F338845

General Info

Members Datasets Scaffolds Average Seq Length
226 168 452 169

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10126229|Ga0099796_101262292
Length 189
Sequence MLRSGAEGSARSGLLREMTANKIYNVLFLCTGNSARSILAESLLNHWGQGKFRAFSAGSFPKGQVHPMAVELLKRMNLPAEGFRSKSWDEFAVPGAPPIDFIFTVCDNAAGEVCPVWPGKPMTAHWGIADPAAVEGTDADKAFAFRKALKELDTRIKLFTSLPINSLDGMTLQAKLRAIGKSDPAPEPV

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.88
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 2.65
Rhizosphere 84.96
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10126229 3300010159 Bacteria 988
2 Ga0070676_10394851 3300005328 Unclassified 961
3 Ga0070690_100005223 3300005330 Bacteria 7275
4 Ga0068869_100026748 3300005334 Unclassified 4017
5 Ga0070666_10176150 3300005335 Bacteria 1499
6 Ga0068868_100008182 3300005338 Bacteria 7482
7 Ga0070689_100003030 3300005340 Bacteria 11065
8 Ga0070687_100034044 3300005343 Bacteria 2519
9 Ga0070669_100146567 3300005353 Bacteria 1825
10 Ga0070675_100042095 3300005354 Unclassified 3731
11 Ga0070671_100018587 3300005355 Bacteria 5647
12 Ga0070674_100026513 3300005356 Unclassified 3787
13 Ga0070673_100125101 3300005364 Bacteria 2150
14 Ga0070688_100019584 3300005365 Bacteria 3923
15 Ga0070659_100166304 3300005366 Unclassified 1805
16 Ga0070667_100230986 3300005367 Bacteria 1649
17 Ga0070701_10101482 3300005438 Unclassified 1594
18 Ga0070705_100310055 3300005440 Bacteria 1135
19 Ga0070694_100479617 3300005444 Unclassified 987
20 Ga0070708_100243626 3300005445 Bacteria 1688
21 Ga0070662_100255681 3300005457 Unclassified 1410
22 Ga0068867_100008714 3300005459 Bacteria 7161
23 Ga0070685_10017315 3300005466 Unclassified 3855
24 Ga0070707_100217906 3300005468 Bacteria 1860
25 Ga0070699_100400965 3300005518 Bacteria 1240
26 Ga0068853_101999597 3300005539 Unclassified 562
27 Ga0070686_100031591 3300005544 Bacteria 3239
28 Ga0070695_100002209 3300005545 Bacteria 11162
29 Ga0070695_100339392 3300005545 Bacteria 1122
30 Ga0070696_100115131 3300005546 Bacteria 1940
31 Ga0070696_100699807 3300005546 Bacteria 826
32 Ga0070665_100330669 3300005548 Bacteria 1528
33 Ga0070665_100580025 3300005548 Bacteria 1134
34 Ga0070704_100009739 3300005549 Bacteria 5825
35 Ga0070704_100222918 3300005549 Bacteria 1534
36 Ga0068859_100017980 3300005617 Bacteria 7105
37 Ga0068859_100036930 3300005617 Unclassified 4903
38 Ga0068870_10167725 3300005840 Bacteria 1307
39 Ga0068870_10259418 3300005840 Bacteria 1081
40 Ga0068863_100008728 3300005841 Bacteria 9901
41 Ga0068863_100160657 3300005841 Bacteria 2153
42 Ga0068858_100018169 3300005842 Bacteria 6587
43 Ga0068860_100050168 3300005843 Unclassified 3973
44 Ga0068860_100051091 3300005843 Bacteria 3934
45 Ga0068860_100796979 3300005843 Bacteria 958
46 Ga0068862_100019372 3300005844 Bacteria 5679
47 Ga0075365_10053037 3300006038 Unclassified 2684
48 Ga0075368_10280630 3300006042 Unclassified 716
49 Ga0075363_100034472 3300006048 Unclassified 2643
50 Ga0075364_10130057 3300006051 Unclassified 1689
51 Ga0075362_10011557 3300006177 Bacteria 3482
