F338764

General Info

Members Datasets Scaffolds Average Seq Length
226 125 452 362

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100076803|Ga0075429_1000768033
Length 394
Sequence MGRSYAFLARSHWARPFGRAFFCATGYHFVTRPMPGSRLGSARMILAPREPLVGGGAAEAFEQQLQQLIRGGYRNLVVDLSGVESIDSAGIRALVRGHTSARRVDGTLRLAGARRNVSSVLELSHLGGIFQMYESVDAAKIAAWPWDAIRAAAGGTALCGVLVWAGFTWPVELSGIGETVATALTDASGAAVLTVHPFVELAKLVAAALIGILVTAVHKPSTRDRAGSRSMEQAQMLLCVSGALSLARAFGIAGAASIIRFRTPVEDPKDVTILFLLMGLGMSAGLGAFAVAGLGTAFLCLTLVALDVMAKQQTRLMSIEIVAGGRTFPSTRVEEVFARNHIVFEPREIAQADEVTVKYHAWLDPRMSLDDVSAQLMRDVSGLASVSWEHPKRV

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 1.33
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 26.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100076803 3300006880 Bacteria 2909
2 Ga0065712_10000303 3300005290 Bacteria 26548
3 Ga0070676_10035616 3300005328 Bacteria 2863
4 Ga0070683_100157714 3300005329 Bacteria 2153
5 Ga0070690_100003270 3300005330 Bacteria 8853
6 Ga0070670_100005618 3300005331 Bacteria 10583
7 Ga0070670_100061255 3300005331 Unclassified 3231
8 Ga0070677_10029962 3300005333 Bacteria 2068
9 Ga0070666_10002223 3300005335 Bacteria 11739
10 Ga0068868_100236662 3300005338 Bacteria 1533
11 Ga0070689_100118968 3300005340 Bacteria 2109
12 Ga0070687_100011837 3300005343 Bacteria 3831
13 Ga0070692_10100101 3300005345 Bacteria 1588
14 Ga0070669_100015928 3300005353 Bacteria 5362
15 Ga0070669_100045452 3300005353 Bacteria 3200
16 Ga0070669_100086953 3300005353 Bacteria 2336
17 Ga0070669_100103906 3300005353 Bacteria 2147
18 Ga0070675_100029795 3300005354 Unclassified 4403
19 Ga0070675_100034127 3300005354 Bacteria 4128
20 Ga0070675_100210312 3300005354 Unclassified 1691
21 Ga0070674_100031467 3300005356 Bacteria 3516
22 Ga0070674_100043336 3300005356 Bacteria 3061
23 Ga0070674_100152869 3300005356 Unclassified 1743
24 Ga0070673_100013340 3300005364 Bacteria 5680
25 Ga0070673_100014517 3300005364 Bacteria 5490
26 Ga0070701_10007931 3300005438 Bacteria 4566
27 Ga0070705_100008173 3300005440 Bacteria 5175
28 Ga0070705_100009692 3300005440 Bacteria 4797
29 Ga0070705_100080771 3300005440 Bacteria 1996
30 Ga0070700_100081488 3300005441 Bacteria 2091
31 Ga0070700_100123349 3300005441 Unclassified 1739
32 Ga0070694_100027454 3300005444 Bacteria 3696
33 Ga0068867_100004963 3300005459 Bacteria 9375
34 Ga0070699_100100230 3300005518 Unclassified 2539
35 Ga0070684_100015143 3300005535 Bacteria 6270
36 Ga0070672_100274242 3300005543 Unclassified 1425
37 Ga0070686_100000557 3300005544 Bacteria 22262
38 Ga0070686_100072902 3300005544 Unclassified 2253
39 Ga0070695_100000285 3300005545 Bacteria 25550
40 Ga0070696_100033268 3300005546 Bacteria 3541
41 Ga0070696_100134618 3300005546 Bacteria 1801
42 Ga0070696_100222221 3300005546 Bacteria 1417
43 Ga0070696_100289981 3300005546 Unclassified 1250
44 Ga0070704_100005612 3300005549 Bacteria 7326
45 Ga0070704_100146388 3300005549 Bacteria 1851
46 Ga0070664_100092842 3300005564 Unclassified 2614
47 Ga0070664_100097795 3300005564 Bacteria 2549
48 Ga0068857_100019758 3300005577 Bacteria 5918
49 Ga0068854_100004144 3300005578 Bacteria 9112
