3300025909 Bacteria 5807
147 Ga0207705_10022365 3300025909 Bacteria 4509
148 Ga0207707_10000007 3300025912 Bacteria 368555
149 Ga0207707_10000863 3300025912 Bacteria 29621
150 Ga0207707_10060840 3300025912 Bacteria 3285
151 Ga0207695_10021982 3300025913 Bacteria 7259
152 Ga0207660_10027350 3300025917 Bacteria 3891
153 Ga0207660_10040785 3300025917 Bacteria 3251
154 Ga0207660_10040859 3300025917 Bacteria 3249
155 Ga0207662_10010955 3300025918 Bacteria 5015
156 Ga0207652_10000102 3300025921 Bacteria 92144
157 Ga0207652_10000194 3300025921 Bacteria 63931
158 Ga0207652_10147390 3300025921 Bacteria 2107
159 Ga0207681_10089950 3300025923 Bacteria 2190
160 Ga0207650_10141004 3300025925 Bacteria 1895
161 Ga0207644_10163030 3300025931 Bacteria 1734
162 Ga0207706_10073511 3300025933 Bacteria 3006
163 Ga0207691_10003761 3300025940 Bacteria 14730
164 Ga0207711_10006031 3300025941 Bacteria 10242
165 Ga0207689_10006116 3300025942 Bacteria 10647
166 Ga0207689_10028362 3300025942 Unclassified 4683
167 Ga0207689_10069969 3300025942 Bacteria 2883
168 Ga0207689_10078992 3300025942 Bacteria 2704
169 Ga0207667_10017719 3300025949 Bacteria 8011
170 Ga0207703_10022727 3300026035 Bacteria 4925
171 Ga0207639_10000624 3300026041 Bacteria 24412
172 Ga0207678_10003237 3300026067 Bacteria 14712
173 Ga0207708_10000433 3300026075 Bacteria 32569
174 Ga0207708_10033959 3300026075 Bacteria 3879
175 Ga0207641_10152066 3300026088 Unclassified 2097
176 Ga0207676_10004733 3300026095 Bacteria 9646
177 Ga0207676_10131793 3300026095 Bacteria 2126
178 Ga0207674_10007116 3300026116 Bacteria 13071
179 Ga0207674_10107562 3300026116 Bacteria 2766
180 Ga0207675_100021354 3300026118 Bacteria 6031
181 Ga0207675_100033513 3300026118 Bacteria 4785
182 Ga0207683_10016227 3300026121 Bacteria 6340
183 Ga0207698_10001350 3300026142 Bacteria 14291
184 Ga0207698_10010334 3300026142 Bacteria 5988
185 Ga0207698_10071396 3300026142 Unclassified 2755
186 Ga0207698_10132366 3300026142 Bacteria 2133
187 Ga0207428_10001192 3300027907 Bacteria 27970
188 Ga0268266_10191860 3300028379 Unclassified 1866
189 Ga0268265_10018421 3300028380 Bacteria 4838
190 Ga0268264_10008885 3300028381 Bacteria 8332
191 Ga0268264_10012931 3300028381 Bacteria 6862
192 Ga0268264_10042591 3300028381 Bacteria 3759
193 Ga0268264_10105217 3300028381 Bacteria 2461
194 Ga0265332_10006179 3300031238 Bacteria 5458
195 Ga0307413_10011466 3300031824 Bacteria 4361
196 Ga0307406_10075174 3300031901 Bacteria 2228
197 Ga0307407_10070443 3300031903 Bacteria 2079
198 Ga0307409_100107475 3300031995 Bacteria 2331
199 Ga0307416_100019297 3300032002 Bacteria 4830
200 Ga0307411_10152412 3300032005 Bacteria 1719
201 Ga0307415_100047128 3300032126 Bacteria 2900
202 Ga0373956_0110644 3300035119 Bacteria 1279
203 Ga0395899_0029474 3300037312 Bacteria 4128
204 Ga0395900_0057196 3300037418 Bacteria 4014
205 Ga0395898_0026931 3300037466 Bacteria 5776
206 Ga0395901_0066512 3300038443 Bacteria 3754
207 Ga0436365_0924676 3300039437 Bacteria 448697
208 Ga0451837_0780012 3300041494 Bacteria 2460
209 Ga0495594_0047817 3300046499 Bacteria 2350
210 Ga0495668_0000102 3300046616 Bacteria 137192
211 Ga0495600_0006801 3300046809 Bacteria 6972
212 Ga0496121_0020064 3300048924 Bacteria 6640
213 Ga0496124_0088348 3300048927 Bacteria 2534
214 Ga0501033_0003423 3300049570 Bacteria 13067
215 Ga0501034_0016564 3300049571 Bacteria 7557
216 Ga0501038_0197916 3300049574 Bacteria 1614
217 Ga0501044_0003045 3300049823 Bacteria 18973
218 nmdc:mga08y16_1198_c1 3300050511 Bacteria 25587
219 nmdc:mga0a205_13732_c1 3300050515 Bacteria 7547
220 Ga0501084_0038797 3300054114 Bacteria 3983
221 2520881571 2519899754 Bacteria 5336938
222 2644683017 2643221725 Bacteria 5087956
223 2817416839 2816332280 Bacteria 5109718
224 2881360619 2881359912 Bacteria 4935907
225 2903899353 2903895155 Bacteria 5258610
226 2958463304 2958458903 Bacteria 5301041
227 2977270726 2977268062 Bacteria 5243061
228 8055594278 8055592153 Bacteria 5961247
229 Ga0070669_100017069
230 Ga0065704_10076116
231 Ga0065712_10078277
232 Ga0065715_10015726
233 Ga0065715_10127215
234 Ga0070658_10001667
235 Ga0070658_10015749
236 Ga0070683_100065978
237 Ga0070683_100155964
238 Ga0070690_100003743
239 Ga0070690_100008863
240 Ga0070690_100016601
241 Ga0070677_10018843
242 Ga0068869_100019314
243 Ga0068869_100109237
244 Ga0070666_10078768
245 Ga0070680_100002559
246 Ga0070680_100033454
247 Ga0070680_100038010
248 Ga0070689_100041403
249 Ga0070689_100203601
250 Ga0070687_100001098
251 Ga0070687_100014188
252 Ga0070668_100112971
253 Ga0070669_100001494
254 Ga0070669_100153141
255 Ga0070671_100005280
256 Ga0070671_100061226
