F338519

General Info

Members Datasets Scaffolds Average Seq Length
226 136 452 316

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100031856|Ga0068869_1000318564
Length 365
Sequence VSSLRALLARCGVNTLRALLLCTFLLGITASAQPPPDEPAAGETADAPAWNFGDEEEEAAPTLLEHVREQALDIALFVVFATLVMVSFLRKNVALKYVTLVFAVVYMGRMKAYMLSVVNVFGVLGGGVSAASIGLPGGEPATAAGIGGALTSSLPPFAFSLAWYTFAVFAVVTTIIWGRVYCGRVCAFGALTQLMDAVFPKRFQIEIPAKLEARASYIKYGILFGAIALYFVTKEITFYRYIEPFWLFTLDATPVLWVMVGVLLVASLFVRNLYCRFLCPLGAALGLISKATTVLPIKRWSECSQCALCEKTCEWGAIRKRQIVKAECVRCDDCEILYDDKQRCPHWLLELKRKARAAMRPGTAA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0.88
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 18.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100031856 3300005334 Bacteria 3712
2 Ga0065712_10000219 3300005290 Bacteria 22736
3 Ga0065707_10001161 3300005295 Bacteria 9448
4 Ga0070683_100118725 3300005329 Bacteria 2498
5 Ga0070690_100000704 3300005330 Bacteria 17143
6 Ga0070690_100066443 3300005330 Bacteria 2334
7 Ga0070670_100028574 3300005331 Bacteria 4799
8 Ga0070666_10031169 3300005335 Unclassified 3519
9 Ga0070666_10046918 3300005335 Bacteria 2899
10 Ga0070680_100081673 3300005336 Bacteria 2667
11 Ga0068868_100002337 3300005338 Bacteria 13121
12 Ga0070687_100037768 3300005343 Unclassified 2416
13 Ga0070661_100073524 3300005344 Bacteria 2517
14 Ga0070692_10196120 3300005345 Bacteria 1180
15 Ga0070675_100008315 3300005354 Bacteria 8052
16 Ga0070675_100277979 3300005354 Bacteria 1471
17 Ga0070675_100297974 3300005354 Bacteria 1420
18 Ga0070675_100318858 3300005354 Unclassified 1373
19 Ga0070671_100012169 3300005355 Bacteria 6924
20 Ga0070671_100071565 3300005355 Bacteria 2894
21 Ga0070674_100372860 3300005356 Bacteria 1159
22 Ga0070673_100004933 3300005364 Bacteria 8498
23 Ga0070673_100044384 3300005364 Bacteria 3442
24 Ga0070688_100025937 3300005365 Unclassified 3476
25 Ga0070667_100015071 3300005367 Bacteria 6387
26 Ga0070667_100026563 3300005367 Unclassified 4817
27 Ga0070701_10001323 3300005438 Bacteria 9125
28 Ga0070705_100043854 3300005440 Bacteria 2566
29 Ga0070700_100110248 3300005441 Bacteria 1829
30 Ga0070662_100140263 3300005457 Bacteria 1872
31 Ga0070685_10065109 3300005466 Bacteria 2145
32 Ga0070707_100038723 3300005468 Bacteria 4554
33 Ga0070672_100004343 3300005543 Bacteria 9276
34 Ga0070686_100075034 3300005544 Bacteria 2224
35 Ga0070695_100430415 3300005545 Bacteria 1007
36 Ga0070696_100010716 3300005546 Bacteria 6141
37 Ga0070665_100006027 3300005548 Bacteria 12385
38 Ga0070664_100002733 3300005564 Bacteria 14242
39 Ga0070664_100243307 3300005564 Bacteria 1615
40 Ga0070664_100303934 3300005564 Bacteria 1442
41 Ga0068856_100111913 3300005614 Bacteria 2727
42 Ga0068859_100031035 3300005617 Bacteria 5364
43 Ga0068864_100001431 3300005618 Bacteria 19685
44 Ga0068864_100003859 3300005618 Bacteria 12346
45 Ga0068861_100005207 3300005719 Bacteria 8764
46 Ga0068870_10128619 3300005840 Bacteria 1468
47 Ga0068863_100009130 3300005841 Bacteria 9683
48 Ga0068863_100023319 3300005841 Bacteria 5913
49 Ga0068863_100058418 3300005841 Bacteria 3650
50 Ga0068858_100004337 3300005842 Bacteria 13921
51 Ga0068858_100008702 3300005842 Bacteria 9746
52 Ga0068860_100073653 3300005843 Bacteria 3247
53 Ga0068862_100010867 3300005844 Bacteria 7517
54 Ga0097621_100067186 3300006237 Bacteria 2954
55 Ga0068871_100049787 3300006358 Bacteria 3387
56 Ga0068871_100084385 3300006358 Unclassified 2636
