F337888

General Info

Members Datasets Scaffolds Average Seq Length
225 158 225 173

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_11227489|Ga0207648_112274892
Length 167
Sequence VKGRWAQGLEPRAFCWIIKERLAASERPGGFARNHRKVRRQEELIWLIGHGFTHILSMLDSPHNLHAYDELGVTWSHFPMGGGSGSTDSRSALAELYSALHKWMGDGERLLLHQEELGDGVMGVVAGYLVATGMIEDGPHAVTVVEQILHRQMGPPGRELVALASAL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
78 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
79 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8
Nodule 0
Rhizoplane 8.44
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100981687 3300005329 Unclassified 811
2 Ga0070670_101211490 3300005331 Unclassified 690
3 Ga0070675_100089010 3300005354 Bacteria 2584
4 Ga0070671_100013220 3300005355 Bacteria 6649
5 Ga0070673_100526321 3300005364 Bacteria 1072
6 Ga0070710_10580010 3300005437 Bacteria 778
7 Ga0070708_100008602 3300005445 Bacteria 8200
8 Ga0070678_100638432 3300005456 Bacteria 954
9 Ga0070681_10343391 3300005458 Bacteria 1403
10 Ga0070681_10413641 3300005458 Bacteria 1260
11 Ga0068867_100199994 3300005459 Bacteria 1599
12 Ga0068867_100548730 3300005459 Bacteria 1001
13 Ga0070679_101670598 3300005530 Bacteria 585
14 Ga0070672_100715765 3300005543 Bacteria 877
15 Ga0070672_100765017 3300005543 Bacteria 848
16 Ga0070695_100149773 3300005545 Bacteria 1627
17 Ga0070665_101738805 3300005548 Bacteria 631
18 Ga0068861_100243315 3300005719 Bacteria 1531
19 Ga0068860_101079308 3300005843 Bacteria 822
20 Ga0081455_10214205 3300005937 Bacteria 1433
21 Ga0081539_10013931 3300005985 Bacteria 6003
22 Ga0070717_10514921 3300006028 Bacteria 1082
23 Ga0075365_10019749 3300006038 Bacteria 4166
24 Ga0075365_10105559 3300006038 Bacteria 1932
25 Ga0075365_10225387 3300006038 Bacteria 1315
26 Ga0075364_10295374 3300006051 Bacteria 1103
27 Ga0075364_10325228 3300006051 Bacteria 1047
28 Ga0075364_10737300 3300006051 Unclassified 672
29 Ga0070715_10166334 3300006163 Bacteria 1094
30 Ga0075362_10320108 3300006177 Bacteria 772
31 Ga0075362_10507721 3300006177 Bacteria 617
32 Ga0068871_101376718 3300006358 Unclassified 665
33 Ga0075428_100078927 3300006844 Bacteria 3593
34 Ga0075428_100174297 3300006844 Bacteria 2330
35 Ga0075430_100310900 3300006846 Bacteria 1303
36 Ga0075430_100872430 3300006846 Unclassified 741
37 Ga0105240_10803456 3300009093 Bacteria 1019
38 Ga0105240_11274315 3300009093 Bacteria 776
39 Ga0111539_10171641 3300009094 Bacteria 2533
40 Ga0111539_10351901 3300009094 Bacteria 1714
41 Ga0105245_10298031 3300009098 Bacteria 1581
42 Ga0105245_10549585 3300009098 Bacteria 1176
43 Ga0105245_11232717 3300009098 Bacteria 796
44 Ga0105243_10307182 3300009148 Bacteria 1440
45 Ga0105242_11079340 3300009176 Bacteria 815
46 Ga0105249_12146564 3300009553 Unclassified 631
47 Ga0105246_10280976 3300011119 Bacteria 1335
48 Ga0157369_11744656 3300013105 Bacteria 632
49 Ga0157375_10881979 3300013308 Bacteria 1039
50 Ga0157380_10600213 3300014326 Unclassified 1089
51 Ga0157380_11335390 3300014326 Bacteria 765
52 Ga0157379_10334757 3300014968 Bacteria 1383
53 Ga0157379_11391698 3300014968 Bacteria 680
54 Ga0157376_11004346 3300014969 Unclassified 857
55 Ga0157376_11994565 3300014969 Bacteria 618
56 Ga0206356_10125103 3300020070 Bacteria 1116
57 Ga0213876_10022128 3300021384 Bacteria 3363