52 Ga0097621_100792079 3300006237 Bacteria 878
53 Ga0075370_10069514 3300006353 Unclassified 2012
54 Ga0068871_100075648 3300006358 Unclassified 2780
55 Ga0068871_100999446 3300006358 Bacteria 779
56 Ga0075428_100004613 3300006844 Bacteria 15241
57 Ga0075428_100206197 3300006844 Bacteria 2124
58 Ga0075430_100000758 3300006846 Bacteria 24898
59 Ga0075430_100027860 3300006846 Bacteria 4798
60 Ga0075430_100098492 3300006846 Unclassified 2443
61 Ga0075430_100108995 3300006846 Bacteria 2310
62 Ga0075430_100328510 3300006846 Bacteria 1264
63 Ga0075431_100003599 3300006847 Bacteria 15018
64 Ga0075431_100017559 3300006847 Bacteria 7274
65 Ga0075431_100361086 3300006847 Bacteria 1459
66 Ga0075429_100000507 3300006880 Bacteria 29416
67 Ga0075429_100028648 3300006880 Unclassified 4835
68 Ga0075429_100572346 3300006880 Bacteria 990
69 Ga0068865_100008513 3300006881 Bacteria 6342
70 Ga0097620_100017980 3300006931 Bacteria 7105
71 Ga0097620_100036930 3300006931 Unclassified 4903
72 Ga0097620_100829736 3300006931 Bacteria 1011
73 Ga0075435_100006142 3300007076 Bacteria 8464
74 Ga0105250_10017528 3300009092 Bacteria 2912
75 Ga0105240_10026366 3300009093 Bacteria 7624
76 Ga0105240_10089027 3300009093 Bacteria 3776
77 Ga0111539_10041763 3300009094 Bacteria 5512
78 Ga0111539_10114884 3300009094 Unclassified 3157
79 Ga0111539_10998541 3300009094 Bacteria 973
80 Ga0105245_10082573 3300009098 Unclassified 2940
81 Ga0105247_10001303 3300009101 Bacteria 18336
82 Ga0105247_10500735 3300009101 Bacteria 885
83 Ga0114129_10005352 3300009147 Bacteria 18113
84 Ga0105243_10011720 3300009148 Bacteria 6630
85 Ga0105242_10358622 3300009176 Bacteria 1349
86 Ga0105248_10015968 3300009177 Bacteria 8268
87 Ga0105248_10047666 3300009177 Bacteria 4806
88 Ga0105248_10180442 3300009177 Bacteria 2379
89 Ga0105249_10100886 3300009553 Bacteria 2714
90 Ga0105249_10189489 3300009553 Bacteria 2007
91 Ga0157378_11953051 3300013297 Bacteria 636
92 Ga0163163_10000009 3300014325 Bacteria 268331
93 Ga0163163_10117060 3300014325 Bacteria 2696
94 Ga0157380_10083132 3300014326 Bacteria 2622
95 Ga0157377_10275238 3300014745 Bacteria 1101
96 Ga0157379_10034351 3300014968 Bacteria 4521
97 Ga0157379_10049337 3300014968 Bacteria 3758
98 Ga0157376_10545040 3300014969 Bacteria 1147
99 Ga0207696_1035024 3300025711 Bacteria 1496
100 Ga0207710_10001602 3300025900 Bacteria 11074
101 Ga0207710_10181645 3300025900 Bacteria 1032
102 Ga0207680_10110093 3300025903 Bacteria 1785
103 Ga0207643_10278938 3300025908 Bacteria 1036
104 Ga0207695_10076271 3300025913 Bacteria 3408
105 Ga0207660_10377524 3300025917 Bacteria 1139
106 Ga0207662_10102699 3300025918 Bacteria 1773
107 Ga0207646_10117116 3300025922 Bacteria 2393
108 Ga0207650_10189664 3300025925 Bacteria 1642
109 Ga0207659_10336542 3300025926 Bacteria 1249
110 Ga0207687_10063196 3300025927 Unclassified 2620
111 Ga0207644_10022263 3300025931 Bacteria 4328
112 Ga0207706_10036190 3300025933 Bacteria 4386
113 Ga0207670_10770371 3300025936 Bacteria 800
114 Ga0207669_10007104 3300025937 Bacteria 5155
