F338050

General Info

Members Datasets Scaffolds Average Seq Length
225 140 450 145

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0118692|Ga0451577_0118692_567_1079
Length 170
Sequence VTSPFVGLSAFCGGCILPPIPQGECSMSDAPQSFANHSRVVPMFHYGASALLVGSLLLSTYQLIRQFSAASLLGLFLTLALAIVYWYSRVFPLTVQDRIIRLEESLRIERLCPELRGRSGEFTVGQLVSLRFASDEELPALARRVLDEKIVSRSEIKKAIRNWRPDHLRA

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 1.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0118692 3300042876 Bacteria 2369
2 rootL2_10117095 3300003322 Bacteria 1749
3 rootL2_10257836 3300003322 Unclassified 2010
4 Ga0070658_10009381 3300005327 Bacteria 7863
5 Ga0070676_10006427 3300005328 Bacteria 6279
6 Ga0070676_10011388 3300005328 Bacteria 4837
7 Ga0070683_101540495 3300005329 Unclassified 639
8 Ga0070690_100120794 3300005330 Bacteria 1758
9 Ga0068869_100729807 3300005334 Bacteria 847
10 Ga0070666_10006162 3300005335 Bacteria 7374
11 Ga0070680_100764227 3300005336 Unclassified 832
12 Ga0070660_100008640 3300005339 Bacteria 7133
13 Ga0070660_100288291 3300005339 Bacteria 1344
14 Ga0070660_101159402 3300005339 Unclassified 655
15 Ga0070689_100637063 3300005340 Unclassified 926
16 Ga0070691_10000759 3300005341 Bacteria 12767
17 Ga0070661_100055181 3300005344 Unclassified 2910
18 Ga0070661_100058056 3300005344 Bacteria 2836
19 Ga0070692_10020702 3300005345 Bacteria 3191
20 Ga0070668_100122229 3300005347 Bacteria 2082
21 Ga0070668_100766887 3300005347 Bacteria 855
22 Ga0070669_100014422 3300005353 Bacteria 5625
23 Ga0070669_100025402 3300005353 Bacteria 4254
24 Ga0070675_100094164 3300005354 Bacteria 2513
25 Ga0070675_101333602 3300005354 Unclassified 661
26 Ga0070674_100091406 3300005356 Bacteria 2198
27 Ga0070659_100000990 3300005366 Bacteria 20856
28 Ga0070659_100959222 3300005366 Bacteria 749
29 Ga0070667_101935168 3300005367 Bacteria 555
30 Ga0070703_10238778 3300005406 Unclassified 732
31 Ga0070701_10170223 3300005438 Bacteria 1268
32 Ga0070700_100000847 3300005441 Bacteria 15107
33 Ga0070700_100072061 3300005441 Bacteria 2207
34 Ga0070700_100467275 3300005441 Bacteria 963
35 Ga0070694_100008176 3300005444 Bacteria 6390
36 Ga0070694_100099381 3300005444 Bacteria 2056
37 Ga0070694_100569326 3300005444 Unclassified 909
38 Ga0070708_100463717 3300005445 Bacteria 1195
39 Ga0070663_101197473 3300005455 Bacteria 667
40 Ga0070678_100392924 3300005456 Bacteria 1203
41 Ga0070662_100934399 3300005457 Bacteria 741
42 Ga0068867_100006575 3300005459 Bacteria 8212
43 Ga0068867_100806909 3300005459 Bacteria 837
44 Ga0070706_100049041 3300005467 Bacteria 3897
45 Ga0070706_100977637 3300005467 Bacteria 781
46 Ga0070707_100456030 3300005468 Unclassified 1239
47 Ga0070698_100468038 3300005471 Bacteria 1197
48 Ga0070699_100089464 3300005518 Bacteria 2690
49 Ga0070699_100128617 3300005518 Archaea 2232
50 Ga0070697_101154103 3300005536 Unclassified 690
51 Ga0070697_101287244 3300005536 Bacteria 652
52 Ga0068853_100000122 3300005539 Bacteria 52521
53 Ga0070672_100155666 3300005543 Bacteria 1893
