F339235

General Info

Members Datasets Scaffolds Average Seq Length
226 161 206 158

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0548566|Ga0496102_0548566_404_952
Length 182
Sequence LHSAALRASTYLDSFEGYRKEESSQMKQASQSASHRSWLSERVLSAITWLERVPYAILALPLRLAIATVFWNSAMTKLADWNAALELFREEYRVPLLPAAIAAYLAVSIELTAPVLLVAGLATRAVALVLLGMTTVIEVFVYPQAWPTHIQWAAMLLVLLCRGPGSWSLDQLILKRFEKVLW

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
3 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
4 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
5 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
6 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
7 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
8 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
9 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
10 2818991450 Burkholderia sp. 604 Isolate Unclassified
11 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
12 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
13 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
14 2885266251 Ralstonia sp. SET104 Isolate Nodule
15 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
16 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
17 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
18 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
19 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.15
Metatranscriptomes 0
Isolates 8.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 2.21
Rhizoplane 3.1
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001151 3300002067 Bacteria 9459
2 JGI24735J21928_10009752 3300002067 Bacteria 3076
3 JGI24735J21928_10009799 3300002067 Bacteria 3069
4 Ga0070658_10013271 3300005327 Bacteria 6610
5 Ga0070683_100115018 3300005329 Bacteria 2539
6 Ga0070680_100013713 3300005336 Bacteria 6320
7 Ga0070660_100000374 3300005339 Bacteria 29729
8 Ga0070660_100003420 3300005339 Bacteria 10915
9 Ga0070661_100205388 3300005344 Bacteria 1506
10 Ga0070663_100405503 3300005455 Bacteria 1115
11 Ga0070681_10180748 3300005458 Bacteria 2031
12 Ga0070681_10383355 3300005458 Unclassified 1316
13 Ga0070698_100259769 3300005471 Bacteria 1669
14 Ga0070698_100296203 3300005471 Bacteria 1549
15 Ga0070699_100591749 3300005518 Bacteria 1011
16 Ga0070699_101113985 3300005518 Bacteria 724
17 Ga0070679_100072448 3300005530 Bacteria 3437
18 Ga0070684_100132232 3300005535 Bacteria 2251
19 Ga0070684_100310293 3300005535 Bacteria 1448
20 Ga0070697_100529025 3300005536 Unclassified 1033
21 Ga0068853_100004203 3300005539 Bacteria 11106
22 Ga0068853_100608281 3300005539 Bacteria 1038
23 Ga0068855_100003905 3300005563 Bacteria 18207
24 Ga0068855_100006634 3300005563 Bacteria 14056
25 Ga0068855_100051446 3300005563 Bacteria 4852
26 Ga0070664_100452920 3300005564 Bacteria 1178
27 Ga0070664_101530878 3300005564 Unclassified 631
28 Ga0068857_100027607 3300005577 Bacteria 5007
29 Ga0068854_101101489 3300005578 Unclassified 707
30 Ga0068856_100092597 3300005614 Bacteria 3008
31 Ga0068852_100035304 3300005616 Bacteria 4169
32 Ga0068851_10009741 3300005834 Bacteria 4475
33 Ga0068863_100290704 3300005841 Bacteria 1584
34 Ga0068860_101718872 3300005843 Bacteria 649
35 Ga0081455_10233496 3300005937 Bacteria 1356
36 Ga0070717_11984908 3300006028 Bacteria 524
37 Ga0075432_10011576 3300006058 Bacteria 2998