115 Ga0207691_10015928 3300025940 Bacteria 7142
116 Ga0207711_10065188 3300025941 Bacteria 3148
117 Ga0207711_10072167 3300025941 Bacteria 2998
118 Ga0207711_10075262 3300025941 Bacteria 2938
119 Ga0207689_10218809 3300025942 Bacteria 1573
120 Ga0207651_10150275 3300025960 Bacteria 1812
121 Ga0207712_10061462 3300025961 Bacteria 2666
122 Ga0207712_10340242 3300025961 Bacteria 1244
123 Ga0207703_10010280 3300026035 Bacteria 7329
124 Ga0207703_10032703 3300026035 Bacteria 4117
125 Ga0207703_10100262 3300026035 Bacteria 2453
126 Ga0207639_11655973 3300026041 Unclassified 600
127 Ga0207678_10002531 3300026067 Bacteria 16661
128 Ga0207708_10004500 3300026075 Bacteria 10264
129 Ga0207641_10150196 3300026088 Bacteria 2109
130 Ga0207641_12094876 3300026088 Bacteria 566
131 Ga0207648_10003074 3300026089 Bacteria 17628
132 Ga0207675_100022987 3300026118 Bacteria 5799
133 Ga0207683_10076313 3300026121 Bacteria 2967
134 Ga0209813_10206995 3300027866 Unclassified 729
135 Ga0207428_10070106 3300027907 Bacteria 2756
136 Ga0207428_10101989 3300027907 Bacteria 2216
137 Ga0268266_10289412 3300028379 Bacteria 1525
138 Ga0268265_11094295 3300028380 Bacteria 791
139 Ga0268264_10031199 3300028381 Bacteria 4369
140 Ga0268264_10771296 3300028381 Bacteria 959
141 Ga0307511_10000037 3300030521 Bacteria 103008
142 Ga0307511_10007976 3300030521 Bacteria 10619
143 Ga0265770_1000034 3300030878 Bacteria 13440
144 Ga0265760_10002232 3300031090 Bacteria 5657
145 Ga0265325_10003806 3300031241 Bacteria 9730
146 Ga0265316_10198595 3300031344 Bacteria 1488
147 Ga0307509_10649593 3300031507 Bacteria 724
148 Ga0307408_100881471 3300031548 Bacteria 818
149 Ga0316575_10023405 3300031665 Bacteria 2388
150 Ga0316576_10022255 3300031727 Bacteria 4400
151 Ga0316578_10309300 3300031728 Bacteria 944
152 Ga0307416_102099873 3300032002 Bacteria 667
153 Ga0307411_10136318 3300032005 Bacteria 1803
154 Ga0307510_10061566 3300033180 Bacteria 3846
155 Ga0373952_0074402 3300035092 Bacteria 856
156 Ga0373936_0069625 3300035113 Bacteria 1448
157 Ga0373954_0080607 3300035118 Bacteria 1555
158 Ga0316574_0027219 3300035398 Bacteria 3443
159 Ga0373937_0001509 3300036401 Bacteria 19546
160 Ga0373937_0611941 3300036401 Bacteria 1034
161 Ga0316584_0021499 3300036712 Bacteria 4690
162 Ga0373925_0116000 3300037068 Bacteria 2074
163 Ga0395900_0228622 3300037418 Bacteria 1872
164 Ga0395905_0096419 3300037471 Bacteria 2777
165 Ga0439431_0003376 3300041997 Bacteria 3513
166 Ga0439442_067888 3300042002 Bacteria 758
167 Ga0450923_010064 3300042125 Bacteria 1668
168 Ga0439446_0021112 3300042156 Bacteria 1839
169 Ga0439434_0002207 3300042435 Bacteria 5654
170 Ga0450918_037068 3300042531 Bacteria 869
171 Ga0453683_0116362 3300044673 Bacteria 1682
172 Ga0451576_0008719 3300045051 Bacteria 11866
173 Ga0495656_0419742 3300046615 Bacteria 702
174 Ga0495668_0230095 3300046616 Bacteria 1015
175 Ga0495669_0032791 3300046684 Bacteria 2284
176 Ga0495677_0324868 3300047445 Bacteria 606
177 Ga0496101_0660774 3300048904 Bacteria 826