58 Ga0213875_10064300 3300021388 Bacteria 1714
59 Ga0207692_10363741 3300025898 Bacteria 894
60 Ga0207685_10201727 3300025905 Bacteria 935
61 Ga0207643_10328857 3300025908 Bacteria 956
62 Ga0207684_10633318 3300025910 Bacteria 912
63 Ga0207707_10477547 3300025912 Bacteria 1065
64 Ga0207663_10319742 3300025916 Bacteria 1166
65 Ga0207659_10079920 3300025926 Bacteria 2414
66 Ga0207700_10565556 3300025928 Bacteria 1010
67 Ga0207664_10808886 3300025929 Unclassified 843
68 Ga0207644_10005942 3300025931 Bacteria 7956
69 Ga0207686_10724245 3300025934 Bacteria 792
70 Ga0207709_10890682 3300025935 Bacteria 723
71 Ga0207670_10634584 3300025936 Bacteria 880
72 Ga0207691_10449741 3300025940 Bacteria 1096
73 Ga0207689_10688009 3300025942 Bacteria 862
74 Ga0207651_11058779 3300025960 Unclassified 726
75 Ga0207712_10956057 3300025961 Bacteria 759
76 Ga0207668_10865723 3300025972 Bacteria 803
77 Ga0207648_10275776 3300026089 Bacteria 1503
78 Ga0207648_10389371 3300026089 Bacteria 1261
79 Ga0207648_10965775 3300026089 Bacteria 797
80 Ga0207648_11227489 3300026089 Bacteria 704
81 Ga0207676_10663359 3300026095 Bacteria 1008
82 Ga0207683_10564356 3300026121 Bacteria 1053
83 Ga0268266_10504923 3300028379 Bacteria 1155
84 Ga0265322_10057143 3300028654 Bacteria 1107
85 Ga0265328_10194035 3300031239 Bacteria 770
86 Ga0265339_10439093 3300031249 Unclassified 607
87 Ga0265327_10010660 3300031251 Bacteria 6430
88 Ga0265327_10012895 3300031251 Bacteria 5596
89 Ga0265327_10139319 3300031251 Bacteria 1135
90 Ga0316575_10142113 3300031665 Bacteria 988
91 Ga0265314_10536589 3300031711 Unclassified 611
92 Ga0307410_10113382 3300031852 Bacteria 1965
93 Ga0307410_10271511 3300031852 Bacteria 1327
94 Ga0307407_10015153 3300031903 Bacteria 3800
95 Ga0307409_100158715 3300031995 Bacteria 1975
96 Ga0307409_100215653 3300031995 Bacteria 1728
97 Ga0307409_100343445 3300031995 Bacteria 1406
98 Ga0307416_100061847 3300032002 Bacteria 3058
99 Ga0307416_102179531 3300032002 Bacteria 656
100 Ga0307414_10039064 3300032004 Bacteria 3194
101 Ga0307411_10275064 3300032005 Bacteria 1337
102 Ga0307415_100193269 3300032126 Bacteria 1608
103 Ga0307415_101219587 3300032126 Bacteria 709
104 Ga0373930_0000695 3300034816 Bacteria 4720
105 Ga0373930_0037028 3300034816 Bacteria 1025
106 Ga0373948_0000379 3300034817 Bacteria 5464
107 Ga0373928_0004261 3300035084 Bacteria 2730
108 Ga0373949_0012437 3300035090 Bacteria 1883
109 Ga0373932_0000285 3300035112 Bacteria 15240
110 Ga0373936_0098505 3300035113 Bacteria 1232
111 Ga0373946_0326841 3300035171 Bacteria 763
112 Ga0316574_0581022 3300035398 Unclassified 693
113 Ga0373931_0000006 3300035691 Bacteria 437006
114 Ga0373931_0000114 3300035691 Bacteria 36840
115 Ga0373933_0505729 3300035724 Bacteria 792
116 Ga0316582_0147182 3300036647 Bacteria 1591
117 Ga0436364_0808678 3300037853 Bacteria 1908
118 Ga0436365_0641211 3300039437 Bacteria 3724
119 Ga0436363_1110276 3300039450 Bacteria 569
120 Ga0466966_0181498 3300044684 Unclassified 1277
121 Ga0466958_0710078 3300045836 Viruses 655
122 Ga0495592_0091178 3300046454 Bacteria 2186
123 Ga0495592_0296894 3300046454 Bacteria 1051
124 Ga0495641_0215111 3300046461 Bacteria 862
125 Ga0495651_0477843 3300046462 Unclassified 801
126 Ga0495653_0017139 3300046463 Bacteria 5892
127 Ga0495653_0360204 3300046463 Bacteria 933