54 Ga0070695_100002599 3300005545 Bacteria 10429
55 Ga0070695_100002735 3300005545 Bacteria 10222
56 Ga0070695_100719713 3300005545 Bacteria 794
57 Ga0070696_100014377 3300005546 Bacteria 5311
58 Ga0070696_100076916 3300005546 Bacteria 2357
59 Ga0070696_100093238 3300005546 Bacteria 2147
60 Ga0070665_101913705 3300005548 Unclassified 599
61 Ga0070704_100042265 3300005549 Bacteria 3151
62 Ga0070704_100071295 3300005549 Bacteria 2524
63 Ga0070704_100125713 3300005549 Bacteria 1978
64 Ga0070704_100206447 3300005549 Bacteria 1589
65 Ga0070704_100835740 3300005549 Bacteria 825
66 Ga0070704_101013830 3300005549 Bacteria 751
67 Ga0068855_100024319 3300005563 Bacteria 7251
68 Ga0068854_100000070 3300005578 Bacteria 73848
69 Ga0068854_100022908 3300005578 Bacteria 4260
70 Ga0068854_101454866 3300005578 Bacteria 621
71 Ga0070702_100003134 3300005615 Bacteria 7326
72 Ga0068852_100133778 3300005616 Bacteria 2287
73 Ga0068859_101278567 3300005617 Unclassified 808
74 Ga0068861_100004619 3300005719 Bacteria 9242
75 Ga0068861_100147645 3300005719 Bacteria 1926
76 Ga0068861_100561675 3300005719 Unclassified 1042
77 Ga0068861_101253539 3300005719 Bacteria 719
78 Ga0068862_100064452 3300005844 Bacteria 3154
79 Ga0068862_100194069 3300005844 Bacteria 1828
80 Ga0068862_100655564 3300005844 Unclassified 1013
81 Ga0097621_101525508 3300006237 Unclassified 634
82 Ga0075428_101725407 3300006844 Unclassified 653
83 Ga0075431_100096033 3300006847 Bacteria 3060
84 Ga0075433_10103014 3300006852 Bacteria 2528
85 Ga0075433_10183418 3300006852 Bacteria 1862
86 Ga0075433_10216040 3300006852 Unclassified 1704
87 Ga0075434_100012622 3300006871 Bacteria 8010
88 Ga0075434_100390166 3300006871 Bacteria 1413
89 Ga0075434_100624888 3300006871 Bacteria 1096
90 Ga0097620_101278547 3300006931 Unclassified 808
91 Ga0075435_100009015 3300007076 Bacteria 7195
92 Ga0075435_100313630 3300007076 Unclassified 1342
93 Ga0105240_10017058 3300009093 Bacteria 9805
94 Ga0111539_10006983 3300009094 Bacteria 14489
95 Ga0111539_10179376 3300009094 Bacteria 2474
96 Ga0111539_11283884 3300009094 Bacteria 850
97 Ga0114129_10001985 3300009147 Bacteria 27999
98 Ga0114129_10027919 3300009147 Bacteria 7992
99 Ga0114129_10479813 3300009147 Bacteria 1627
100 Ga0114129_10585414 3300009147 Bacteria 1447
101 Ga0114129_11118528 3300009147 Bacteria 985
102 Ga0105243_10012728 3300009148 Bacteria 6355
103 Ga0105243_11312441 3300009148 Bacteria 741
104 Ga0105242_10291039 3300009176 Bacteria 1487
105 Ga0105248_10571400 3300009177 Bacteria 1276
106 Ga0105248_11326968 3300009177 Bacteria 814
107 Ga0105248_11720835 3300009177 Bacteria 711
108 Ga0105249_11248580 3300009553 Bacteria 814
109 Ga0105249_11343980 3300009553 Bacteria 786
110 Ga0105239_11019467 3300010375 Bacteria 952
111 Ga0157370_10007226 3300013104 Bacteria 12120
112 Ga0157370_10075570 3300013104 Bacteria 3175
113 Ga0157370_10662826 3300013104 Unclassified 953
114 Ga0157369_10343775 3300013105 Bacteria 1550
115 Ga0157369_10382031 3300013105 Bacteria 1462
116 Ga0157374_10359449 3300013296 Bacteria 1448