57 Ga0068871_100187946 3300006358 Unclassified 1778
58 Ga0075428_100005316 3300006844 Bacteria 14310
59 Ga0075428_100016923 3300006844 Bacteria 8052
60 Ga0075428_100088858 3300006844 Bacteria 3370
61 Ga0075430_100020534 3300006846 Bacteria 5619
62 Ga0075430_100025128 3300006846 Bacteria 5066
63 Ga0075431_100005750 3300006847 Bacteria 12257
64 Ga0075431_100436773 3300006847 Bacteria 1306
65 Ga0075433_10006742 3300006852 Bacteria 9099
66 Ga0075433_10019148 3300006852 Bacteria 5695
67 Ga0075433_10039268 3300006852 Bacteria 4091
68 Ga0075433_10064965 3300006852 Bacteria 3200
69 Ga0075434_100007785 3300006871 Bacteria 9919
70 Ga0075434_100009838 3300006871 Bacteria 8941
71 Ga0075434_100017569 3300006871 Bacteria 6894
72 Ga0075434_100244192 3300006871 Bacteria 1815
73 Ga0075434_100352021 3300006871 Bacteria 1494
74 Ga0075434_100439237 3300006871 Unclassified 1326
75 Ga0097620_100031035 3300006931 Bacteria 5364
76 Ga0075435_100259538 3300007076 Unclassified 1480
77 Ga0099794_10072769 3300007265 Bacteria 1685
78 Ga0111539_10010303 3300009094 Bacteria 11767
79 Ga0111539_10025746 3300009094 Bacteria 7205
80 Ga0111539_10037576 3300009094 Bacteria 5846
81 Ga0111539_10052944 3300009094 Bacteria 4831
82 Ga0111539_10142632 3300009094 Bacteria 2804
83 Ga0111539_10144214 3300009094 Bacteria 2788
84 Ga0111539_10671590 3300009094 Bacteria 1206
85 Ga0105245_10004146 3300009098 Bacteria 12875
86 Ga0114129_10001413 3300009147 Bacteria 32335
87 Ga0114129_10004137 3300009147 Bacteria 20495
88 Ga0114129_10101493 3300009147 Unclassified 3980
89 Ga0114129_10625057 3300009147 Unclassified 1393
90 Ga0114129_10693885 3300009147 Bacteria 1309
91 Ga0105243_10013064 3300009148 Bacteria 6274
92 Ga0105243_10230027 3300009148 Bacteria 1644
93 Ga0105248_10011171 3300009177 Bacteria 9906
94 Ga0105248_10338800 3300009177 Bacteria 1693
95 Ga0105248_10572050 3300009177 Bacteria 1275
96 Ga0105249_10409838 3300009553 Bacteria 1387
97 Ga0105239_10085799 3300010375 Bacteria 3470
98 Ga0105246_10226477 3300011119 Bacteria 1469
99 Ga0157374_10000620 3300013296 Bacteria 31251
100 Ga0157374_10047735 3300013296 Unclassified 3971
101 Ga0163162_10004274 3300013306 Bacteria 13742
102 Ga0157375_10001153 3300013308 Bacteria 22834
103 Ga0157375_10003515 3300013308 Bacteria 13591
104 Ga0157375_10036596 3300013308 Bacteria 4697
105 Ga0157375_10082354 3300013308 Bacteria 3260
106 Ga0163163_10017721 3300014325 Bacteria 6648
107 Ga0157380_10012848 3300014326 Bacteria 6084
108 Ga0157380_10015553 3300014326 Bacteria 5594
109 Ga0157380_10079166 3300014326 Bacteria 2683
110 Ga0157380_10232182 3300014326 Bacteria 1658
111 Ga0157380_10582188 3300014326 Bacteria 1104
112 Ga0157377_10038544 3300014745 Unclassified 2639
113 Ga0157376_10022090 3300014969 Bacteria 4952
114 Ga0157376_10237503 3300014969 Unclassified 1696
115 Ga0157376_10285115 3300014969 Bacteria 1557
116 Ga0207680_10006798 3300025903 Bacteria 5551
117 Ga0207646_10042228 3300025922 Bacteria 4098
118 Ga0207681_10231981 3300025923 Bacteria 1433
119 Ga0207650_10002816 3300025925 Bacteria 12011
120 Ga0207659_10107200 3300025926 Bacteria 2117
121 Ga0207644_10008979 3300025931 Bacteria 6549
122 Ga0207644_10089920 3300025931 Bacteria 2286
123 Ga0207706_10176260 3300025933 Bacteria 1878
124 Ga0207704_10178951 3300025938 Bacteria 1530
125 Ga0207691_10045946 3300025940 Unclassified 4014
126 Ga0207689_10167488 3300025942 Bacteria 1810
127 Ga0207689_10287330 3300025942 Bacteria 1362