178 Ga0496102_0080347 3300048905 Bacteria 3004
179 Ga0496102_0513989 3300048905 Bacteria 1120
180 Ga0496106_0240764 3300048909 Bacteria 1446
181 Ga0496111_0686505 3300048914 Bacteria 745
182 Ga0496112_0066865 3300048915 Bacteria 3547
183 Ga0496121_0047627 3300048924 Bacteria 3655
184 Ga0496125_0065354 3300048928 Bacteria 2883
185 Ga0496126_0534004 3300048929 Bacteria 933
186 Ga0496126_0818292 3300048929 Bacteria 713
187 Ga0501071_0609758 3300049587 Bacteria 839
188 Ga0501075_1019280 3300049591 Bacteria 629
189 Ga0501079_0044715 3300049741 Bacteria 3417
190 Ga0501081_0027853 3300049743 Bacteria 3810
191 nmdc:mga00v17_223739_c1 3300050491 Unclassified 1219
192 nmdc:mga0yw44_442230_c1 3300050492 Unclassified 881
193 nmdc:mga0k408_25316_c1 3300050493 Unclassified 3361
194 nmdc:mga06z11_48940_c1 3300050494 Unclassified 2154
195 nmdc:mga04h51_389098_c1 3300050495 Unclassified 582
196 nmdc:mga05p37_1048712_c1 3300050507 Unclassified 860
197 nmdc:mga05p37_400527_c1 3300050507 Bacteria 1603
198 nmdc:mga05p37_8149_c1 3300050507 Bacteria 12385
199 nmdc:mga09592_17288_c1 3300050508 Bacteria 5908
200 nmdc:mga09592_425087_c1 3300050508 Bacteria 1147
201 nmdc:mga09592_447651_c1 3300050508 Bacteria 1114
202 nmdc:mga09592_507611_c1 3300050508 Bacteria 1038
203 nmdc:mga0qj67_131601_c1 3300050509 Bacteria 2026
204 nmdc:mga0qj67_316723_c1 3300050509 Bacteria 1263
205 nmdc:mga0qj67_33686_c1 3300050509 Bacteria 3998
206 nmdc:mga0qj67_4184_c1 3300050509 Bacteria 10454
207 nmdc:mga0qj67_528477_c1 3300050509 Unclassified 947
208 nmdc:mga06r32_110363_c1 3300050510 Bacteria 2706
209 nmdc:mga06r32_1697086_c1 3300050510 Bacteria 569
210 nmdc:mga06r32_1879_c1 3300050510 Bacteria 12730
211 nmdc:mga08y16_1630333_c1 3300050511 Bacteria 602
212 nmdc:mga08y16_52888_c1 3300050511 Bacteria 4247
213 nmdc:mga08y16_97795_c1 3300050511 Unclassified 3057
214 nmdc:mga0n895_162122_c1 3300050512 Bacteria 2268
215 nmdc:mga0rr50_165085_c1 3300050513 Bacteria 1800
216 nmdc:mga0rr50_461069_c1 3300050513 Bacteria 1078
217 nmdc:mga0a205_4098_c1 3300050515 Bacteria 13041
218 Ga0500583_0001470 3300053092 Bacteria 6768
219 Ga0500559_0041131 3300053136 Bacteria 2014
220 Ga0500559_0178618 3300053136 Bacteria 1000
221 Ga0500588_0129144 3300053146 Bacteria 898
222 Ga0500616_0130745 3300053153 Bacteria 1186
223 Ga0500622_0010182 3300053156 Bacteria 5172
224 Ga0500637_0067278 3300053178 Bacteria 2058
225 Ga0530510_0238359 3300061734 Bacteria 1354
226 2899807701 2899803654 Bacteria 5577784
227 Ga0099796_10126229
228 Ga0070676_10394851
229 Ga0070690_100005223
230 Ga0068869_100026748
231 Ga0070666_10176150
232 Ga0068868_100008182
233 Ga0070689_100003030
234 Ga0070687_100034044
235 Ga0070669_100146567
236 Ga0070675_100042095
237 Ga0070671_100018587
238 Ga0070674_100026513
239 Ga0070673_100125101
240 Ga0070688_100019584
241 Ga0070659_100166304
242 Ga0070667_100230986
243 Ga0070701_10101482
244 Ga0070705_100310055
245 Ga0070694_100479617
246 Ga0070708_100243626
247 Ga0070662_100255681
248 Ga0068867_100008714
249 Ga0070685_10017315
250 Ga0070707_100217906