257 Ga0070667_100118891
258 Ga0070709_10002843
259 Ga0070700_100000080
260 Ga0070700_100002066
261 Ga0070694_100164102
262 Ga0070663_100012301
263 Ga0070681_10000791
264 Ga0070681_10018164
265 Ga0070681_10062032
266 Ga0070681_10070953
267 Ga0070698_100113655
268 Ga0070679_100000011
269 Ga0070679_100000473
270 Ga0070679_100012789
271 Ga0070679_100027834
272 Ga0070679_100124190
273 Ga0070684_100025200
274 Ga0070697_100102431
275 Ga0068853_100001000
276 Ga0068853_100088037
277 Ga0070672_100058224
278 Ga0070672_100084228
279 Ga0070686_100013227
280 Ga0070686_100051164
281 Ga0070686_100076010
282 Ga0070695_100100192
283 Ga0070695_100126140
284 Ga0070695_100154307
285 Ga0070696_100053373
286 Ga0068855_100035672
287 Ga0068856_100253749
288 Ga0068852_100004531
289 Ga0068852_100083321
290 Ga0068852_100184332
291 Ga0068859_100001336
292 Ga0068859_100006652
293 Ga0068859_100028636
294 Ga0068859_100066115
295 Ga0068859_100108966
296 Ga0068864_100003407
297 Ga0068864_100012207
298 Ga0068861_100071853
299 Ga0068863_100165706
300 Ga0068858_100024409
301 Ga0068858_100136031
302 Ga0068860_100007374
303 Ga0068860_100008322
304 Ga0068860_100075197
305 Ga0068862_100007259
306 Ga0068862_100158250
307 Ga0068871_100002375
308 Ga0075433_10033670
309 Ga0075434_100026824
310 Ga0097620_100001336
311 Ga0097620_100006652
312 Ga0097620_100028637
313 Ga0097620_100066121
314 Ga0097620_100108970
315 Ga0099824_1010763
316 Ga0099826_10008133
317 Ga0105251_10061988
318 Ga0105250_10021818
319 Ga0105240_10000443
320 Ga0111539_10002522
321 Ga0105245_10019309
322 Ga0105245_10056630
323 Ga0105247_10003582
324 Ga0114129_10003544
325 Ga0114129_10248789
326 Ga0105243_10031277
327 Ga0105241_10047564
328 Ga0105242_10012277
329 Ga0105248_10020454
330 Ga0105248_10038630
331 Ga0105248_10169877
332 Ga0105249_10148192
333 Ga0105239_10087481
334 Ga0105239_10132442
335 Ga0105239_10318380
336 Ga0157373_10000008
337 Ga0157371_10003456
338 Ga0157371_10006359
339 Ga0157371_10017036
340 Ga0157370_10000029
341 Ga0157370_10024156
342 Ga0157370_10095506
343 Ga0157370_10236526
344 Ga0157374_10164037
345 Ga0157378_10028192
346 Ga0163162_10022546
347 Ga0163162_10176698
348 Ga0163162_10177743
349 Ga0157372_10010682
350 Ga0157372_10043187
351 Ga0157372_10083468
352 Ga0157375_10011643
353 Ga0157375_10012668
354 Ga0157375_10359569
355 Ga0163163_10017805
356 Ga0163163_10019364
357 Ga0163163_10056277
358 Ga0163163_10288992
359 Ga0157380_10002910
360 Ga0157377_10062815
361 Ga0157379_10050905
362 Ga0157379_10216038
363 Ga0157376_10012989
364 Ga0157376_10019578
365 Ga0182006_1001618
366 Ga0163161_10006286
367 Ga0213876_10000062
368 Ga0207697_10004077
369 Ga0207710_10001259
370 Ga0207647_10112676
371 Ga0207699_10006583
372 Ga0207645_10013219
373 Ga0207643_10005696
374 Ga0207705_10013891
375 Ga0207705_10022365
376 Ga0207707_10000007
377 Ga0207707_10000863
378 Ga0207707_10060840
379 Ga0207695_10021982
380 Ga0207660_10027350
381 Ga0207660_10040785
382 Ga0207660_10040859
383 Ga0207662_10010955
384 Ga0207652_10000102
385 Ga0207652_10000194
386 Ga0207652_10147390
387 Ga0207681_10089950
388 Ga0207650_10141004
389 Ga0207644_10163030
390 Ga0207706_10073511
391 Ga0207691_10003761
392 Ga0207711_10006031
393 Ga0207689_10006116
394 Ga0207689_10028362
395 Ga0207689_10069969
396 Ga0207689_10078992
397 Ga0207667_10017719
398 Ga0207703_10022727
399 Ga0207639_10000624
400 Ga0207678_10003237
401 Ga0207708_10000433
402 Ga0207708_10033959
403 Ga0207641_10152066
404 Ga0207676_10004733
405 Ga0207676_10131793
406 Ga0207674_10007116
407 Ga0207674_10107562
408 Ga0207675_100021354
409 Ga0207675_100033513
410 Ga0207683_10016227
411 Ga0207698_10001350
412 Ga0207698_10010334
413 Ga0207698_10071396
414 Ga0207698_10132366
415 Ga0207428_10001192
416 Ga0268266_10191860
417 Ga0268265_10018421
418 Ga0268264_10008885
419 Ga0268264_10012931
420 Ga0268264_10042591
421 Ga0268264_10105217
422 Ga0265332_10006179
423 Ga0307413_10011466
424 Ga0307406_10075174
425 Ga0307407_10070443
426 Ga0307409_100107475
427 Ga0307416_100019297
428 Ga0307411_10152412
429 Ga0307415_100047128
430 Ga0373956_0110644
431 Ga0395899_0029474
432 Ga0395900_0057196
433 Ga0395898_0026931
434 Ga0395901_0066512
435 Ga0436365_0924676
436 Ga0451837_0780012
437 Ga0495594_0047817
438 Ga0495668_0000102
439 Ga0495600_0006801
440 Ga0496121_0020064
441 Ga0496124_0088348
442 Ga0501033_0003423
443 Ga0501034_0016564
444 Ga0501038_0197916
445 Ga0501044_0003045
446 nmdc:mga08y16_1198_c1
447 nmdc:mga0a205_13732_c1
448 Ga0501084_0038797
449 2520881571
450 2644683017
451 2817416839
452 2881360619
453 2903899353
454 2958463304
455 2977270726
456 8055594278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12708