128 Ga0207689_10287854 3300025942 Bacteria 1361
129 Ga0207661_10149649 3300025944 Bacteria 2017
130 Ga0207679_10006537 3300025945 Bacteria 7367
131 Ga0207679_10377077 3300025945 Unclassified 1243
132 Ga0207651_10011652 3300025960 Unclassified 4932
133 Ga0207712_10015603 3300025961 Bacteria 4905
134 Ga0207658_10023795 3300025986 Unclassified 4279
135 Ga0207677_10013571 3300026023 Unclassified 4727
136 Ga0207703_10207553 3300026035 Bacteria 1744
137 Ga0207708_10014427 3300026075 Bacteria 5915
138 Ga0207708_10128463 3300026075 Bacteria 1980
139 Ga0207641_10010560 3300026088 Bacteria 7577
140 Ga0207641_10027107 3300026088 Unclassified 4732
141 Ga0207641_10288770 3300026088 Bacteria 1545
142 Ga0207676_10008059 3300026095 Bacteria 7489
143 Ga0207676_10046478 3300026095 Bacteria 3359
144 Ga0207675_100009267 3300026118 Bacteria 9231
145 Ga0207698_10010454 3300026142 Bacteria 5964
146 Ga0207428_10000344 3300027907 Bacteria 60501
147 Ga0207428_10057369 3300027907 Bacteria 3091
148 Ga0268265_10039818 3300028380 Bacteria 3466
149 Ga0307413_10028333 3300031824 Bacteria 3118
150 Ga0307409_100062575 3300031995 Bacteria 2914
151 Ga0307409_100188877 3300031995 Bacteria 1832
152 Ga0373948_0022204 3300034817 Bacteria 1222
153 Ga0373962_0027026 3300035242 Bacteria 1550
154 Ga0373933_0025067 3300035724 Bacteria 3418
155 Ga0373933_0081150 3300035724 Bacteria 1989
156 Ga0373937_0093331 3300036401 Bacteria 2790
157 Ga0373937_0107191 3300036401 Bacteria 2598
158 Ga0373937_0128980 3300036401 Unclassified 2361
159 Ga0373937_0296225 3300036401 Bacteria 1529
160 Ga0451576_0072072 3300045051 Bacteria 3595
161 Ga0495592_0050115 3300046454 Unclassified 3103
162 Ga0495629_0040461 3300046459 Bacteria 3279
163 Ga0495662_0125632 3300046476 Bacteria 1260
164 Ga0495608_0108264 3300046511 Unclassified 1787
165 Ga0495652_0104340 3300046529 Unclassified 2293
166 Ga0495667_0001971 3300046559 Bacteria 13590
167 Ga0495657_0346564 3300046675 Unclassified 879
168 Ga0495647_0014478 3300046681 Bacteria 2749
169 Ga0495658_0156576 3300046683 Bacteria 1402
170 Ga0495613_0172147 3300046689 Bacteria 1536
171 Ga0495674_0012899 3300047319 Bacteria 7870
172 Ga0495674_0079774 3300047319 Bacteria 2810
173 Ga0495675_0030524 3300047444 Bacteria 3439
174 Ga0496109_0062345 3300048912 Bacteria 3409
175 Ga0496114_0004458 3300048917 Bacteria 10865
176 Ga0501039_0137735 3300049575 Bacteria 1917
177 Ga0501040_0023982 3300049576 Unclassified 4093
178 Ga0501040_0209156 3300049576 Bacteria 1387
179 Ga0501041_0209680 3300049577 Bacteria 1222
180 Ga0501042_0036007 3300049578 Unclassified 3511
181 Ga0501048_0184010 3300049582 Unclassified 1481
182 Ga0501071_0055450 3300049587 Bacteria 2861
183 Ga0501073_0009712 3300049589 Bacteria 7088
184 Ga0501075_0034004 3300049591 Unclassified 3794
185 Ga0501075_0144509 3300049591 Unclassified 1813
186 Ga0501075_0150670 3300049591 Bacteria 1773
187 Ga0501076_0097742 3300049592 Bacteria 2365
188 Ga0501076_0210024 3300049592 Bacteria 1590
189 Ga0501080_0250808 3300049742 Unclassified 1614
190 Ga0501081_0030422 3300049743 Bacteria 3654
191 Ga0501045_0043539 3300049824 Unclassified 3269
192 nmdc:mga0yw44_169590_c1 3300050492 Bacteria 1432
193 nmdc:mga05p37_367698_c1 3300050507 Unclassified 1689
194 nmdc:mga05p37_502334_c1 3300050507 Unclassified 1391
195 nmdc:mga05p37_64152_c1 3300050507 Unclassified 4520
196 nmdc:mga05p37_668093_c1 3300050507 Unclassified 1160
197 nmdc:mga05p37_86993_c1 3300050507 Unclassified 3852
