F338739

General Info

Members Datasets Scaffolds Average Seq Length
226 146 452 278

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100098929|Ga0068871_1000989292
Length 281
Sequence MTRDSWLEAHPYLRPMADLSAQVDRAASAVDVLAVRIPNWEDYRADFLAGVPLLSCAEAGVDLEPGGRMAIALVQRLASGTSPEWLEVEARALDAELRNEPHASRRIADFLLGPASPLGDEPLTLSFPGLLRFLGWTAMARYLHPVVNAFSGWRNEEQWLRRYCPTCGSLPAMAQLAGSDPGRMRMLSCGCCGTRWQFKRTGCPFCETDAQKLASVTIEEEPGLRIAHCESCGGYLKTYDGQGSESFWLSDWSSLHLDLIAHDRGFKRMAVSLYEFDLHPT

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 5.75
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 5.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100098929 3300006358 Bacteria 2441
2 Ga0070683_100005889 3300005329 Bacteria 10254
3 Ga0070690_100209551 3300005330 Bacteria 1360
4 Ga0070677_10013012 3300005333 Bacteria 2901
5 Ga0070677_10038480 3300005333 Bacteria 1872
6 Ga0070677_10137379 3300005333 Bacteria 1123
7 Ga0068868_100457322 3300005338 Bacteria 1111
8 Ga0070660_100305538 3300005339 Bacteria 1305
9 Ga0070689_100438984 3300005340 Bacteria 1109
10 Ga0070661_100008936 3300005344 Bacteria 6934
11 Ga0070692_10077680 3300005345 Bacteria 1781
12 Ga0070669_100012986 3300005353 Bacteria 5914
13 Ga0070675_100056657 3300005354 Bacteria 3230
14 Ga0070675_100208471 3300005354 Bacteria 1698
15 Ga0070675_100599477 3300005354 Bacteria 999
16 Ga0070671_100021933 3300005355 Bacteria 5217
17 Ga0070674_100019909 3300005356 Bacteria 4274
18 Ga0070674_100026597 3300005356 Bacteria 3782
19 Ga0070674_100063119 3300005356 Bacteria 2591
20 Ga0070673_100100974 3300005364 Bacteria 2376
21 Ga0070688_100265555 3300005365 Bacteria 1227
22 Ga0070667_100049894 3300005367 Bacteria 3526
23 Ga0070667_100088372 3300005367 Bacteria 2661
24 Ga0070703_10006597 3300005406 Bacteria 3252
25 Ga0070709_10176592 3300005434 Bacteria 1497
26 Ga0070700_100169298 3300005441 Bacteria 1511
27 Ga0070694_100020247 3300005444 Bacteria 4239
28 Ga0070694_100085990 3300005444 Bacteria 2197
29 Ga0070708_100000430 3300005445 Bacteria 31264
30 Ga0070663_100009335 3300005455 Bacteria 6071
31 Ga0070678_100159132 3300005456 Bacteria 1828
32 Ga0070681_10131100 3300005458 Bacteria 2439
33 Ga0068867_100088997 3300005459 Bacteria 2341
34 Ga0070706_100073835 3300005467 Bacteria 3157
35 Ga0070707_100675991 3300005468 Bacteria 995
36 Ga0070679_100312092 3300005530 Unclassified 1522
37 Ga0070684_100000056 3300005535 Bacteria 74448
38 Ga0070697_100057331 3300005536 Bacteria 3169
39 Ga0070672_100048576 3300005543 Bacteria 3298
40 Ga0070672_100168410 3300005543 Bacteria 1821
41 Ga0070672_100558666 3300005543 Bacteria 994
42 Ga0070672_100607214 3300005543 Bacteria 953
43 Ga0070695_100000899 3300005545 Bacteria 16058
44 Ga0070693_100000150 3300005547 Bacteria 31809
45 Ga0070693_100012920 3300005547 Bacteria 4240
46 Ga0070665_100454154 3300005548 Unclassified 1291
47 Ga0070704_100000667 3300005549 Bacteria 16589
48 Ga0070664_100001255 3300005564 Bacteria 20310
49 Ga0070664_100495802 3300005564 Bacteria 1125
50 Ga0068857_100057459 3300005577 Bacteria 3453
51 Ga0068854_100188900 3300005578 Bacteria 1613
52 Ga0070702_100099441 3300005615 Bacteria 1781