117 Ga0157372_10056437 3300013307 Bacteria 4388
118 Ga0157380_10060459 3300014326 Bacteria 3028
119 Ga0224572_1001181 3300024225 Bacteria 3726
120 Ga0228598_1000372 3300024227 Bacteria 8933
121 Ga0207680_10003908 3300025903 Bacteria 7033
122 Ga0207680_11019311 3300025903 Unclassified 593
123 Ga0207647_10057143 3300025904 Bacteria 2393
124 Ga0207645_10009957 3300025907 Bacteria 6549
125 Ga0207645_10024241 3300025907 Bacteria 3936
126 Ga0207645_10809470 3300025907 Bacteria 637
127 Ga0207705_10086804 3300025909 Bacteria 2287
128 Ga0207684_10150693 3300025910 Bacteria 2001
129 Ga0207684_10774143 3300025910 Bacteria 812
130 Ga0207695_10013677 3300025913 Bacteria 9662
131 Ga0207657_10007070 3300025919 Bacteria 11530
132 Ga0207657_10191618 3300025919 Bacteria 1649
133 Ga0207649_10152317 3300025920 Bacteria 1594
134 Ga0207681_10013401 3300025923 Bacteria 5075
135 Ga0207659_11344472 3300025926 Bacteria 613
136 Ga0207690_10000909 3300025932 Bacteria 18882
137 Ga0207706_10455238 3300025933 Bacteria 1107
138 Ga0207709_10067836 3300025935 Bacteria 2253
139 Ga0207669_10697659 3300025937 Bacteria 834
140 Ga0207711_10358916 3300025941 Bacteria 1350
141 Ga0207661_11322157 3300025944 Unclassified 662
142 Ga0207712_10660861 3300025961 Bacteria 909
143 Ga0207712_10755069 3300025961 Bacteria 852
144 Ga0207668_10169624 3300025972 Bacteria 1710
145 Ga0207668_10483741 3300025972 Bacteria 1062
146 Ga0207640_10000080 3300025981 Bacteria 75177
147 Ga0207640_10055875 3300025981 Bacteria 2588
148 Ga0207703_10189890 3300026035 Bacteria 1819
149 Ga0207639_10000082 3300026041 Bacteria 82368
150 Ga0207678_10046913 3300026067 Bacteria 3736
151 Ga0207708_10007468 3300026075 Bacteria 8077
152 Ga0207708_10152321 3300026075 Bacteria 1821
153 Ga0207708_10478918 3300026075 Bacteria 1040
154 Ga0207648_10015083 3300026089 Bacteria 7114
155 Ga0207648_10818757 3300026089 Bacteria 867
156 Ga0207675_100004071 3300026118 Bacteria 14150
157 Ga0207675_100393631 3300026118 Bacteria 1364
158 Ga0207675_100599826 3300026118 Bacteria 1104
159 Ga0207698_10242069 3300026142 Bacteria 1645
160 Ga0209971_1026816 3300027682 Bacteria 1377
161 Ga0207428_10003989 3300027907 Bacteria 14169
162 Ga0207428_10498807 3300027907 Bacteria 884
163 Ga0268266_10404804 3300028379 Bacteria 1291
164 Ga0268265_10423939 3300028380 Unclassified 1236
165 Ga0268265_10752003 3300028380 Bacteria 946
166 Ga0265770_1005087 3300030878 Bacteria 1804
167 Ga0265760_10001346 3300031090 Bacteria 7221
168 Ga0265760_10067581 3300031090 Unclassified 1093
169 Ga0265760_10152542 3300031090 Bacteria 758
170 Ga0307408_100995812 3300031548 Unclassified 772
171 Ga0265314_10352875 3300031711 Unclassified 809
172 Ga0316578_10524516 3300031728 Unclassified 697
173 Ga0307416_100792926 3300032002 Bacteria 1043
174 Ga0307510_10061682 3300033180 Bacteria 3840
175 Ga0373941_0069604 3300035115 Bacteria 1165
176 Ga0436362_1243594 3300039453 Bacteria 1382
177 Ga0451793_1811451 3300041452 Bacteria 552
178 Ga0451807_2081361 3300041486 Bacteria 681
179 Ga0451835_0669864 3300041492 Bacteria 559