Pectate_lyase_3

Pectate lyase superfamily protein

64

134

0.91

PF00295

Glyco_hydro_28

Glycosyl hydrolases family 28

91

452

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jur-assembly1.cif.gz_D the crystal structure of a hyperthermoactive exopolygalacturonase from thermotoga maritima 0.8839 32 452
4mxn-assembly2.cif.gz_B crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8382 50 327
3jur-assembly1.cif.gz_D the crystal structure of a hyperthermoactive exopolygalacturonase from thermotoga maritima 0.8357 32 452
5olp-assembly2.cif.gz_B galacturonidase 0.8091 47 443
4mxn-assembly2.cif.gz_B crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution 0.8001 50 327
ID Description Score Start End Superfamily
3jurB00 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8877 32 446 2.160.20.10
af_Q0DX16_1_247_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8483 217 433 2.160.20.10
3jurB00 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8316 32 446 2.160.20.10
af_A0A0R0L061_1_215_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7857 219 439 2.160.20.10
af_A0A0R0F0K0_135_291_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7852 50 235 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A7Y8I453-F1-model_v4 Glycoside hydrolase family 28 protein 0.9927 285 448 GO:0004650
GO:0005975
AF-R7DK10-F1-model_v4 deleted 0.991 47 159
AF-A0A6L7EDC7-F1-model_v4 deleted 0.987 291 441
AF-A0A7Y8I453-F1-model_v4 Glycoside hydrolase family 28 protein 0.9808 285 448 GO:0004650
GO:0005975
AF-K1S123-F1-model_v4 Uncharacterized protein 0.9777 46 135

Map