53 Ga0068859_100022821 3300005617 Bacteria 6274
54 Ga0068859_100123550 3300005617 Bacteria 2656
55 Ga0068861_100351146 3300005719 Bacteria 1294
56 Ga0068870_10011449 3300005840 Bacteria 4113
57 Ga0068862_100035731 3300005844 Bacteria 4210
58 Ga0068862_100041708 3300005844 Bacteria 3906
59 Ga0068862_100072127 3300005844 Bacteria 2982
60 Ga0075365_10004624 3300006038 Bacteria 7324
61 Ga0075364_10142092 3300006051 Bacteria 1615
62 Ga0097621_100076201 3300006237 Bacteria 2782
63 Ga0068871_100003194 3300006358 Bacteria 11246
64 Ga0068871_100543282 3300006358 Bacteria 1052
65 Ga0075428_100039471 3300006844 Bacteria 5196
66 Ga0075428_100042048 3300006844 Bacteria 5026
67 Ga0075428_100592003 3300006844 Bacteria 1185
68 Ga0075431_100003038 3300006847 Bacteria 16230
69 Ga0075431_100668043 3300006847 Unclassified 1018
70 Ga0075434_100391761 3300006871 Bacteria 1410
71 Ga0075429_100008015 3300006880 Bacteria 9177
72 Ga0075429_100460356 3300006880 Unclassified 1114
73 Ga0068865_100125468 3300006881 Bacteria 1915
74 Ga0097620_100022822 3300006931 Bacteria 6274
75 Ga0097620_100123547 3300006931 Bacteria 2656
76 Ga0099794_10000715 3300007265 Bacteria 11151
77 Ga0111539_10005948 3300009094 Bacteria 15754
78 Ga0111539_10008461 3300009094 Bacteria 13084
79 Ga0111539_10045722 3300009094 Bacteria 5240
80 Ga0111539_10192346 3300009094 Unclassified 2380
81 Ga0111539_10195612 3300009094 Unclassified 2358
82 Ga0111539_10414726 3300009094 Bacteria 1568
83 Ga0111539_10488778 3300009094 Unclassified 1434
84 Ga0105245_10130041 3300009098 Bacteria 2361
85 Ga0114129_10944000 3300009147 Unclassified 1090
86 Ga0105242_10002202 3300009176 Bacteria 15375
87 Ga0105248_10031922 3300009177 Bacteria 5885
88 Ga0105248_10042133 3300009177 Bacteria 5120
89 Ga0105248_10047672 3300009177 Bacteria 4805
90 Ga0105248_10151231 3300009177 Bacteria 2619
91 Ga0105248_11128813 3300009177 Bacteria 886
92 Ga0105249_10307497 3300009553 Bacteria 1592
93 Ga0105249_10383831 3300009553 Bacteria 1431
94 Ga0105249_10980020 3300009553 Bacteria 914
95 Ga0157374_10089452 3300013296 Bacteria 2934
96 Ga0163162_10014862 3300013306 Bacteria 7602
97 Ga0163162_10015506 3300013306 Bacteria 7447
98 Ga0163162_10201109 3300013306 Bacteria 2121
99 Ga0163162_10381921 3300013306 Bacteria 1542
100 Ga0157375_10013378 3300013308 Bacteria 7298
101 Ga0157375_10264354 3300013308 Bacteria 1882
102 Ga0163163_10003233 3300014325 Bacteria 13819
103 Ga0157380_10003916 3300014326 Bacteria 10268
104 Ga0157380_10022614 3300014326 Bacteria 4738
105 Ga0157380_10063519 3300014326 Bacteria 2961
106 Ga0157380_10110561 3300014326 Bacteria 2308
107 Ga0157380_10185670 3300014326 Bacteria 1831
108 Ga0157380_10786959 3300014326 Bacteria 967
109 Ga0163161_10093704 3300017792 Bacteria 2225
110 Ga0163161_10245239 3300017792 Bacteria 1395
111 Ga0207697_10072410 3300025315 Bacteria 1445
112 Ga0207653_10002701 3300025885 Bacteria 5636
113 Ga0207682_10003871 3300025893 Bacteria 6408
114 Ga0207682_10056179 3300025893 Bacteria 1638
115 Ga0207688_10099525 3300025901 Bacteria 1677
116 Ga0207647_10309506 3300025904 Bacteria 898
117 Ga0207699_10046148 3300025906 Bacteria 2547