38 Ga0070716_100022339 3300006173 Bacteria 3342
39 Ga0075433_10112148 3300006852 Bacteria 2419
40 Ga0075433_10594976 3300006852 Bacteria 971
41 Ga0075434_100219549 3300006871 Unclassified 1921
42 Ga0075434_100653257 3300006871 Bacteria 1070
43 Ga0075434_101313128 3300006871 Bacteria 734
44 Ga0075436_100101790 3300006914 Bacteria 2001
45 Ga0075436_100314820 3300006914 Bacteria 1124
46 Ga0075435_100047465 3300007076 Bacteria 3449
47 Ga0075435_100095315 3300007076 Bacteria 2461
48 Ga0099794_10018758 3300007265 Bacteria 3105
49 Ga0099794_10146316 3300007265 Bacteria 1198
50 Ga0099794_10263018 3300007265 Bacteria 891
51 Ga0099795_10089944 3300007788 Bacteria 1188
52 Ga0105251_10088806 3300009011 Bacteria 1422
53 Ga0105240_10000645 3300009093 Bacteria 64351
54 Ga0105240_10005296 3300009093 Bacteria 19255
55 Ga0105240_10017010 3300009093 Bacteria 9825
56 Ga0105240_10716661 3300009093 Unclassified 1091
57 Ga0111539_11294130 3300009094 Unclassified 846
58 Ga0114129_10040667 3300009147 Bacteria 6553
59 Ga0114129_10164962 3300009147 Bacteria 3024
60 Ga0114129_10715280 3300009147 Bacteria 1286
61 Ga0105241_10032019 3300009174 Bacteria 3938
62 Ga0105237_10001075 3300009545 Bacteria 36717
63 Ga0105237_10012453 3300009545 Bacteria 8966
64 Ga0105238_10008074 3300009551 Bacteria 10528
65 Ga0105238_10463073 3300009551 Bacteria 1266
66 Ga0105238_10804301 3300009551 Bacteria 956
67 Ga0099796_10280241 3300010159 Bacteria 701
68 Ga0105239_10040407 3300010375 Bacteria 5110
69 Ga0157370_10003501 3300013104 Bacteria 18402
70 Ga0157370_10010775 3300013104 Bacteria 9611
71 Ga0157369_10007022 3300013105 Bacteria 12986
72 Ga0157369_10034838 3300013105 Bacteria 5522
73 Ga0157374_10000123 3300013296 Bacteria 70359
74 Ga0157374_10192041 3300013296 Bacteria 1998
75 Ga0157372_10001473 3300013307 Bacteria 25544
76 Ga0182008_10196631 3300014497 Bacteria 1025
77 Ga0182006_1004125 3300015261 Bacteria 7221
78 Ga0182007_10000331 3300015262 Bacteria 29987
79 Ga0207656_10027557 3300025321 Bacteria 2325
80 Ga0207713_1007046 3300025735 Bacteria 6733
81 Ga0207647_10000257 3300025904 Bacteria 43652
82 Ga0207647_10049290 3300025904 Bacteria 2613
83 Ga0207705_10104486 3300025909 Bacteria 2087
84 Ga0207705_10109086 3300025909 Bacteria 2043
85 Ga0207684_10015940 3300025910 Bacteria 6458
86 Ga0207654_10110076 3300025911 Bacteria 1712
87 Ga0207707_10001185 3300025912 Bacteria 24547
88 Ga0207707_10152025 3300025912 Bacteria 2023
89 Ga0207695_10000547 3300025913 Bacteria 78059
90 Ga0207695_10002737 3300025913 Bacteria 25702
91 Ga0207695_10024770 3300025913 Bacteria 6739
92 Ga0207695_11260586 3300025913 Unclassified 619
93 Ga0207671_10020203 3300025914 Bacteria 5074
94 Ga0207671_10281618 3300025914 Bacteria 1311
95 Ga0207671_10470263 3300025914 Bacteria 1002
96 Ga0207693_11406410 3300025915 Bacteria 518
97 Ga0207660_10003703 3300025917 Bacteria 9962
98 Ga0207657_10000187 3300025919 Bacteria 64305
99 Ga0207657_10006555 3300025919 Bacteria 12051
100 Ga0207649_10017096 3300025920 Bacteria 4106
101 Ga0207652_10003468 3300025921 Bacteria 13006
102 Ga0207694_10100052 3300025924 Bacteria 2297
103 Ga0207650_10005219 3300025925 Bacteria 8860
104 Ga0207700_11069938 3300025928 Bacteria 721
105 Ga0207700_11271598 3300025928 Bacteria 656
106 Ga0207665_10041843 3300025939 Bacteria 3062