198 nmdc:mga0qj67_135455_c1 3300050509 Bacteria 1996
199 nmdc:mga0qj67_138996_c1 3300050509 Unclassified 1969
200 nmdc:mga0qj67_161642_c1 3300050509 Bacteria 1818
201 nmdc:mga0qj67_18946_c1 3300050509 Bacteria 5252
202 nmdc:mga06r32_20188_c1 3300050510 Bacteria 6130
203 nmdc:mga08y16_10515_c1 3300050511 Bacteria 9709
204 nmdc:mga08y16_150222_c1 3300050511 Bacteria 2422
205 nmdc:mga08y16_23424_c1 3300050511 Bacteria 6523
206 nmdc:mga08y16_35954_c1 3300050511 Bacteria 5202
207 nmdc:mga08y16_463149_c1 3300050511 Bacteria 1292
208 nmdc:mga0n895_113164_c1 3300050512 Bacteria 2731
209 nmdc:mga0n895_6536_c1 3300050512 Bacteria 9921
210 nmdc:mga0n895_75993_c1 3300050512 Bacteria 3340
211 nmdc:mga0n895_89450_c1 3300050512 Unclassified 3080
212 nmdc:mga0rr50_275842_c1 3300050513 Bacteria 1402
213 nmdc:mga0rr50_6549_c1 3300050513 Bacteria 7106
214 nmdc:mga0a205_118078_c1 3300050515 Bacteria 2551
215 nmdc:mga0a205_15602_c1 3300050515 Bacteria 7100
216 nmdc:mga0a205_91073_c1 3300050515 Bacteria 2946
217 nmdc:mga0a205_926_c1 3300050515 Bacteria 24210
218 Ga0495601_0129780 3300053077 Unclassified 1641
219 Ga0495619_0105579 3300053085 Unclassified 1920
220 Ga0500646_0023999 3300053090 Bacteria 1640
221 Ga0500641_0051986 3300053096 Bacteria 1687
222 Ga0501084_0010667 3300054114 Bacteria 7606
223 Ga0501084_0110129 3300054114 Bacteria 2314
224 Ga0590075_027321 3300059424 Bacteria 1439
225 Ga0590075_046655 3300059424 Bacteria 1110
226 Ga0501082_0213070 3300060353 Bacteria 1680
227 Ga0068869_100031856
228 Ga0065712_10000219
229 Ga0065707_10001161
230 Ga0070683_100118725
231 Ga0070690_100000704
232 Ga0070690_100066443
233 Ga0070670_100028574
234 Ga0070666_10031169
235 Ga0070666_10046918
236 Ga0070680_100081673
237 Ga0068868_100002337
238 Ga0070687_100037768
239 Ga0070661_100073524
240 Ga0070692_10196120
241 Ga0070675_100008315
242 Ga0070675_100277979
243 Ga0070675_100297974
244 Ga0070675_100318858
245 Ga0070671_100012169
246 Ga0070671_100071565
247 Ga0070674_100372860
248 Ga0070673_100004933
249 Ga0070673_100044384
250 Ga0070688_100025937
251 Ga0070667_100015071
252 Ga0070667_100026563
253 Ga0070701_10001323
254 Ga0070705_100043854
255 Ga0070700_100110248
256 Ga0070662_100140263
257 Ga0070685_10065109
258 Ga0070707_100038723
259 Ga0070672_100004343
260 Ga0070686_100075034
261 Ga0070695_100430415
262 Ga0070696_100010716
263 Ga0070665_100006027
264 Ga0070664_100002733
265 Ga0070664_100243307
266 Ga0070664_100303934
267 Ga0068856_100111913
268 Ga0068859_100031035
269 Ga0068864_100001431
270 Ga0068864_100003859
271 Ga0068861_100005207
272 Ga0068870_10128619
273 Ga0068863_100009130
274 Ga0068863_100023319
275 Ga0068863_100058418
276 Ga0068858_100004337
277 Ga0068858_100008702
278 Ga0068860_100073653
279 Ga0068862_100010867
280 Ga0097621_100067186
281 Ga0068871_100049787
282 Ga0068871_100084385
283 Ga0068871_100187946
284 Ga0075428_100005316
285 Ga0075428_100016923
286 Ga0075428_100088858
287 Ga0075430_100020534
288 Ga0075430_100025128
289 Ga0075431_100005750
290 Ga0075431_100436773
291 Ga0075433_10006742
292 Ga0075433_10019148
293 Ga0075433_10039268
294 Ga0075433_10064965
295 Ga0075434_100007785
296 Ga0075434_100009838
297 Ga0075434_100017569
298 Ga0075434_100244192
299 Ga0075434_100352021
300 Ga0075434_100439237
301 Ga0097620_100031035
302 Ga0075435_100259538
303 Ga0099794_10072769
304 Ga0111539_10010303
305 Ga0111539_10025746
306 Ga0111539_10037576
307 Ga0111539_10052944
308 Ga0111539_10142632