118 Ga0207645_10039594 3300025907 Bacteria 3020
119 Ga0207643_10002541 3300025908 Bacteria 9879
120 Ga0207684_10037718 3300025910 Bacteria 4101
121 Ga0207707_10119874 3300025912 Bacteria 2300
122 Ga0207663_10030706 3300025916 Bacteria 3172
123 Ga0207652_10030631 3300025921 Bacteria 4507
124 Ga0207681_10080583 3300025923 Bacteria 2296
125 Ga0207650_10014132 3300025925 Bacteria 5545
126 Ga0207659_10065829 3300025926 Bacteria 2627
127 Ga0207659_10157752 3300025926 Bacteria 1778
128 Ga0207659_10289938 3300025926 Bacteria 1341
129 Ga0207687_10084695 3300025927 Bacteria 2298
130 Ga0207644_10039793 3300025931 Bacteria 3320
131 Ga0207706_10027944 3300025933 Bacteria 5041
132 Ga0207706_10073833 3300025933 Bacteria 2999
133 Ga0207686_10009968 3300025934 Bacteria 5166
134 Ga0207669_10039873 3300025937 Bacteria 2719
135 Ga0207669_10057943 3300025937 Bacteria 2361
136 Ga0207704_10211673 3300025938 Bacteria 1427
137 Ga0207691_10006647 3300025940 Bacteria 11158
138 Ga0207691_10142669 3300025940 Bacteria 2109
139 Ga0207691_10197572 3300025940 Bacteria 1751
140 Ga0207691_10208930 3300025940 Bacteria 1696
141 Ga0207691_10515267 3300025940 Bacteria 1015
142 Ga0207711_10049330 3300025941 Bacteria 3604
143 Ga0207711_10132739 3300025941 Bacteria 2234
144 Ga0207711_10264751 3300025941 Bacteria 1581
145 Ga0207689_10017359 3300025942 Bacteria 6090
146 Ga0207679_10010056 3300025945 Bacteria 6079
147 Ga0207651_10205071 3300025960 Unclassified 1583
148 Ga0207712_10166422 3300025961 Bacteria 1719
149 Ga0207658_10022668 3300025986 Bacteria 4374
150 Ga0207658_10082045 3300025986 Bacteria 2475
151 Ga0207658_10110586 3300025986 Bacteria 2171
152 Ga0207677_10428327 3300026023 Bacteria 1129
153 Ga0207708_10099839 3300026075 Bacteria 2246
154 Ga0207648_10027872 3300026089 Bacteria 5011
155 Ga0207674_10132613 3300026116 Bacteria 2454
156 Ga0207675_100021665 3300026118 Bacteria 5983
157 Ga0207683_10032258 3300026121 Bacteria 4550
158 Ga0207683_10218477 3300026121 Bacteria 1736
159 Ga0207698_10553543 3300026142 Bacteria 1128
160 Ga0207428_10015389 3300027907 Bacteria 6618
161 Ga0207428_10078401 3300027907 Bacteria 2585
162 Ga0207428_10206577 3300027907 Bacteria 1477
163 Ga0207428_10357405 3300027907 Bacteria 1074
164 Ga0268266_10437099 3300028379 Unclassified 1242
165 Ga0268265_10041744 3300028380 Bacteria 3398
166 Ga0451853_1195341 3300041512 Bacteria 1607
167 Ga0439460_0014831 3300042461 Bacteria 2054
168 Ga0495603_0053838 3300046455 Bacteria 2387
169 Ga0495629_0000312 3300046459 Bacteria 41742
170 Ga0495653_0083557 3300046463 Bacteria 2354
171 Ga0495582_0016156 3300046473 Bacteria 4090
172 Ga0495639_0005824 3300046475 Bacteria 5304
173 Ga0495639_0036100 3300046475 Bacteria 2212
174 Ga0495662_0081454 3300046476 Bacteria 1574
175 Ga0495584_0157060 3300046491 Bacteria 1156
176 Ga0495630_0171713 3300046517 Bacteria 1652
177 Ga0495640_0057874 3300046533 Bacteria 2645
178 Ga0495645_0030505 3300046543 Bacteria 3926
179 Ga0495622_0064633 3300046557 Bacteria 1692
180 Ga0495634_0030786 3300046642 Bacteria 3702
181 Ga0495635_0000976 3300046663 Bacteria 18836
182 Ga0495635_0108739 3300046663 Bacteria 1894