107 Ga0207661_10075113 3300025944 Bacteria 2772
108 Ga0207679_10808943 3300025945 Bacteria 855
109 Ga0207679_11444771 3300025945 Unclassified 631
110 Ga0207667_10005865 3300025949 Bacteria 14958
111 Ga0207667_10009101 3300025949 Bacteria 11739
112 Ga0207667_10024844 3300025949 Bacteria 6569
113 Ga0207712_10968001 3300025961 Bacteria 754
114 Ga0207639_10004528 3300026041 Bacteria 9368
115 Ga0207702_10216297 3300026078 Bacteria 1784
116 Ga0207641_10113821 3300026088 Bacteria 2403
117 Ga0207674_10029679 3300026116 Bacteria 5755
118 Ga0207674_10559415 3300026116 Bacteria 1105
119 Ga0207698_10074788 3300026142 Bacteria 2704
120 Ga0209588_1015372 3300027671 Bacteria 2353
121 Ga0209588_1040776 3300027671 Bacteria 1498
122 Ga0209588_1063774 3300027671 Bacteria 1191
123 Ga0207428_10629530 3300027907 Bacteria 771
124 Ga0316583_10079811 3300032133 Bacteria 1144
125 Ga0373948_0069963 3300034817 Bacteria 785
126 Ga0373959_0035447 3300034820 Bacteria 1026
127 Ga0373956_0111600 3300035119 Bacteria 1273
128 Ga0373931_0004435 3300035691 Bacteria 6413
129 Ga0373927_0024388 3300035695 Bacteria 3957
130 Ga0373937_0241121 3300036401 Bacteria 1703
131 Ga0316584_0458486 3300036712 Bacteria 901
132 Ga0451576_0692742 3300045051 Bacteria 1071
133 Ga0495590_0000385 3300046457 Bacteria 22415
134 Ga0495638_0003866 3300046460 Bacteria 11614
135 Ga0495651_0029934 3300046462 Bacteria 4245
136 Ga0495650_0000737 3300046471 Bacteria 41003
137 Ga0495580_0000309 3300046472 Bacteria 39776
138 Ga0495580_0025521 3300046472 Bacteria 4319
139 Ga0495580_0225747 3300046472 Bacteria 1286
140 Ga0495605_0007995 3300046474 Bacteria 5988
141 Ga0495605_0286348 3300046474 Bacteria 699
142 Ga0495584_0000488 3300046491 Bacteria 27288
143 Ga0495585_0021191 3300046492 Bacteria 3734
144 Ga0495607_0002160 3300046501 Bacteria 16382
145 Ga0495607_0053980 3300046501 Bacteria 2318
146 Ga0495583_0005727 3300046506 Bacteria 8333
147 Ga0495583_0072173 3300046506 Bacteria 1515
148 Ga0495616_0000655 3300046513 Bacteria 25722
149 Ga0495632_0017212 3300046519 Bacteria 3997
150 Ga0495643_0001497 3300046522 Bacteria 21173
151 Ga0495644_0000546 3300046523 Bacteria 15898
152 Ga0495648_0003825 3300046524 Bacteria 13069
153 Ga0495648_0015515 3300046524 Bacteria 5529
154 Ga0495648_0038121 3300046524 Bacteria 3079
155 Ga0495648_0176315 3300046524 Bacteria 1091
156 Ga0495652_0006927 3300046529 Bacteria 10487
157 Ga0495654_0006446 3300046530 Bacteria 6669
158 Ga0495609_0000585 3300046538 Bacteria 28606
159 Ga0495597_0003114 3300046542 Bacteria 9955
160 Ga0495622_0035485 3300046557 Bacteria 2325
161 Ga0495622_0118109 3300046557 Bacteria 1212
162 Ga0495656_0007977 3300046615 Bacteria 3766
163 Ga0495611_0000501 3300046648 Bacteria 23343
164 Ga0495611_0014320 3300046648 Bacteria 3387
165 Ga0495625_0032691 3300046660 Bacteria 3855
166 Ga0495659_0034845 3300046664 Bacteria 1772
167 Ga0495659_0059716 3300046664 Bacteria 1405
168 Ga0495661_0061208 3300046665 Bacteria 2235
169 Ga0495599_0873905 3300046678 Bacteria 510
170 Ga0495623_0005314 3300046679 Bacteria 8436
171 Ga0495624_0802397 3300046690 Bacteria 556
172 Ga0495624_0811195 3300046690 Bacteria 553
173 Ga0495671_0026910 3300046692 Bacteria 2976
174 Ga0495649_0000023 3300046694 Bacteria 178544
175 Ga0495649_0000030 3300046694 Bacteria 152164