50 Ga0070702_100005242 3300005615 Bacteria 6012
51 Ga0068859_100049866 3300005617 Bacteria 4205
52 Ga0068859_100181400 3300005617 Bacteria 2188
53 Ga0068861_100001598 3300005719 Bacteria 14419
54 Ga0068861_100156571 3300005719 Bacteria 1875
55 Ga0068870_10101881 3300005840 Bacteria 1624
56 Ga0068860_100416030 3300005843 Unclassified 1332
57 Ga0068862_100018860 3300005844 Bacteria 5749
58 Ga0068862_100101219 3300005844 Bacteria 2520
59 Ga0068871_100020211 3300006358 Bacteria 5098
60 Ga0075428_100000437 3300006844 Bacteria 41489
61 Ga0075428_100003930 3300006844 Bacteria 16305
62 Ga0075428_100091981 3300006844 Unclassified 3307
63 Ga0075428_100195772 3300006844 Unclassified 2186
64 Ga0075430_100014801 3300006846 Bacteria 6643
65 Ga0075430_100121576 3300006846 Bacteria 2177
66 Ga0075431_100016488 3300006847 Bacteria 7498
67 Ga0075431_100035640 3300006847 Bacteria 5122
68 Ga0075431_100066530 3300006847 Bacteria 3721
69 Ga0075431_100078612 3300006847 Unclassified 3405
70 Ga0075433_10071856 3300006852 Bacteria 3042
71 Ga0075433_10090491 3300006852 Bacteria 2705
72 Ga0075433_10147728 3300006852 Bacteria 2090
73 Ga0075429_100029083 3300006880 Bacteria 4799
74 Ga0075429_100030013 3300006880 Bacteria 4722
75 Ga0075429_100094837 3300006880 Bacteria 2602
76 Ga0075436_100027808 3300006914 Bacteria 3893
77 Ga0097620_100049866 3300006931 Bacteria 4205
78 Ga0097620_100181400 3300006931 Bacteria 2188
79 Ga0075435_100150217 3300007076 Unclassified 1958
80 Ga0111539_10000984 3300009094 Bacteria 37322
81 Ga0111539_10002574 3300009094 Bacteria 24010
82 Ga0111539_10017754 3300009094 Bacteria 8809
83 Ga0111539_10068555 3300009094 Bacteria 4188
84 Ga0111539_10116188 3300009094 Unclassified 3137
85 Ga0114129_10000348 3300009147 Bacteria 53953
86 Ga0114129_10003501 3300009147 Bacteria 22077
87 Ga0114129_10007331 3300009147 Bacteria 15701
88 Ga0114129_10011586 3300009147 Bacteria 12556
89 Ga0114129_10022012 3300009147 Bacteria 9047
90 Ga0114129_10042463 3300009147 Bacteria 6404
91 Ga0114129_10078972 3300009147 Unclassified 4576
92 Ga0114129_10147963 3300009147 Unclassified 3216
93 Ga0114129_10203003 3300009147 Bacteria 2684
94 Ga0114129_10330338 3300009147 Bacteria 2025
95 Ga0114129_10517096 3300009147 Bacteria 1557
96 Ga0105243_10033716 3300009148 Bacteria 3960
97 Ga0105243_10151293 3300009148 Bacteria 1991
98 Ga0105248_10008556 3300009177 Bacteria 11235
99 Ga0105249_10123422 3300009553 Bacteria 2464
100 Ga0105249_10275348 3300009553 Bacteria 1678
101 Ga0105246_10068689 3300011119 Unclassified 2486
102 Ga0105246_10115227 3300011119 Bacteria 1982
103 Ga0163163_10029921 3300014325 Bacteria 5241
104 Ga0163163_10451761 3300014325 Bacteria 1345
105 Ga0157380_10143916 3300014326 Bacteria 2052
106 Ga0157380_10188302 3300014326 Bacteria 1819
107 Ga0157377_10057103 3300014745 Bacteria 2218
108 Ga0207697_10070186 3300025315 Unclassified 1467
109 Ga0207682_10037509 3300025893 Bacteria 1963
110 Ga0207680_10008623 3300025903 Bacteria 5017
111 Ga0207645_10007127 3300025907 Bacteria 7937
112 Ga0207643_10063095 3300025908 Unclassified 2118
113 Ga0207660_10065179 3300025917 Bacteria 2632