183 Ga0495657_0188200 3300046675 Bacteria 1263
184 Ga0495658_0000006 3300046683 Bacteria 148671
185 Ga0495669_0103694 3300046684 Bacteria 1323
186 Ga0495581_0001422 3300047315 Bacteria 13278
187 Ga0495604_0152985 3300047317 Bacteria 1637
188 Ga0495676_0153908 3300047321 Bacteria 1633
189 Ga0495676_0326746 3300047321 Unclassified 1029
190 Ga0495680_0000127 3300047322 Bacteria 75095
191 Ga0495680_0080009 3300047322 Bacteria 2470
192 Ga0495684_0210635 3300047471 Bacteria 1429
193 Ga0495684_0370418 3300047471 Bacteria 1012
194 Ga0496104_0002582 3300048907 Bacteria 15623
195 Ga0496105_0011183 3300048908 Bacteria 7080
196 Ga0496107_0100472 3300048910 Bacteria 2121
197 Ga0496108_0025168 3300048911 Bacteria 4903
198 Ga0496109_0001332 3300048912 Bacteria 20385
199 Ga0496109_0170382 3300048912 Bacteria 2042
200 Ga0496110_0005699 3300048913 Bacteria 9779
201 Ga0496110_0017667 3300048913 Bacteria 5965
202 Ga0496110_0650767 3300048913 Bacteria 954
203 Ga0496111_0013329 3300048914 Bacteria 5591
204 Ga0496112_0001262 3300048915 Bacteria 19186
205 Ga0496113_0032791 3300048916 Bacteria 3776
206 Ga0496114_0041902 3300048917 Bacteria 3793
207 nmdc:mga0yw44_2529_c1 3300050492 Bacteria 7838
208 nmdc:mga05p37_14310_c1 3300050507 Bacteria 9525
209 nmdc:mga05p37_355204_c1 3300050507 Bacteria 1724
210 nmdc:mga05p37_433997_c1 3300050507 Bacteria 1525
211 nmdc:mga05p37_727110_c1 3300050507 Unclassified 1098
212 nmdc:mga09592_11400_c1 3300050508 Bacteria 7229
213 nmdc:mga09592_428710_c1 3300050508 Bacteria 1142
214 nmdc:mga0qj67_37644_c1 3300050509 Bacteria 3791
215 nmdc:mga06r32_204358_c1 3300050510 Unclassified 1963
216 nmdc:mga06r32_2564_c1 3300050510 Bacteria 16234
217 nmdc:mga06r32_27428_c1 3300050510 Bacteria 5320
218 nmdc:mga08y16_23925_c1 3300050511 Bacteria 6451
219 nmdc:mga08y16_428817_c1 3300050511 Bacteria 1351
220 nmdc:mga08y16_64292_c1 3300050511 Bacteria 3831
221 nmdc:mga08y16_92993_c1 3300050511 Bacteria 3142
222 nmdc:mga0n895_116307_c1 3300050512 Bacteria 2693
223 nmdc:mga0n895_220935_c1 3300050512 Bacteria 1923
224 Ga0495601_0003504 3300053077 Bacteria 9013
225 Ga0495595_0019514 3300053084 Bacteria 2942
226 Ga0495619_0001191 3300053085 Bacteria 17119
227 Ga0068871_100098929
228 Ga0070683_100005889
229 Ga0070690_100209551
230 Ga0070677_10013012
231 Ga0070677_10038480
232 Ga0070677_10137379
233 Ga0068868_100457322
234 Ga0070660_100305538
235 Ga0070689_100438984
236 Ga0070661_100008936
237 Ga0070692_10077680
238 Ga0070669_100012986
239 Ga0070675_100056657
240 Ga0070675_100208471
241 Ga0070675_100599477
242 Ga0070671_100021933
243 Ga0070674_100019909
244 Ga0070674_100026597
245 Ga0070674_100063119
246 Ga0070673_100100974
247 Ga0070688_100265555
248 Ga0070667_100049894
249 Ga0070667_100088372
250 Ga0070703_10006597
251 Ga0070709_10176592
252 Ga0070700_100169298
253 Ga0070694_100020247
254 Ga0070694_100085990
255 Ga0070708_100000430
256 Ga0070663_100009335
257 Ga0070678_100159132
258 Ga0070681_10131100
259 Ga0068867_100088997
260 Ga0070706_100073835
261 Ga0070707_100675991
262 Ga0070679_100312092
263 Ga0070684_100000056
264 Ga0070697_100057331
265 Ga0070672_100048576
266 Ga0070672_100168410
267 Ga0070672_100558666