309 Ga0111539_10144214
310 Ga0111539_10671590
311 Ga0105245_10004146
312 Ga0114129_10001413
313 Ga0114129_10004137
314 Ga0114129_10101493
315 Ga0114129_10625057
316 Ga0114129_10693885
317 Ga0105243_10013064
318 Ga0105243_10230027
319 Ga0105248_10011171
320 Ga0105248_10338800
321 Ga0105248_10572050
322 Ga0105249_10409838
323 Ga0105239_10085799
324 Ga0105246_10226477
325 Ga0157374_10000620
326 Ga0157374_10047735
327 Ga0163162_10004274
328 Ga0157375_10001153
329 Ga0157375_10003515
330 Ga0157375_10036596
331 Ga0157375_10082354
332 Ga0163163_10017721
333 Ga0157380_10012848
334 Ga0157380_10015553
335 Ga0157380_10079166
336 Ga0157380_10232182
337 Ga0157380_10582188
338 Ga0157377_10038544
339 Ga0157376_10022090
340 Ga0157376_10237503
341 Ga0157376_10285115
342 Ga0207680_10006798
343 Ga0207646_10042228
344 Ga0207681_10231981
345 Ga0207650_10002816
346 Ga0207659_10107200
347 Ga0207644_10008979
348 Ga0207644_10089920
349 Ga0207706_10176260
350 Ga0207704_10178951
351 Ga0207691_10045946
352 Ga0207689_10167488
353 Ga0207689_10287330
354 Ga0207689_10287854
355 Ga0207661_10149649
356 Ga0207679_10006537
357 Ga0207679_10377077
358 Ga0207651_10011652
359 Ga0207712_10015603
360 Ga0207658_10023795
361 Ga0207677_10013571
362 Ga0207703_10207553
363 Ga0207708_10014427
364 Ga0207708_10128463
365 Ga0207641_10010560
366 Ga0207641_10027107
367 Ga0207641_10288770
368 Ga0207676_10008059
369 Ga0207676_10046478
370 Ga0207675_100009267
371 Ga0207698_10010454
372 Ga0207428_10000344
373 Ga0207428_10057369
374 Ga0268265_10039818
375 Ga0307413_10028333
376 Ga0307409_100062575
377 Ga0307409_100188877
378 Ga0373948_0022204
379 Ga0373962_0027026
380 Ga0373933_0025067
381 Ga0373933_0081150
382 Ga0373937_0093331
383 Ga0373937_0107191
384 Ga0373937_0128980
385 Ga0373937_0296225
386 Ga0451576_0072072
387 Ga0495592_0050115
388 Ga0495629_0040461
389 Ga0495662_0125632
390 Ga0495608_0108264
391 Ga0495652_0104340
392 Ga0495667_0001971
393 Ga0495657_0346564
394 Ga0495647_0014478
395 Ga0495658_0156576
396 Ga0495613_0172147
397 Ga0495674_0012899
398 Ga0495674_0079774
399 Ga0495675_0030524
400 Ga0496109_0062345
401 Ga0496114_0004458
402 Ga0501039_0137735
403 Ga0501040_0023982
404 Ga0501040_0209156
405 Ga0501041_0209680
406 Ga0501042_0036007
407 Ga0501048_0184010
408 Ga0501071_0055450
409 Ga0501073_0009712
410 Ga0501075_0034004
411 Ga0501075_0144509
412 Ga0501075_0150670
413 Ga0501076_0097742
414 Ga0501076_0210024
415 Ga0501080_0250808
416 Ga0501081_0030422
417 Ga0501045_0043539
418 nmdc:mga0yw44_169590_c1
419 nmdc:mga05p37_367698_c1
420 nmdc:mga05p37_502334_c1
421 nmdc:mga05p37_64152_c1
422 nmdc:mga05p37_668093_c1
423 nmdc:mga05p37_86993_c1
424 nmdc:mga0qj67_135455_c1
425 nmdc:mga0qj67_138996_c1
426 nmdc:mga0qj67_161642_c1
427 nmdc:mga0qj67_18946_c1
428 nmdc:mga06r32_20188_c1
429 nmdc:mga08y16_10515_c1
430 nmdc:mga08y16_150222_c1
431 nmdc:mga08y16_23424_c1
432 nmdc:mga08y16_35954_c1
433 nmdc:mga08y16_463149_c1
434 nmdc:mga0n895_113164_c1
435 nmdc:mga0n895_6536_c1
436 nmdc:mga0n895_75993_c1
437 nmdc:mga0n895_89450_c1
438 nmdc:mga0rr50_275842_c1
439 nmdc:mga0rr50_6549_c1
440 nmdc:mga0a205_118078_c1
441 nmdc:mga0a205_15602_c1
442 nmdc:mga0a205_91073_c1
443 nmdc:mga0a205_926_c1
444 Ga0495601_0129780
445 Ga0495619_0105579
446 Ga0500646_0023999
447 Ga0500641_0051986
448 Ga0501084_0010667
449 Ga0501084_0110129
450 Ga0590075_027321
451 Ga0590075_046655
452 Ga0501082_0213070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12801