114 Ga0207662_10038550 3300025918 Bacteria 2800
115 Ga0207662_10105146 3300025918 Bacteria 1754
116 Ga0207662_10207731 3300025918 Bacteria 1270
117 Ga0207681_10006649 3300025923 Bacteria 7100
118 Ga0207681_10010100 3300025923 Bacteria 5777
119 Ga0207681_10084831 3300025923 Bacteria 2246
120 Ga0207659_10039466 3300025926 Bacteria 3293
121 Ga0207706_10066763 3300025933 Bacteria 3166
122 Ga0207706_10347874 3300025933 Unclassified 1289
123 Ga0207709_10025881 3300025935 Bacteria 3364
124 Ga0207709_10083321 3300025935 Bacteria 2067
125 Ga0207670_10034417 3300025936 Bacteria 3274
126 Ga0207704_10317216 3300025938 Bacteria 1201
127 Ga0207691_10280438 3300025940 Unclassified 1434
128 Ga0207711_10017009 3300025941 Bacteria 6040
129 Ga0207661_10129651 3300025944 Bacteria 2158
130 Ga0207679_10070145 3300025945 Bacteria 2640
131 Ga0207679_10092637 3300025945 Unclassified 2342
132 Ga0207651_10008446 3300025960 Bacteria 5563
133 Ga0207712_10088310 3300025961 Bacteria 2276
134 Ga0207640_10003432 3300025981 Bacteria 8536
135 Ga0207648_10010999 3300026089 Bacteria 8545
136 Ga0207674_10015475 3300026116 Bacteria 8379
137 Ga0207675_100001546 3300026118 Bacteria 23054
138 Ga0207675_100046729 3300026118 Unclassified 4045
139 Ga0207675_100093285 3300026118 Unclassified 2832
140 Ga0207428_10001876 3300027907 Bacteria 21403
141 Ga0207428_10016672 3300027907 Bacteria 6318
142 Ga0207428_10060740 3300027907 Bacteria 2994
143 Ga0268265_10020098 3300028380 Bacteria 4656
144 Ga0268265_10046485 3300028380 Bacteria 3245
145 Ga0307408_100021844 3300031548 Unclassified 4338
146 Ga0307408_100030460 3300031548 Bacteria 3747
147 Ga0307408_100165388 3300031548 Unclassified 1761
148 Ga0307405_10084668 3300031731 Bacteria 2082
149 Ga0307410_10094840 3300031852 Bacteria 2126
150 Ga0307406_10033803 3300031901 Bacteria 3132
151 Ga0307407_10043937 3300031903 Unclassified 2515
152 Ga0307407_10164678 3300031903 Bacteria 1454
153 Ga0307412_10033097 3300031911 Unclassified 3282
154 Ga0307412_10055087 3300031911 Unclassified 2643
155 Ga0307412_10121613 3300031911 Unclassified 1880
156 Ga0307409_100018100 3300031995 Unclassified 4721
157 Ga0307409_100042026 3300031995 Unclassified 3420
158 Ga0307409_100050604 3300031995 Bacteria 3174
159 Ga0307416_100021874 3300032002 Unclassified 4603
160 Ga0307416_100095880 3300032002 Bacteria 2563
161 Ga0307416_100115825 3300032002 Unclassified 2374
162 Ga0307411_10058538 3300032005 Bacteria 2550
163 Ga0307415_100064721 3300032126 Unclassified 2545
164 Ga0439433_0008812 3300041999 Unclassified 2193
165 Ga0439449_0036283 3300042007 Bacteria 1834
166 Ga0439462_0035235 3300042015 Bacteria 1330
167 Ga0439435_0006082 3300042436 Bacteria 2695
168 Ga0439460_0027137 3300042461 Bacteria 1606
169 Ga0451577_0095672 3300042876 Bacteria 2652
170 Ga0495613_0139629 3300046689 Unclassified 1732
171 Ga0496102_0184619 3300048905 Unclassified 1965
172 Ga0496109_0379643 3300048912 Bacteria 1335
173 Ga0496113_0094863 3300048916 Unclassified 2306
174 Ga0501299_008171 3300049522 Bacteria 1695
175 Ga0501036_0183133 3300049572 Unclassified 1763
176 Ga0501039_0141966 3300049575 Bacteria 1886
177 Ga0501041_0052691 3300049577 Bacteria 2481