176 Ga0495589_0464029 3300046794 Bacteria 579
177 Ga0495660_0004421 3300046810 Bacteria 8508
178 Ga0495581_0155640 3300047315 Bacteria 1336
179 Ga0495636_0005020 3300047318 Bacteria 5194
180 Ga0495674_0012013 3300047319 Bacteria 8164
181 Ga0495672_0000077 3300047320 Bacteria 165019
182 Ga0495672_0012107 3300047320 Bacteria 6039
183 Ga0495672_0046959 3300047320 Bacteria 2572
184 Ga0495683_0046064 3300047323 Bacteria 2189
185 Ga0495687_030680 3300047443 Bacteria 2474
186 Ga0495687_147066 3300047443 Bacteria 811
187 Ga0495677_0000249 3300047445 Bacteria 23579
188 Ga0495685_000072 3300047447 Bacteria 38017
189 Ga0495673_0017506 3300047469 Bacteria 3635
190 Ga0495673_0083808 3300047469 Bacteria 1315
191 Ga0495626_0002217 3300048091 Bacteria 13923
192 Ga0495626_0008181 3300048091 Bacteria 5761
193 Ga0496101_0270252 3300048904 Bacteria 1327
194 Ga0496102_0548566 3300048905 Bacteria 1079
195 Ga0496105_0215760 3300048908 Bacteria 1563
196 Ga0496106_0052071 3300048909 Bacteria 3088
197 Ga0496116_0208861 3300048919 Bacteria 1014
198 Ga0496118_0001833 3300048921 Bacteria 30443
199 Ga0496121_0040936 3300048924 Bacteria 4057
200 Ga0495682_0006460 3300049460 Bacteria 4736
201 Ga0501070_0376037 3300049586 Bacteria 1151
202 nmdc:mga05p37_8141_c1 3300050507 Bacteria 12391
203 nmdc:mga0n895_1132659_c1 3300050512 Bacteria 759
204 nmdc:mga0n895_1638713_c1 3300050512 Bacteria 607
205 nmdc:mga08x19_37282_c1 3300050514 Bacteria 3085
206 Ga0500577_0147444 3300053142 Bacteria 996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0005020 Ga0495636_0005020_2048_2524 148
2 3300049586 Ga0501070_0376037 Ga0501070_0376037_560_1030 148
3 3300006028 Ga0070717_11984908 Ga0070717_119849081 149
4 iso_pu_bacteria 2791355137 2792835125 149
5 3300053142 Ga0500577_0147444 Ga0500577_0147444_204_680 151
6 iso_pu_bacteria 2842324504 2842329910 151
7 iso_pu_bacteria 2842348783 2842354624 151
8 iso_pu_bacteria 2842454564 2842460073 151
9 3300034817 Ga0373948_0069963 Ga0373948_0069963_234_698 152
10 3300046474 Ga0495605_0286348 Ga0495605_0286348_11_469 152
11 3300046501 Ga0495607_0002160 Ga0495607_0002160_4999_5457 152
12 3300046523 Ga0495644_0000546 Ga0495644_0000546_1539_1997 152
13 3300046615 Ga0495656_0007977 Ga0495656_0007977_949_1407 152
14 3300046648 Ga0495611_0000501 Ga0495611_0000501_5927_6385 152
15 3300046665 Ga0495661_0061208 Ga0495661_0061208_1236_1694 152
16 3300047445 Ga0495677_0000249 Ga0495677_0000249_10932_11390 152
17 3300047447 Ga0495685_000072 Ga0495685_000072_8605_9063 152
18 iso_pu_bacteria 2885266251 2885269260 152
19 3300006058 Ga0075432_10011576 Ga0075432_100115765 153
20 3300006852 Ga0075433_10594976 Ga0075433_105949761 153
21 3300006871 Ga0075434_100219549 Ga0075434_1002195493 153
22 3300006871 Ga0075434_101313128 Ga0075434_1013131281 153
23 3300006914 Ga0075436_100314820 Ga0075436_1003148202 153
24 3300007076 Ga0075435_100047465 Ga0075435_1000474652 153
25 3300009094 Ga0111539_11294130 Ga0111539_112941302 153
26 3300009147 Ga0114129_10164962 Ga0114129_101649625 153
27 3300010159 Ga0099796_10280241 Ga0099796_102802412 153
28 3300025910 Ga0207684_10015940 Ga0207684_1001594011 153
29 3300027907 Ga0207428_10629530 Ga0207428_106295302 153
30 3300046474 Ga0495605_0007995 Ga0495605_0007995_1852_2313 153
31 3300046491 Ga0495584_0000488 Ga0495584_0000488_25591_26052 153