180 Ga0451837_0202424 3300041494 Unclassified 1439
181 Ga0451577_0001143 3300042876 Bacteria 37508
182 Ga0451577_0157480 3300042876 Unclassified 2044
183 Ga0453684_0000820 3300044712 Bacteria 105155
184 Ga0451576_0304927 3300045051 Unclassified 1666
185 Ga0466967_0177493 3300045976 Bacteria 2007
186 Ga0496105_0889478 3300048908 Bacteria 672
187 Ga0496121_0455888 3300048924 Bacteria 823
188 Ga0501031_0190236 3300049568 Bacteria 1340
189 Ga0501032_0000332 3300049569 Bacteria 39442
190 Ga0501033_0015810 3300049570 Bacteria 5719
191 Ga0501034_0186847 3300049571 Bacteria 2035
192 Ga0501034_0515638 3300049571 Bacteria 1108
193 Ga0501036_0027112 3300049572 Bacteria 4840
194 Ga0501037_0397462 3300049573 Bacteria 945
195 Ga0501038_0048254 3300049574 Bacteria 3685
196 Ga0501038_0393796 3300049574 Bacteria 1073
197 Ga0501039_0767879 3300049575 Bacteria 752
198 Ga0501043_0003481 3300049579 Bacteria 12935
199 Ga0501046_0000076 3300049580 Bacteria 103321
200 Ga0501047_0002173 3300049581 Bacteria 18773
201 Ga0501048_0392911 3300049582 Bacteria 991
202 Ga0501070_0724406 3300049586 Bacteria 785
203 Ga0501073_0001249 3300049589 Bacteria 18593
204 Ga0501079_0445406 3300049741 Bacteria 1017
205 Ga0501080_0087031 3300049742 Bacteria 2903
206 Ga0501080_0680307 3300049742 Bacteria 909
207 Ga0501035_0013539 3300049822 Bacteria 7529
208 Ga0501044_0014442 3300049823 Bacteria 8526
209 nmdc:mga05p37_1091532_c1 3300050507 Bacteria 837
210 nmdc:mga05p37_33932_c1 3300050507 Bacteria 6252
211 nmdc:mga05p37_397064_c1 3300050507 Bacteria 1611
212 nmdc:mga05p37_404598_c1 3300050507 Bacteria 1593
213 nmdc:mga05p37_459370_c1 3300050507 Bacteria 1472
214 nmdc:mga06r32_36711_c1 3300050510 Bacteria 4633
215 nmdc:mga08y16_11736_c1 3300050511 Bacteria 9205
216 nmdc:mga08y16_1328518_c1 3300050511 Bacteria 685
217 nmdc:mga08y16_152069_c1 3300050511 Bacteria 2405
218 nmdc:mga08y16_90607_c1 3300050511 Bacteria 3188
219 nmdc:mga0n895_101186_c1 3300050512 Bacteria 2892
220 nmdc:mga0n895_26074_c1 3300050512 Bacteria 5530
221 nmdc:mga0n895_57342_c1 3300050512 Bacteria 3839
222 nmdc:mga0n895_673659_c1 3300050512 Bacteria 1032
223 nmdc:mga0a205_115569_c1 3300050515 Bacteria 2582
224 nmdc:mga0a205_20412_c1 3300050515 Bacteria 6250
225 nmdc:mga0a205_555700_c1 3300050515 Bacteria 1003
226 Ga0451577_0118692
227 rootL2_10117095
228 rootL2_10257836
229 Ga0070658_10009381
230 Ga0070676_10006427
231 Ga0070676_10011388
232 Ga0070683_101540495
233 Ga0070690_100120794
234 Ga0068869_100729807
235 Ga0070666_10006162
236 Ga0070680_100764227
237 Ga0070660_100008640
238 Ga0070660_100288291
239 Ga0070660_101159402
240 Ga0070689_100637063
241 Ga0070691_10000759
242 Ga0070661_100055181
243 Ga0070661_100058056
244 Ga0070692_10020702
245 Ga0070668_100122229
246 Ga0070668_100766887
247 Ga0070669_100014422
248 Ga0070669_100025402
249 Ga0070675_100094164
250 Ga0070675_101333602
251 Ga0070674_100091406
252 Ga0070659_100000990
253 Ga0070659_100959222
254 Ga0070667_101935168
255 Ga0070703_10238778
256 Ga0070701_10170223
257 Ga0070700_100000847
258 Ga0070700_100072061