178 Ga0501042_0012346 3300049578 Bacteria 5784
179 Ga0501046_0174186 3300049580 Bacteria 1613
180 Ga0501048_0025945 3300049582 Bacteria 4269
181 Ga0501071_0011742 3300049587 Bacteria 5911
182 Ga0501072_0010456 3300049588 Bacteria 7069
183 Ga0501072_0107480 3300049588 Bacteria 2219
184 Ga0501074_0086626 3300049590 Bacteria 2244
185 Ga0501075_0060825 3300049591 Bacteria 2845
186 Ga0501075_0123912 3300049591 Bacteria 1967
187 Ga0501076_0263675 3300049592 Unclassified 1411
188 Ga0501233_046499 3300049668 Unclassified 1038
189 Ga0501079_0009507 3300049741 Bacteria 7371
190 Ga0501080_0314015 3300049742 Unclassified 1420
191 Ga0501035_0336269 3300049822 Unclassified 1266
192 nmdc:mga0yw44_6067_c1 3300050492 Bacteria 5793
193 nmdc:mga05p37_10414_c1 3300050507 Bacteria 11035
194 nmdc:mga05p37_138621_c1 3300050507 Unclassified 2981
195 nmdc:mga05p37_203528_c1 3300050507 Unclassified 2396
196 nmdc:mga05p37_27460_c1 3300050507 Bacteria 6929
197 nmdc:mga05p37_30821_c1 3300050507 Bacteria 6546
198 nmdc:mga05p37_400045_c1 3300050507 Bacteria 1604
199 nmdc:mga05p37_408949_c1 3300050507 Unclassified 1582
200 nmdc:mga05p37_527781_c1 3300050507 Unclassified 1349
201 nmdc:mga05p37_64114_c1 3300050507 Unclassified 4521
202 nmdc:mga09592_205414_c1 3300050508 Bacteria 1706
203 nmdc:mga09592_208590_c1 3300050508 Unclassified 1692
204 nmdc:mga09592_47772_c1 3300050508 Bacteria 3608
205 nmdc:mga09592_50564_c1 3300050508 Bacteria 3506
206 nmdc:mga0qj67_103026_c1 3300050509 Unclassified 2302
207 nmdc:mga0qj67_30494_c1 3300050509 Bacteria 4199
208 nmdc:mga0qj67_74634_c1 3300050509 Bacteria 2710
209 nmdc:mga06r32_10760_c1 3300050510 Bacteria 8239
210 nmdc:mga06r32_163014_c1 3300050510 Bacteria 2212
211 nmdc:mga06r32_35086_c1 3300050510 Bacteria 4732
212 nmdc:mga06r32_379650_c1 3300050510 Unclassified 1396
213 nmdc:mga06r32_94358_c1 3300050510 Bacteria 2928
214 nmdc:mga08y16_101974_c1 3300050511 Bacteria 2988
215 nmdc:mga08y16_2101_c1 3300050511 Bacteria 20413
216 nmdc:mga08y16_249681_c1 3300050511 Bacteria 1833
217 nmdc:mga08y16_46828_c1 3300050511 Unclassified 4527
218 nmdc:mga08y16_665284_c1 3300050511 Unclassified 1044
219 nmdc:mga0n895_354017_c1 3300050512 Unclassified 1487
220 nmdc:mga0rr50_133513_c1 3300050513 Unclassified 1990
221 nmdc:mga0a205_109220_c1 3300050515 Unclassified 2664
222 nmdc:mga0a205_29806_c1 3300050515 Bacteria 5221
223 nmdc:mga0a205_4177_c1 3300050515 Bacteria 12941
224 nmdc:mga0a205_71499_c1 3300050515 Bacteria 3350
225 Ga0501084_0095934 3300054114 Bacteria 2491
226 Ga0501084_0212099 3300054114 Bacteria 1634
227 Ga0075429_100076803
228 Ga0065712_10000303
229 Ga0070676_10035616
230 Ga0070683_100157714
231 Ga0070690_100003270
232 Ga0070670_100005618
233 Ga0070670_100061255
234 Ga0070677_10029962
235 Ga0070666_10002223
236 Ga0068868_100236662
237 Ga0070689_100118968
238 Ga0070687_100011837
239 Ga0070692_10100101
240 Ga0070669_100015928
241 Ga0070669_100045452
242 Ga0070669_100086953
243 Ga0070669_100103906
244 Ga0070675_100029795
245 Ga0070675_100034127
246 Ga0070675_100210312
247 Ga0070674_100031467
248 Ga0070674_100043336
249 Ga0070674_100152869