128 Ga0495653_0477959 3300046463 Bacteria 780
129 Ga0495582_0036567 3300046473 Bacteria 2701
130 Ga0495582_0163679 3300046473 Bacteria 1266
131 Ga0495608_0101102 3300046511 Bacteria 1859
132 Ga0495608_0215722 3300046511 Unclassified 1205
133 Ga0495628_0115386 3300046516 Bacteria 2062
134 Ga0495628_0384116 3300046516 Unclassified 1028
135 Ga0495630_0019826 3300046517 Bacteria 4949
136 Ga0495630_0046344 3300046517 Bacteria 3250
137 Ga0495630_0671923 3300046517 Bacteria 793
138 Ga0495631_0228949 3300046518 Bacteria 793
139 Ga0495640_0072209 3300046533 Bacteria 2313
140 Ga0495640_0122522 3300046533 Bacteria 1689
141 Ga0495587_0286379 3300046536 Bacteria 923
142 Ga0495667_0148875 3300046559 Bacteria 1507
143 Ga0495668_0654251 3300046616 Unclassified 581
144 Ga0495634_0104818 3300046642 Bacteria 1823
145 Ga0495634_0752995 3300046642 Bacteria 558
146 Ga0495635_0296864 3300046663 Bacteria 1084
147 Ga0495599_0572905 3300046678 Unclassified 659
148 Ga0495647_0317649 3300046681 Bacteria 705
149 Ga0495658_0030836 3300046683 Bacteria 2915
150 Ga0495613_0097913 3300046689 Bacteria 2120
151 Ga0495613_0157593 3300046689 Bacteria 1617
152 Ga0495649_0559376 3300046694 Bacteria 566
153 Ga0495600_0295395 3300046809 Bacteria 1023
154 Ga0495604_0121465 3300047317 Bacteria 1891
155 Ga0495604_0168099 3300047317 Bacteria 1545
156 Ga0495674_0178396 3300047319 Bacteria 1770
157 Ga0495680_0146761 3300047322 Bacteria 1722
158 Ga0495675_0049215 3300047444 Bacteria 2680
159 Ga0495684_0220582 3300047471 Bacteria 1390
160 Ga0496100_0057860 3300048903 Bacteria 2541
161 Ga0496100_0288036 3300048903 Unclassified 1226
162 Ga0496101_0044535 3300048904 Bacteria 3176
163 Ga0496101_0142399 3300048904 Bacteria 1828
164 Ga0496101_0349595 3300048904 Bacteria 1162
165 Ga0496101_0437176 3300048904 Bacteria 1032
166 Ga0496102_0007629 3300048905 Bacteria 9248
167 Ga0496103_0117673 3300048906 Bacteria 1692
168 Ga0496104_0013787 3300048907 Bacteria 7291
169 Ga0496104_0064248 3300048907 Bacteria 3482
170 Ga0496105_0013176 3300048908 Bacteria 6558
171 Ga0496105_0124406 3300048908 Bacteria 2126
172 Ga0496106_0067975 3300048909 Bacteria 2717
173 Ga0496107_0070065 3300048910 Bacteria 2546
174 Ga0496109_0420181 3300048912 Bacteria 1263
175 Ga0496111_0366918 3300048914 Bacteria 1065
176 Ga0496113_0451328 3300048916 Bacteria 1033
177 Ga0496114_1478229 3300048917 Bacteria 567
178 Ga0496115_0016463 3300048918 Bacteria 5631
179 Ga0501033_0000576 3300049570 Bacteria 34166
180 Ga0501034_0020436 3300049571 Bacteria 6760
181 Ga0501036_0069022 3300049572 Bacteria 2991
182 Ga0501036_0233341 3300049572 Bacteria 1544
183 Ga0501037_0073872 3300049573 Bacteria 2479
184 Ga0501039_1015972 3300049575 Bacteria 644
185 Ga0501043_0253068 3300049579 Bacteria 1356
186 Ga0501046_0030610 3300049580 Bacteria 4367
187 Ga0501047_0003572 3300049581 Bacteria 14674
188 Ga0501047_0207282 3300049581 Bacteria 1820
189 Ga0501048_0173423 3300049582 Bacteria 1528
190 Ga0501068_0271133 3300049584 Unclassified 1083
191 Ga0501070_0002867 3300049586 Bacteria 15022
192 Ga0501071_0602391 3300049587 Bacteria 845
193 Ga0501077_0576466 3300049593 Bacteria 722
194 Ga0501080_0048584 3300049742 Bacteria 3949
195 Ga0501080_0682720 3300049742 Bacteria 907
196 Ga0501083_0130147 3300049744 Bacteria 1650
197 Ga0501083_0752242 3300049744 Bacteria 634