32 3300046519 Ga0495632_0017212 Ga0495632_0017212_1603_2064 153
33 3300046664 Ga0495659_0034845 Ga0495659_0034845_377_838 153
34 3300046694 Ga0495649_0000030 Ga0495649_0000030_11111_11572 153
35 3300047320 Ga0495672_0012107 Ga0495672_0012107_1897_2358 153
36 3300047443 Ga0495687_147066 Ga0495687_147066_135_596 153
37 3300048091 Ga0495626_0002217 Ga0495626_0002217_6080_6541 153
38 3300050512 nmdc:mga0n895_1132659_c1 nmdc:mga0n895_1132659_c1_252_713 153
39 iso_pu_bacteria 2562617112 2563056400 153
40 iso_pu_bacteria 2599185240 2599746027 153
41 iso_pu_bacteria 2599185355 2600208139 153
42 iso_pu_bacteria 2675903129 2676743618 153
43 iso_pu_bacteria 2711768613 2713473006 153
44 iso_pu_bacteria 2711768613 2713475246 153
45 iso_pu_bacteria 2744054900 2746085380 153
46 iso_pu_bacteria 2744054901 2746093828 153
47 iso_pu_bacteria 2751185846 2753570181 153
48 iso_pu_bacteria 2818991450 2819624555 153
49 iso_pu_bacteria 2901300506 2901304870 153
50 iso_pu_bacteria 2921643360 2921654296 153
51 iso_pu_bacteria 2928108538 2928108605 153
52 iso_pu_bacteria 2928135762 2928135829 153
53 iso_pu_bacteria 2928503688 2928508282 153
54 3300005471 Ga0070698_100296203 Ga0070698_1002962032 154
55 3300005563 Ga0068855_100051446 Ga0068855_1000514462 154
56 3300005564 Ga0070664_101530878 Ga0070664_1015308781 154
57 3300005616 Ga0068852_100035304 Ga0068852_1000353046 154
58 3300005834 Ga0068851_10009741 Ga0068851_100097413 154
59 3300005937 Ga0081455_10233496 Ga0081455_102334963 154
60 3300006173 Ga0070716_100022339 Ga0070716_1000223393 154
61 3300006871 Ga0075434_100653257 Ga0075434_1006532572 154
62 3300006914 Ga0075436_100101790 Ga0075436_1001017903 154
63 3300007265 Ga0099794_10263018 Ga0099794_102630181 154
64 3300007788 Ga0099795_10089944 Ga0099795_100899442 154
65 3300025913 Ga0207695_10024770 Ga0207695_100247706 154
66 3300025915 Ga0207693_11406410 Ga0207693_114064101 154
67 3300025920 Ga0207649_10017096 Ga0207649_100170966 154
68 3300025921 Ga0207652_10003468 Ga0207652_1000346813 154
69 3300025939 Ga0207665_10041843 Ga0207665_100418433 154
70 3300025945 Ga0207679_11444771 Ga0207679_114447712 154
71 3300026116 Ga0207674_10029679 Ga0207674_100296792 154
72 3300027671 Ga0209588_1063774 Ga0209588_10637742 154
73 3300046457 Ga0495590_0000385 Ga0495590_0000385_7597_8064 154
74 3300046460 Ga0495638_0003866 Ga0495638_0003866_4965_5432 154
75 3300046462 Ga0495651_0029934 Ga0495651_0029934_1430_1894 154
76 3300046471 Ga0495650_0000737 Ga0495650_0000737_35754_36221 154
77 3300046472 Ga0495580_0225747 Ga0495580_0225747_264_728 154
78 3300046492 Ga0495585_0021191 Ga0495585_0021191_1580_2047 154
79 3300046501 Ga0495607_0053980 Ga0495607_0053980_1243_1710 154
80 3300046506 Ga0495583_0072173 Ga0495583_0072173_427_894 154
81 3300046513 Ga0495616_0000655 Ga0495616_0000655_10904_11371 154
82 3300046522 Ga0495643_0001497 Ga0495643_0001497_10254_10721 154
83 3300046524 Ga0495648_0003825 Ga0495648_0003825_3463_3930 154
84 3300046529 Ga0495652_0006927 Ga0495652_0006927_2405_2869 154
85 3300046530 Ga0495654_0006446 Ga0495654_0006446_5237_5704 154
86 3300046538 Ga0495609_0000585 Ga0495609_0000585_22322_22789 154
87 3300046542 Ga0495597_0003114 Ga0495597_0003114_5724_6191 154
88 3300046557 Ga0495622_0035485 Ga0495622_0035485_295_762 154
89 3300046648 Ga0495611_0014320 Ga0495611_0014320_2217_2684 154