268 Ga0070672_100607214
269 Ga0070695_100000899
270 Ga0070693_100000150
271 Ga0070693_100012920
272 Ga0070665_100454154
273 Ga0070704_100000667
274 Ga0070664_100001255
275 Ga0070664_100495802
276 Ga0068857_100057459
277 Ga0068854_100188900
278 Ga0070702_100099441
279 Ga0068859_100022821
280 Ga0068859_100123550
281 Ga0068861_100351146
282 Ga0068870_10011449
283 Ga0068862_100035731
284 Ga0068862_100041708
285 Ga0068862_100072127
286 Ga0075365_10004624
287 Ga0075364_10142092
288 Ga0097621_100076201
289 Ga0068871_100003194
290 Ga0068871_100543282
291 Ga0075428_100039471
292 Ga0075428_100042048
293 Ga0075428_100592003
294 Ga0075431_100003038
295 Ga0075431_100668043
296 Ga0075434_100391761
297 Ga0075429_100008015
298 Ga0075429_100460356
299 Ga0068865_100125468
300 Ga0097620_100022822
301 Ga0097620_100123547
302 Ga0099794_10000715
303 Ga0111539_10005948
304 Ga0111539_10008461
305 Ga0111539_10045722
306 Ga0111539_10192346
307 Ga0111539_10195612
308 Ga0111539_10414726
309 Ga0111539_10488778
310 Ga0105245_10130041
311 Ga0114129_10944000
312 Ga0105242_10002202
313 Ga0105248_10031922
314 Ga0105248_10042133
315 Ga0105248_10047672
316 Ga0105248_10151231
317 Ga0105248_11128813
318 Ga0105249_10307497
319 Ga0105249_10383831
320 Ga0105249_10980020
321 Ga0157374_10089452
322 Ga0163162_10014862
323 Ga0163162_10015506
324 Ga0163162_10201109
325 Ga0163162_10381921
326 Ga0157375_10013378
327 Ga0157375_10264354
328 Ga0163163_10003233
329 Ga0157380_10003916
330 Ga0157380_10022614
331 Ga0157380_10063519
332 Ga0157380_10110561
333 Ga0157380_10185670
334 Ga0157380_10786959
335 Ga0163161_10093704
336 Ga0163161_10245239
337 Ga0207697_10072410
338 Ga0207653_10002701
339 Ga0207682_10003871
340 Ga0207682_10056179
341 Ga0207688_10099525
342 Ga0207647_10309506
343 Ga0207699_10046148
344 Ga0207645_10039594
345 Ga0207643_10002541
346 Ga0207684_10037718
347 Ga0207707_10119874
348 Ga0207663_10030706
349 Ga0207652_10030631
350 Ga0207681_10080583
351 Ga0207650_10014132
352 Ga0207659_10065829
353 Ga0207659_10157752
354 Ga0207659_10289938
355 Ga0207687_10084695
356 Ga0207644_10039793
357 Ga0207706_10027944
358 Ga0207706_10073833
359 Ga0207686_10009968
360 Ga0207669_10039873
361 Ga0207669_10057943
362 Ga0207704_10211673
363 Ga0207691_10006647
364 Ga0207691_10142669
365 Ga0207691_10197572
366 Ga0207691_10208930
367 Ga0207691_10515267
368 Ga0207711_10049330
369 Ga0207711_10132739
370 Ga0207711_10264751
371 Ga0207689_10017359
372 Ga0207679_10010056
373 Ga0207651_10205071
374 Ga0207712_10166422
375 Ga0207658_10022668
376 Ga0207658_10082045
377 Ga0207658_10110586
378 Ga0207677_10428327
379 Ga0207708_10099839
380 Ga0207648_10027872
381 Ga0207674_10132613
382 Ga0207675_100021665
383 Ga0207683_10032258
384 Ga0207683_10218477
385 Ga0207698_10553543
386 Ga0207428_10015389
387 Ga0207428_10078401
388 Ga0207428_10206577
389 Ga0207428_10357405
390 Ga0268266_10437099
391 Ga0268265_10041744
392 Ga0451853_1195341
393 Ga0439460_0014831
394 Ga0495603_0053838
395 Ga0495629_0000312
396 Ga0495653_0083557
397 Ga0495582_0016156
398 Ga0495639_0005824
399 Ga0495639_0036100
400 Ga0495662_0081454
401 Ga0495584_0157060
402 Ga0495630_0171713