259 Ga0070700_100467275
260 Ga0070694_100008176
261 Ga0070694_100099381
262 Ga0070694_100569326
263 Ga0070708_100463717
264 Ga0070663_101197473
265 Ga0070678_100392924
266 Ga0070662_100934399
267 Ga0068867_100006575
268 Ga0068867_100806909
269 Ga0070706_100049041
270 Ga0070706_100977637
271 Ga0070707_100456030
272 Ga0070698_100468038
273 Ga0070699_100089464
274 Ga0070699_100128617
275 Ga0070697_101154103
276 Ga0070697_101287244
277 Ga0068853_100000122
278 Ga0070672_100155666
279 Ga0070695_100002599
280 Ga0070695_100002735
281 Ga0070695_100719713
282 Ga0070696_100014377
283 Ga0070696_100076916
284 Ga0070696_100093238
285 Ga0070665_101913705
286 Ga0070704_100042265
287 Ga0070704_100071295
288 Ga0070704_100125713
289 Ga0070704_100206447
290 Ga0070704_100835740
291 Ga0070704_101013830
292 Ga0068855_100024319
293 Ga0068854_100000070
294 Ga0068854_100022908
295 Ga0068854_101454866
296 Ga0070702_100003134
297 Ga0068852_100133778
298 Ga0068859_101278567
299 Ga0068861_100004619
300 Ga0068861_100147645
301 Ga0068861_100561675
302 Ga0068861_101253539
303 Ga0068862_100064452
304 Ga0068862_100194069
305 Ga0068862_100655564
306 Ga0097621_101525508
307 Ga0075428_101725407
308 Ga0075431_100096033
309 Ga0075433_10103014
310 Ga0075433_10183418
311 Ga0075433_10216040
312 Ga0075434_100012622
313 Ga0075434_100390166
314 Ga0075434_100624888
315 Ga0097620_101278547
316 Ga0075435_100009015
317 Ga0075435_100313630
318 Ga0105240_10017058
319 Ga0111539_10006983
320 Ga0111539_10179376
321 Ga0111539_11283884
322 Ga0114129_10001985
323 Ga0114129_10027919
324 Ga0114129_10479813
325 Ga0114129_10585414
326 Ga0114129_11118528
327 Ga0105243_10012728
328 Ga0105243_11312441
329 Ga0105242_10291039
330 Ga0105248_10571400
331 Ga0105248_11326968
332 Ga0105248_11720835
333 Ga0105249_11248580
334 Ga0105249_11343980
335 Ga0105239_11019467
336 Ga0157370_10007226
337 Ga0157370_10075570
338 Ga0157370_10662826
339 Ga0157369_10343775
340 Ga0157369_10382031
341 Ga0157374_10359449
342 Ga0157372_10056437
343 Ga0157380_10060459
344 Ga0224572_1001181
345 Ga0228598_1000372
346 Ga0207680_10003908
347 Ga0207680_11019311
348 Ga0207647_10057143
349 Ga0207645_10009957
350 Ga0207645_10024241
351 Ga0207645_10809470
352 Ga0207705_10086804
353 Ga0207684_10150693
354 Ga0207684_10774143
355 Ga0207695_10013677
356 Ga0207657_10007070
357 Ga0207657_10191618
358 Ga0207649_10152317
359 Ga0207681_10013401
360 Ga0207659_11344472
361 Ga0207690_10000909
362 Ga0207706_10455238
363 Ga0207709_10067836
364 Ga0207669_10697659
365 Ga0207711_10358916
366 Ga0207661_11322157
367 Ga0207712_10660861
368 Ga0207712_10755069
369 Ga0207668_10169624
370 Ga0207668_10483741
371 Ga0207640_10000080
372 Ga0207640_10055875
373 Ga0207703_10189890
374 Ga0207639_10000082
375 Ga0207678_10046913
376 Ga0207708_10007468
377 Ga0207708_10152321
378 Ga0207708_10478918
379 Ga0207648_10015083
380 Ga0207648_10818757
381 Ga0207675_100004071
382 Ga0207675_100393631
383 Ga0207675_100599826
384 Ga0207698_10242069
385 Ga0209971_1026816
386 Ga0207428_10003989
387 Ga0207428_10498807