90 3300046660 Ga0495625_0032691 Ga0495625_0032691_1698_2165 154
91 3300046664 Ga0495659_0059716 Ga0495659_0059716_74_541 154
92 3300046678 Ga0495599_0873905 Ga0495599_0873905_15_479 154
93 3300046679 Ga0495623_0005314 Ga0495623_0005314_2121_2585 154
94 3300046690 Ga0495624_0811195 Ga0495624_0811195_36_500 154
95 3300046692 Ga0495671_0026910 Ga0495671_0026910_2111_2578 154
96 3300046694 Ga0495649_0000023 Ga0495649_0000023_161690_162157 154
97 3300046810 Ga0495660_0004421 Ga0495660_0004421_3997_4464 154
98 3300047315 Ga0495581_0155640 Ga0495581_0155640_343_807 154
99 3300047320 Ga0495672_0000077 Ga0495672_0000077_10254_10721 154
100 3300047443 Ga0495687_030680 Ga0495687_030680_1184_1651 154
101 3300047469 Ga0495673_0017506 Ga0495673_0017506_1470_1937 154
102 3300048091 Ga0495626_0008181 Ga0495626_0008181_64_531 154
103 3300050512 nmdc:mga0n895_1638713_c1 nmdc:mga0n895_1638713_c1_62_529 154
104 3300050514 nmdc:mga08x19_37282_c1 nmdc:mga08x19_37282_c1_2190_2657 154
105 3300032133 Ga0316583_10079811 Ga0316583_100798112 155
106 3300035119 Ga0373956_0111600 Ga0373956_0111600_378_845 155
107 3300036401 Ga0373937_0241121 Ga0373937_0241121_383_850 155
108 3300036712 Ga0316584_0458486 Ga0316584_0458486_168_635 155
109 3300005518 Ga0070699_101113985 Ga0070699_1011139851 156
110 3300006852 Ga0075433_10112148 Ga0075433_101121483 156
111 3300007265 Ga0099794_10018758 Ga0099794_100187582 156
112 3300009093 Ga0105240_10005296 Ga0105240_100052964 156
113 3300009093 Ga0105240_10716661 Ga0105240_107166612 156
114 3300009545 Ga0105237_10001075 Ga0105237_1000107521 156
115 3300009551 Ga0105238_10463073 Ga0105238_104630731 156
116 3300010375 Ga0105239_10040407 Ga0105239_100404073 156
117 3300013104 Ga0157370_10003501 Ga0157370_100035015 156
118 3300013105 Ga0157369_10034838 Ga0157369_100348383 156
119 3300013296 Ga0157374_10000123 Ga0157374_1000012328 156
120 3300013307 Ga0157372_10001473 Ga0157372_100014735 156
121 3300025913 Ga0207695_11260586 Ga0207695_112605861 156
122 3300027671 Ga0209588_1015372 Ga0209588_10153722 156
123 3300046524 Ga0495648_0038121 Ga0495648_0038121_755_1225 156
124 3300046690 Ga0495624_0802397 Ga0495624_0802397_63_533 156
125 3300047319 Ga0495674_0012013 Ga0495674_0012013_3235_3705 156
126 3300002067 JGI24735J21928_10001151 JGI24735J21928_100011512 157
127 3300002067 JGI24735J21928_10009752 JGI24735J21928_100097524 157
128 3300002067 JGI24735J21928_10009799 JGI24735J21928_100097992 157
129 3300005327 Ga0070658_10013271 Ga0070658_100132716 157
130 3300005329 Ga0070683_100115018 Ga0070683_1001150182 157
131 3300005336 Ga0070680_100013713 Ga0070680_1000137132 157
132 3300005339 Ga0070660_100000374 Ga0070660_10000037416 157
133 3300005339 Ga0070660_100003420 Ga0070660_1000034208 157
134 3300005344 Ga0070661_100205388 Ga0070661_1002053883 157
135 3300005455 Ga0070663_100405503 Ga0070663_1004055032 157
136 3300005458 Ga0070681_10180748 Ga0070681_101807484 157
137 3300005458 Ga0070681_10383355 Ga0070681_103833552 157
138 3300005471 Ga0070698_100259769 Ga0070698_1002597694 157
139 3300005518 Ga0070699_100591749 Ga0070699_1005917492 157
140 3300005530 Ga0070679_100072448 Ga0070679_1000724485 157
141 3300005535 Ga0070684_100132232 Ga0070684_1001322324 157
142 3300005535 Ga0070684_100310293 Ga0070684_1003102931 157