250 Ga0070673_100013340
251 Ga0070673_100014517
252 Ga0070701_10007931
253 Ga0070705_100008173
254 Ga0070705_100009692
255 Ga0070705_100080771
256 Ga0070700_100081488
257 Ga0070700_100123349
258 Ga0070694_100027454
259 Ga0068867_100004963
260 Ga0070699_100100230
261 Ga0070684_100015143
262 Ga0070672_100274242
263 Ga0070686_100000557
264 Ga0070686_100072902
265 Ga0070695_100000285
266 Ga0070696_100033268
267 Ga0070696_100134618
268 Ga0070696_100222221
269 Ga0070696_100289981
270 Ga0070704_100005612
271 Ga0070704_100146388
272 Ga0070664_100092842
273 Ga0070664_100097795
274 Ga0068857_100019758
275 Ga0068854_100004144
276 Ga0070702_100005242
277 Ga0068859_100049866
278 Ga0068859_100181400
279 Ga0068861_100001598
280 Ga0068861_100156571
281 Ga0068870_10101881
282 Ga0068860_100416030
283 Ga0068862_100018860
284 Ga0068862_100101219
285 Ga0068871_100020211
286 Ga0075428_100000437
287 Ga0075428_100003930
288 Ga0075428_100091981
289 Ga0075428_100195772
290 Ga0075430_100014801
291 Ga0075430_100121576
292 Ga0075431_100016488
293 Ga0075431_100035640
294 Ga0075431_100066530
295 Ga0075431_100078612
296 Ga0075433_10071856
297 Ga0075433_10090491
298 Ga0075433_10147728
299 Ga0075429_100029083
300 Ga0075429_100030013
301 Ga0075429_100094837
302 Ga0075436_100027808
303 Ga0097620_100049866
304 Ga0097620_100181400
305 Ga0075435_100150217
306 Ga0111539_10000984
307 Ga0111539_10002574
308 Ga0111539_10017754
309 Ga0111539_10068555
310 Ga0111539_10116188
311 Ga0114129_10000348
312 Ga0114129_10003501
313 Ga0114129_10007331
314 Ga0114129_10011586
315 Ga0114129_10022012
316 Ga0114129_10042463
317 Ga0114129_10078972
318 Ga0114129_10147963
319 Ga0114129_10203003
320 Ga0114129_10330338
321 Ga0114129_10517096
322 Ga0105243_10033716
323 Ga0105243_10151293
324 Ga0105248_10008556
325 Ga0105249_10123422
326 Ga0105249_10275348
327 Ga0105246_10068689
328 Ga0105246_10115227
329 Ga0163163_10029921
330 Ga0163163_10451761
331 Ga0157380_10143916
332 Ga0157380_10188302
333 Ga0157377_10057103
334 Ga0207697_10070186
335 Ga0207682_10037509
336 Ga0207680_10008623
337 Ga0207645_10007127
338 Ga0207643_10063095
339 Ga0207660_10065179
340 Ga0207662_10038550
341 Ga0207662_10105146
342 Ga0207662_10207731
343 Ga0207681_10006649
344 Ga0207681_10010100
345 Ga0207681_10084831
346 Ga0207659_10039466
347 Ga0207706_10066763
348 Ga0207706_10347874
349 Ga0207709_10025881
350 Ga0207709_10083321
351 Ga0207670_10034417
352 Ga0207704_10317216
353 Ga0207691_10280438
354 Ga0207711_10017009
355 Ga0207661_10129651
356 Ga0207679_10070145
357 Ga0207679_10092637
358 Ga0207651_10008446
359 Ga0207712_10088310
360 Ga0207640_10003432
361 Ga0207648_10010999
362 Ga0207674_10015475
363 Ga0207675_100001546
364 Ga0207675_100046729
365 Ga0207675_100093285
366 Ga0207428_10001876
367 Ga0207428_10016672
368 Ga0207428_10060740
369 Ga0268265_10020098
370 Ga0268265_10046485
371 Ga0307408_100021844
372 Ga0307408_100030460
373 Ga0307408_100165388
374 Ga0307405_10084668
375 Ga0307410_10094840
376 Ga0307406_10033803
377 Ga0307407_10043937
378 Ga0307407_10164678
379 Ga0307412_10033097
380 Ga0307412_10055087
381 Ga0307412_10121613
382 Ga0307409_100018100
383 Ga0307409_100042026