Fer4_5

4Fe-4S binding domain

159

206

0.94

PF12801

Fer4_5

4Fe-4S binding domain

252

300

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h1d-assembly1.cif.gz_A solid-state nmr structure of aquaporin z in its native cellular membranes 0.2355 21 220
8h1d-assembly1.cif.gz_A solid-state nmr structure of aquaporin z in its native cellular membranes 0.2108 21 220
4q4j-assembly1.cif.gz_A structure of crosslinked tm287/288_s498c_s520c mutant 0.2044 14 237
6ibl-assembly1.cif.gz_A activated turkey beta1 adrenoceptor with bound agonist formoterol and nanobody nb80 0.19 5 300
7b9s-assembly1.cif.gz_3 structure of the mycobacterial esx-5 type vii secretion system hexameric pore complex 0.1797 1 300
ID Description Score Start End Superfamily
af_A0A0R0ELR6_50_178_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3268 22 131 1.20.1250.20
af_A0A0R0ELR6_50_178_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2905 22 131 1.20.1250.20
af_Q9V420_246_403_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.2524 28 127 1.20.1050.10
af_X1WGH4_5_294_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2331 15 221 1.20.1070.10
af_Q10Q78_35_162_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2263 26 125 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7X7QZ71-F1-model_v4 4Fe-4S binding protein 0.906 22 221 GO:0010181
GO:0016020
AF-A0A382TRZ0-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.898 14 239 GO:0005886
AF-A0A5R9R4M9-F1-model_v4 deleted 0.8863 28 221
AF-A0A7Y4C410-F1-model_v4 FMN-binding protein 0.8796 27 221 GO:0010181
GO:0016020
AF-A0A4R4CVZ0-F1-model_v4 Transcriptional regulator 0.8764 25 221 GO:0005886
GO:0009055
GO:0010181
GO:0022900

Map