143 3300005536 Ga0070697_100529025 Ga0070697_1005290252 157
144 3300005539 Ga0068853_100004203 Ga0068853_1000042038 157
145 3300005539 Ga0068853_100608281 Ga0068853_1006082811 157
146 3300005563 Ga0068855_100003905 Ga0068855_10000390510 157
147 3300005563 Ga0068855_100006634 Ga0068855_10000663412 157
148 3300005564 Ga0070664_100452920 Ga0070664_1004529201 157
149 3300005577 Ga0068857_100027607 Ga0068857_1000276072 157
150 3300005578 Ga0068854_101101489 Ga0068854_1011014892 157
151 3300005614 Ga0068856_100092597 Ga0068856_1000925974 157
152 3300005841 Ga0068863_100290704 Ga0068863_1002907042 157
153 3300005843 Ga0068860_101718872 Ga0068860_1017188721 157
154 3300007076 Ga0075435_100095315 Ga0075435_1000953153 157
155 3300007265 Ga0099794_10146316 Ga0099794_101463162 157
156 3300009011 Ga0105251_10088806 Ga0105251_100888062 157
157 3300009093 Ga0105240_10000645 Ga0105240_1000064558 157
158 3300009093 Ga0105240_10017010 Ga0105240_100170108 157
159 3300009147 Ga0114129_10040667 Ga0114129_100406675 157
160 3300009147 Ga0114129_10715280 Ga0114129_107152802 157
161 3300009174 Ga0105241_10032019 Ga0105241_100320195 157
162 3300009545 Ga0105237_10012453 Ga0105237_1001245310 157
163 3300009551 Ga0105238_10008074 Ga0105238_100080749 157
164 3300009551 Ga0105238_10804301 Ga0105238_108043012 157
165 3300013104 Ga0157370_10010775 Ga0157370_1001077516 157
166 3300013105 Ga0157369_10007022 Ga0157369_1000702213 157
167 3300013296 Ga0157374_10192041 Ga0157374_101920411 157
168 3300014497 Ga0182008_10196631 Ga0182008_101966311 157
169 3300015261 Ga0182006_1004125 Ga0182006_10041257 157
170 3300015262 Ga0182007_10000331 Ga0182007_1000033110 157
171 3300025321 Ga0207656_10027557 Ga0207656_100275573 157
172 3300025735 Ga0207713_1007046 Ga0207713_10070464 157
173 3300025904 Ga0207647_10000257 Ga0207647_1000025731 157
174 3300025904 Ga0207647_10049290 Ga0207647_100492903 157
175 3300025909 Ga0207705_10104486 Ga0207705_101044863 157
176 3300025909 Ga0207705_10109086 Ga0207705_101090863 157
177 3300025911 Ga0207654_10110076 Ga0207654_101100761 157
178 3300025912 Ga0207707_10001185 Ga0207707_1000118528 157
179 3300025912 Ga0207707_10152025 Ga0207707_101520252 157
180 3300025913 Ga0207695_10000547 Ga0207695_1000054719 157
181 3300025913 Ga0207695_10002737 Ga0207695_1000273712 157
182 3300025914 Ga0207671_10020203 Ga0207671_100202032 157
183 3300025914 Ga0207671_10281618 Ga0207671_102816182 157
184 3300025914 Ga0207671_10470263 Ga0207671_104702631 157
185 3300025917 Ga0207660_10003703 Ga0207660_100037032 157
186 3300025919 Ga0207657_10000187 Ga0207657_1000018737 157
187 3300025919 Ga0207657_10006555 Ga0207657_100065552 157
188 3300025924 Ga0207694_10100052 Ga0207694_101000522 157
189 3300025925 Ga0207650_10005219 Ga0207650_100052199 157
190 3300025928 Ga0207700_11069938 Ga0207700_110699381 157
191 3300025928 Ga0207700_11271598 Ga0207700_112715981 157
192 3300025944 Ga0207661_10075113 Ga0207661_100751132 157
193 3300025945 Ga0207679_10808943 Ga0207679_108089431 157
194 3300025949 Ga0207667_10005865 Ga0207667_1000586513 157
195 3300025949 Ga0207667_10009101 Ga0207667_100091019 157
196 3300025949 Ga0207667_10024844 Ga0207667_100248445 157
197 3300025961 Ga0207712_10968001 Ga0207712_109680011 157
198 3300026041 Ga0207639_10004528 Ga0207639_100045288 157