251 Ga0070699_100400965
252 Ga0068853_101999597
253 Ga0070686_100031591
254 Ga0070695_100002209
255 Ga0070695_100339392
256 Ga0070696_100115131
257 Ga0070696_100699807
258 Ga0070665_100330669
259 Ga0070665_100580025
260 Ga0070704_100009739
261 Ga0070704_100222918
262 Ga0068859_100017980
263 Ga0068859_100036930
264 Ga0068870_10167725
265 Ga0068870_10259418
266 Ga0068863_100008728
267 Ga0068863_100160657
268 Ga0068858_100018169
269 Ga0068860_100050168
270 Ga0068860_100051091
271 Ga0068860_100796979
272 Ga0068862_100019372
273 Ga0075365_10053037
274 Ga0075368_10280630
275 Ga0075363_100034472
276 Ga0075364_10130057
277 Ga0075362_10011557
278 Ga0097621_100792079
279 Ga0075370_10069514
280 Ga0068871_100075648
281 Ga0068871_100999446
282 Ga0075428_100004613
283 Ga0075428_100206197
284 Ga0075430_100000758
285 Ga0075430_100027860
286 Ga0075430_100098492
287 Ga0075430_100108995
288 Ga0075430_100328510
289 Ga0075431_100003599
290 Ga0075431_100017559
291 Ga0075431_100361086
292 Ga0075429_100000507
293 Ga0075429_100028648
294 Ga0075429_100572346
295 Ga0068865_100008513
296 Ga0097620_100017980
297 Ga0097620_100036930
298 Ga0097620_100829736
299 Ga0075435_100006142
300 Ga0105250_10017528
301 Ga0105240_10026366
302 Ga0105240_10089027
303 Ga0111539_10041763
304 Ga0111539_10114884
305 Ga0111539_10998541
306 Ga0105245_10082573
307 Ga0105247_10001303
308 Ga0105247_10500735
309 Ga0114129_10005352
310 Ga0105243_10011720
311 Ga0105242_10358622
312 Ga0105248_10015968
313 Ga0105248_10047666
314 Ga0105248_10180442
315 Ga0105249_10100886
316 Ga0105249_10189489
317 Ga0157378_11953051
318 Ga0163163_10000009
319 Ga0163163_10117060
320 Ga0157380_10083132
321 Ga0157377_10275238
322 Ga0157379_10034351
323 Ga0157379_10049337
324 Ga0157376_10545040
325 Ga0207696_1035024
326 Ga0207710_10001602
327 Ga0207710_10181645
328 Ga0207680_10110093
329 Ga0207643_10278938
330 Ga0207695_10076271
331 Ga0207660_10377524
332 Ga0207662_10102699
333 Ga0207646_10117116
334 Ga0207650_10189664
335 Ga0207659_10336542
336 Ga0207687_10063196
337 Ga0207644_10022263
338 Ga0207706_10036190
339 Ga0207670_10770371
340 Ga0207669_10007104
341 Ga0207691_10015928
342 Ga0207711_10065188
343 Ga0207711_10072167
344 Ga0207711_10075262
345 Ga0207689_10218809
346 Ga0207651_10150275
347 Ga0207712_10061462
348 Ga0207712_10340242
349 Ga0207703_10010280
350 Ga0207703_10032703
351 Ga0207703_10100262
352 Ga0207639_11655973
353 Ga0207678_10002531
354 Ga0207708_10004500
355 Ga0207641_10150196
356 Ga0207641_12094876
357 Ga0207648_10003074
358 Ga0207675_100022987
359 Ga0207683_10076313
360 Ga0209813_10206995
361 Ga0207428_10070106
362 Ga0207428_10101989
363 Ga0268266_10289412
364 Ga0268265_11094295
365 Ga0268264_10031199
366 Ga0268264_10771296
367 Ga0307511_10000037
368 Ga0307511_10007976
369 Ga0265770_1000034
370 Ga0265760_10002232
371 Ga0265325_10003806
372 Ga0265316_10198595
373 Ga0307509_10649593
374 Ga0307408_100881471
375 Ga0316575_10023405
376 Ga0316576_10022255
377 Ga0316578_10309300
378 Ga0307416_102099873
379 Ga0307411_10136318
380 Ga0307510_10061566