388 Ga0268266_10404804
389 Ga0268265_10423939
390 Ga0268265_10752003
391 Ga0265770_1005087
392 Ga0265760_10001346
393 Ga0265760_10067581
394 Ga0265760_10152542
395 Ga0307408_100995812
396 Ga0265314_10352875
397 Ga0316578_10524516
398 Ga0307416_100792926
399 Ga0307510_10061682
400 Ga0373941_0069604
401 Ga0436362_1243594
402 Ga0451793_1811451
403 Ga0451807_2081361
404 Ga0451835_0669864
405 Ga0451837_0202424
406 Ga0451577_0001143
407 Ga0451577_0157480
408 Ga0453684_0000820
409 Ga0451576_0304927
410 Ga0466967_0177493
411 Ga0496105_0889478
412 Ga0496121_0455888
413 Ga0501031_0190236
414 Ga0501032_0000332
415 Ga0501033_0015810
416 Ga0501034_0186847
417 Ga0501034_0515638
418 Ga0501036_0027112
419 Ga0501037_0397462
420 Ga0501038_0048254
421 Ga0501038_0393796
422 Ga0501039_0767879
423 Ga0501043_0003481
424 Ga0501046_0000076
425 Ga0501047_0002173
426 Ga0501048_0392911
427 Ga0501070_0724406
428 Ga0501073_0001249
429 Ga0501079_0445406
430 Ga0501080_0087031
431 Ga0501080_0680307
432 Ga0501035_0013539
433 Ga0501044_0014442
434 nmdc:mga05p37_1091532_c1
435 nmdc:mga05p37_33932_c1
436 nmdc:mga05p37_397064_c1
437 nmdc:mga05p37_404598_c1
438 nmdc:mga05p37_459370_c1
439 nmdc:mga06r32_36711_c1
440 nmdc:mga08y16_11736_c1
441 nmdc:mga08y16_1328518_c1
442 nmdc:mga08y16_152069_c1
443 nmdc:mga08y16_90607_c1
444 nmdc:mga0n895_101186_c1
445 nmdc:mga0n895_26074_c1
446 nmdc:mga0n895_57342_c1
447 nmdc:mga0n895_673659_c1
448 nmdc:mga0a205_115569_c1
449 nmdc:mga0a205_20412_c1
450 nmdc:mga0a205_555700_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20136

DUF6526

Family of unknown function (DUF6526)

27

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkm-assembly1.cif.gz_F-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7794 69 131
6kkm-assembly1.cif.gz_G-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7753 69 131
6kkm-assembly1.cif.gz_H-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7753 69 131
6kkn-assembly1.cif.gz_A-2 crystal structure of rubisco accumulation factor raf1 from anabaena sp. pcc 7120 0.7747 69 131
7xsd-assembly1.cif.gz_O cryo-em structure of rubisco assembly intermediate rbcl8raf18rbcx16 0.772 72 131
ID Description Score Start End Superfamily
3txqB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8464 15 64 1.10.287.1060
3txsB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8459 15 64 1.10.287.1060
af_Q2FWV7_1_86_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.844 22 64 1.20.1070.10
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.664 79 129 1.10.10.2830
af_Q2FUQ5_107_218_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6184 76 133 1.10.10.2830
ID Description Score Start End GO Terms
AF-A0A5B9EEL8-F1-model_v4 Uncharacterized protein 0.9882 1 143 GO:0016020
AF-A0A7Y5VIE0-F1-model_v4 Uncharacterized protein 0.9866 1 143 GO:0016020
AF-A0A4R1KZ86-F1-model_v4 ABC transporter permease 0.9681 1 143 GO:0016020
AF-Q1IR69-F1-model_v4 Uncharacterized protein 0.967 4 143 GO:0016020
AF-A0A2Z5G3S1-F1-model_v4 Uncharacterized protein 0.9657 1 143 GO:0016020

Map