403 Ga0495640_0057874
404 Ga0495645_0030505
405 Ga0495622_0064633
406 Ga0495634_0030786
407 Ga0495635_0000976
408 Ga0495635_0108739
409 Ga0495657_0188200
410 Ga0495658_0000006
411 Ga0495669_0103694
412 Ga0495581_0001422
413 Ga0495604_0152985
414 Ga0495676_0153908
415 Ga0495676_0326746
416 Ga0495680_0000127
417 Ga0495680_0080009
418 Ga0495684_0210635
419 Ga0495684_0370418
420 Ga0496104_0002582
421 Ga0496105_0011183
422 Ga0496107_0100472
423 Ga0496108_0025168
424 Ga0496109_0001332
425 Ga0496109_0170382
426 Ga0496110_0005699
427 Ga0496110_0017667
428 Ga0496110_0650767
429 Ga0496111_0013329
430 Ga0496112_0001262
431 Ga0496113_0032791
432 Ga0496114_0041902
433 nmdc:mga0yw44_2529_c1
434 nmdc:mga05p37_14310_c1
435 nmdc:mga05p37_355204_c1
436 nmdc:mga05p37_433997_c1
437 nmdc:mga05p37_727110_c1
438 nmdc:mga09592_11400_c1
439 nmdc:mga09592_428710_c1
440 nmdc:mga0qj67_37644_c1
441 nmdc:mga06r32_204358_c1
442 nmdc:mga06r32_2564_c1
443 nmdc:mga06r32_27428_c1
444 nmdc:mga08y16_23925_c1
445 nmdc:mga08y16_428817_c1
446 nmdc:mga08y16_64292_c1
447 nmdc:mga08y16_92993_c1
448 nmdc:mga0n895_116307_c1
449 nmdc:mga0n895_220935_c1
450 Ga0495601_0003504
451 Ga0495595_0019514
452 Ga0495619_0001191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04216

FdhE

Protein involved in formate dehydrogenase formation

6

275

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiy-assembly2.cif.gz_B the crystal structure of the fdhe protein from pseudomonas aeruginosa 0.6577 5 273
2fiy-assembly1.cif.gz_A the crystal structure of the fdhe protein from pseudomonas aeruginosa 0.6516 5 272
2fiy-assembly1.cif.gz_A the crystal structure of the fdhe protein from pseudomonas aeruginosa 0.6256 5 272
2fiy-assembly2.cif.gz_B the crystal structure of the fdhe protein from pseudomonas aeruginosa 0.6242 5 273
5t2a-assembly1.cif.gz_n cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.5497 165 191
ID Description Score Start End Superfamily
af_A0A0R0G8Q4_69_273_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.6836 206 235 3.40.50.1110
2fiyB00 Alpha Beta;Alpha-Beta Complex;FdhE-like fold;FdhE-like domain 0.6577 5 273 3.90.1670.10
af_P13024_23_308_3.90.1670.10 Alpha Beta;Alpha-Beta Complex;FdhE-like fold;FdhE-like domain 0.6502 62 267 3.90.1670.10
2fiyB00 Alpha Beta;Alpha-Beta Complex;FdhE-like fold;FdhE-like domain 0.6242 5 273 3.90.1670.10
af_Q4DQ60_1_79_3.30.720.90 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.5296 165 192 3.30.720.90
ID Description Score Start End GO Terms
AF-A0A2V9VJV5-F1-model_v4 Formate dehydrogenase accessory protein FdhE 0.9442 1 270 GO:0005829
GO:0008199
GO:0051604
AF-A0A2V9VJV5-F1-model_v4 Formate dehydrogenase accessory protein FdhE 0.9375 1 270 GO:0005829
GO:0008199
GO:0051604
AF-Q1IUI9-F1-model_v4 Uncharacterized protein involved in formate dehydrogenase formation 0.9335 2 275 GO:0005829
GO:0008199
GO:0051604
AF-A0A7I9VPG6-F1-model_v4 Formate dehydrogenase accessory protein FdhE 0.9335 3 270 GO:0005829
GO:0008199
GO:0051604
AF-Q1IUI9-F1-model_v4 Uncharacterized protein involved in formate dehydrogenase formation 0.9238 2 275 GO:0005829
GO:0008199
GO:0051604

Map