199 3300026078 Ga0207702_10216297 Ga0207702_102162973 157
200 3300026088 Ga0207641_10113821 Ga0207641_101138213 157
201 3300026116 Ga0207674_10559415 Ga0207674_105594152 157
202 3300026142 Ga0207698_10074788 Ga0207698_100747882 157
203 3300027671 Ga0209588_1040776 Ga0209588_10407762 157
204 3300034820 Ga0373959_0035447 Ga0373959_0035447_517_996 157
205 3300035691 Ga0373931_0004435 Ga0373931_0004435_4584_5063 157
206 3300035695 Ga0373927_0024388 Ga0373927_0024388_2617_3108 157
207 3300045051 Ga0451576_0692742 Ga0451576_0692742_420_899 157
208 3300046472 Ga0495580_0000309 Ga0495580_0000309_28640_29122 157
209 3300046472 Ga0495580_0025521 Ga0495580_0025521_2704_3186 157
210 3300046506 Ga0495583_0005727 Ga0495583_0005727_1017_1499 157
211 3300046524 Ga0495648_0015515 Ga0495648_0015515_3768_4256 157
212 3300046524 Ga0495648_0176315 Ga0495648_0176315_19_501 157
213 3300046557 Ga0495622_0118109 Ga0495622_0118109_647_1129 157
214 3300046794 Ga0495589_0464029 Ga0495589_0464029_31_513 157
215 3300047320 Ga0495672_0046959 Ga0495672_0046959_1300_1782 157
216 3300047323 Ga0495683_0046064 Ga0495683_0046064_614_1096 157
217 3300047469 Ga0495673_0083808 Ga0495673_0083808_415_897 157
218 3300048904 Ga0496101_0270252 Ga0496101_0270252_635_1117 157
219 3300048905 Ga0496102_0548566 Ga0496102_0548566_404_952 157
220 3300048908 Ga0496105_0215760 Ga0496105_0215760_516_998 157
221 3300048909 Ga0496106_0052071 Ga0496106_0052071_1672_2154 157
222 3300048919 Ga0496116_0208861 Ga0496116_0208861_232_714 157
223 3300048921 Ga0496118_0001833 Ga0496118_0001833_5177_5659 157
224 3300048924 Ga0496121_0040936 Ga0496121_0040936_1782_2264 157
225 3300049460 Ga0495682_0006460 Ga0495682_0006460_245_727 157
226 3300050507 nmdc:mga05p37_8141_c1 nmdc:mga05p37_8141_c1_3706_4242 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

58

143

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mwn-assembly2.cif.gz_B structure of the novel 14 kda fragment of alpha-subunit of phycoerythrin from the starving cyanobacterium phormidium tenue 0.4433 34 135
2v8a-assembly1.cif.gz_B the structure of thermosynechococcus elongatus allophycocyanin at 3.5 angstroems. 0.3947 23 143
8jj5-assembly1.cif.gz_A porcine uroplakin complex 0.3802 33 135
8imk-assembly1.cif.gz_A d3-d4, d1-d2, d'3-d'4, d'1-d'2 cylinder in cyanobacterial phycobilisome from anthocerotibacter panamensis (cluster c) 0.3743 15 136
7y4l-assembly1.cif.gz_bD pbs of pbs-psii-psi-lhcs from porphyridium purpureum. 0.3704 14 140
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8188 32 138 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7385 32 138 1.10.10.1740
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7343 37 131 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7179 32 156 1.20.120.550
af_A0A1D6HRG8_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7162 38 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A536ZKJ7-F1-model_v4 DoxX family protein 0.9811 34 156 GO:0005886
AF-A0A7X1TJU7-F1-model_v4 DoxX family membrane protein 0.9756 25 156 GO:0005886
AF-A0A377N9T2-F1-model_v4 DoxX 0.9661 61 148 GO:0005886
AF-A0A522ZDW0-F1-model_v4 DoxX family protein 0.9628 38 152 GO:0005886
AF-A0A1G6RHJ0-F1-model_v4 deleted 0.9563 31 147

Feature Viewer

pLDDT pTM Quality
84.79 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map