381 Ga0373952_0074402
382 Ga0373936_0069625
383 Ga0373954_0080607
384 Ga0316574_0027219
385 Ga0373937_0001509
386 Ga0373937_0611941
387 Ga0316584_0021499
388 Ga0373925_0116000
389 Ga0395900_0228622
390 Ga0395905_0096419
391 Ga0439431_0003376
392 Ga0439442_067888
393 Ga0450923_010064
394 Ga0439446_0021112
395 Ga0439434_0002207
396 Ga0450918_037068
397 Ga0453683_0116362
398 Ga0451576_0008719
399 Ga0495656_0419742
400 Ga0495668_0230095
401 Ga0495669_0032791
402 Ga0495677_0324868
403 Ga0496101_0660774
404 Ga0496102_0080347
405 Ga0496102_0513989
406 Ga0496106_0240764
407 Ga0496111_0686505
408 Ga0496112_0066865
409 Ga0496121_0047627
410 Ga0496125_0065354
411 Ga0496126_0534004
412 Ga0496126_0818292
413 Ga0501071_0609758
414 Ga0501075_1019280
415 Ga0501079_0044715
416 Ga0501081_0027853
417 nmdc:mga00v17_223739_c1
418 nmdc:mga0yw44_442230_c1
419 nmdc:mga0k408_25316_c1
420 nmdc:mga06z11_48940_c1
421 nmdc:mga04h51_389098_c1
422 nmdc:mga05p37_1048712_c1
423 nmdc:mga05p37_400527_c1
424 nmdc:mga05p37_8149_c1
425 nmdc:mga09592_17288_c1
426 nmdc:mga09592_425087_c1
427 nmdc:mga09592_447651_c1
428 nmdc:mga09592_507611_c1
429 nmdc:mga0qj67_131601_c1
430 nmdc:mga0qj67_316723_c1
431 nmdc:mga0qj67_33686_c1
432 nmdc:mga0qj67_4184_c1
433 nmdc:mga0qj67_528477_c1
434 nmdc:mga06r32_110363_c1
435 nmdc:mga06r32_1697086_c1
436 nmdc:mga06r32_1879_c1
437 nmdc:mga08y16_1630333_c1
438 nmdc:mga08y16_52888_c1
439 nmdc:mga08y16_97795_c1
440 nmdc:mga0n895_162122_c1
441 nmdc:mga0rr50_165085_c1
442 nmdc:mga0rr50_461069_c1
443 nmdc:mga0a205_4098_c1
444 Ga0500583_0001470
445 Ga0500559_0041131
446 Ga0500559_0178618
447 Ga0500588_0129144
448 Ga0500616_0130745
449 Ga0500622_0010182
450 Ga0500637_0067278
451 Ga0530510_0238359
452 2899807701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

26

160

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9109 9 145
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9003 9 146
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.8746 9 146
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.8708 9 145
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.8613 9 146
ID Description Score Start End Superfamily
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8526 10 146 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8397 10 146 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8379 9 144 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8239 8 145 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7992 9 144 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A318DK53-F1-model_v4 Arsenate reductase 0.9414 7 168 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A420GFI0-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9364 7 164 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2D6BEZ2-F1-model_v4 deleted 0.935 23 164
AF-A0A7C9QVC3-F1-model_v4 Arsenate reductase ArsC 0.9308 6 165 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1I1LDP7-F1-model_v4 Protein-tyrosine-phosphatase 0.9264 9 165 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map