384 Ga0307409_100050604
385 Ga0307416_100021874
386 Ga0307416_100095880
387 Ga0307416_100115825
388 Ga0307411_10058538
389 Ga0307415_100064721
390 Ga0439433_0008812
391 Ga0439449_0036283
392 Ga0439462_0035235
393 Ga0439435_0006082
394 Ga0439460_0027137
395 Ga0451577_0095672
396 Ga0495613_0139629
397 Ga0496102_0184619
398 Ga0496109_0379643
399 Ga0496113_0094863
400 Ga0501299_008171
401 Ga0501036_0183133
402 Ga0501039_0141966
403 Ga0501041_0052691
404 Ga0501042_0012346
405 Ga0501046_0174186
406 Ga0501048_0025945
407 Ga0501071_0011742
408 Ga0501072_0010456
409 Ga0501072_0107480
410 Ga0501074_0086626
411 Ga0501075_0060825
412 Ga0501075_0123912
413 Ga0501076_0263675
414 Ga0501233_046499
415 Ga0501079_0009507
416 Ga0501080_0314015
417 Ga0501035_0336269
418 nmdc:mga0yw44_6067_c1
419 nmdc:mga05p37_10414_c1
420 nmdc:mga05p37_138621_c1
421 nmdc:mga05p37_203528_c1
422 nmdc:mga05p37_27460_c1
423 nmdc:mga05p37_30821_c1
424 nmdc:mga05p37_400045_c1
425 nmdc:mga05p37_408949_c1
426 nmdc:mga05p37_527781_c1
427 nmdc:mga05p37_64114_c1
428 nmdc:mga09592_205414_c1
429 nmdc:mga09592_208590_c1
430 nmdc:mga09592_47772_c1
431 nmdc:mga09592_50564_c1
432 nmdc:mga0qj67_103026_c1
433 nmdc:mga0qj67_30494_c1
434 nmdc:mga0qj67_74634_c1
435 nmdc:mga06r32_10760_c1
436 nmdc:mga06r32_163014_c1
437 nmdc:mga06r32_35086_c1
438 nmdc:mga06r32_379650_c1
439 nmdc:mga06r32_94358_c1
440 nmdc:mga08y16_101974_c1
441 nmdc:mga08y16_2101_c1
442 nmdc:mga08y16_249681_c1
443 nmdc:mga08y16_46828_c1
444 nmdc:mga08y16_665284_c1
445 nmdc:mga0n895_354017_c1
446 nmdc:mga0rr50_133513_c1
447 nmdc:mga0a205_109220_c1
448 nmdc:mga0a205_29806_c1
449 nmdc:mga0a205_4177_c1
450 nmdc:mga0a205_71499_c1
451 Ga0501084_0095934
452 Ga0501084_0212099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13466

STAS_2

STAS domain

56

127

0.96

PF01740

STAS

STAS domain

39

139

0.9

PF16316

DUF4956

Domain of unknown function (DUF4956)

232

332

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9364 5 109
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9017 2 98
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9013 2 101
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8941 2 109
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.8927 2 105
ID Description Score Start End Superfamily
af_Q55FJ8_836_995_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9156 9 110 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9151 4 107 3.30.750.24
af_Q94LW6_488_626_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9142 4 109 3.30.750.24
af_P9WGF7_437_560_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9085 4 109 3.30.750.24
af_A7YF68_522_654_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9042 4 112 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A538B7V1-F1-model_v4 Anti-sigma factor antagonist 0.9751 11 99 GO:0043856
AF-A0A8B0UCM9-F1-model_v4 deleted 0.9726 25 105
AF-A0A0S8IFG2-F1-model_v4 Anti-sigma factor antagonist 0.972 2 104 GO:0043856
AF-A0A2D5UAQ4-F1-model_v4 Anti-sigma factor antagonist 0.97 2 107 GO:0043856
AF-A0A512HA21-F1-model_v4 Anti-sigma factor antagonist 0.9691 2 108 GO:0043856

Map