198 Ga0501044_0008125 3300049823 Bacteria 11516
199 Ga0501044_0186595 3300049823 Bacteria 2038
200 nmdc:mga03683_137938_c1 3300050489 Bacteria 1095
201 nmdc:mga00v17_194639_c1 3300050491 Bacteria 1310
202 nmdc:mga00v17_356896_c1 3300050491 Bacteria 950
203 nmdc:mga00v17_43875_c1 3300050491 Bacteria 2694
204 nmdc:mga00v17_653529_c1 3300050491 Unclassified 676
205 nmdc:mga0yw44_192425_c1 3300050492 Bacteria 1346
206 nmdc:mga0yw44_563_c1 3300050492 Bacteria 13408
207 nmdc:mga0yw44_653107_c1 3300050492 Bacteria 715
208 nmdc:mga0yw44_8578_c1 3300050492 Bacteria 5103
209 nmdc:mga05p37_619279_c1 3300050507 Bacteria 1218
210 nmdc:mga0qj67_24148_c1 3300050509 Bacteria 4684
211 nmdc:mga0qj67_645835_c1 3300050509 Unclassified 844
212 nmdc:mga08y16_124124_c1 3300050511 Bacteria 2686
213 Ga0495601_0121146 3300053077 Bacteria 1699
214 Ga0495601_0295740 3300053077 Bacteria 1055
215 Ga0495595_0043729 3300053084 Bacteria 2056
216 Ga0495595_0084193 3300053084 Bacteria 1519
217 Ga0495595_0090866 3300053084 Bacteria 1465
218 Ga0495595_0093582 3300053084 Bacteria 1444
219 Ga0495619_0034661 3300053085 Bacteria 3282
220 Ga0495619_0057652 3300053085 Bacteria 2577
221 Ga0495619_0188719 3300053085 Bacteria 1427
222 Ga0495619_0232336 3300053085 Bacteria 1278
223 Ga0495619_0785806 3300053085 Unclassified 644
224 Ga0500566_0002875 3300053094 Bacteria 10263
225 Ga0501082_0189408 3300060353 Bacteria 1790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10064300 Ga0213875_100643002 149
2 3300037853 Ga0436364_0808678 Ga0436364_0808678_543_1070 149
3 3300014968 Ga0157379_11391698 Ga0157379_113916982 155
4 3300045836 Ga0466958_0710078 Ga0466958_0710078_31_558 159
5 3300046678 Ga0495599_0572905 Ga0495599_0572905_136_639 162
6 3300009098 Ga0105245_11232717 Ga0105245_112327172 163
7 3300049593 Ga0501077_0576466 Ga0501077_0576466_105_596 163
8 3300005445 Ga0070708_100008602 Ga0070708_1000086028 164
9 3300025910 Ga0207684_10633318 Ga0207684_106333182 164
10 3300025929 Ga0207664_10808886 Ga0207664_108088862 164
11 3300026089 Ga0207648_11227489 Ga0207648_112274892 164
12 3300039450 Ga0436363_1110276 Ga0436363_1110276_37_537 164
13 3300046642 Ga0495634_0104818 Ga0495634_0104818_11_505 164
14 3300005364 Ga0070673_100526321 Ga0070673_1005263211 166
15 3300005459 Ga0068867_100548730 Ga0068867_1005487302 166
16 3300005545 Ga0070695_100149773 Ga0070695_1001497732 166
17 3300009098 Ga0105245_10549585 Ga0105245_105495852 166
18 3300014969 Ga0157376_11994565 Ga0157376_119945651 166
19 3300025936 Ga0207670_10634584 Ga0207670_106345842 166
20 3300049742 Ga0501080_0682720 Ga0501080_0682720_267_767 166
21 3300005458 Ga0070681_10413641 Ga0070681_104136412 167
22 3300005459 Ga0068867_100199994 Ga0068867_1001999942 167
23 3300005530 Ga0070679_101670598 Ga0070679_1016705981 167
24 3300005543 Ga0070672_100765017 Ga0070672_1007650172 167
25 3300009093 Ga0105240_11274315 Ga0105240_112743152 167
26 3300009098 Ga0105245_10298031 Ga0105245_102980312 167
27 3300013105 Ga0157369_11744656 Ga0157369_117446561 167
28 3300020070 Ga0206356_10125103 Ga0206356_101251031 167
29 3300025912 Ga0207707_10477547 Ga0207707_104775472 167
30 3300026089 Ga0207648_10389371 Ga0207648_103893712 167
31 3300031239 Ga0265328_10194035 Ga0265328_101940352 167
32 3300031249 Ga0265339_10439093 Ga0265339_104390932 167
33 3300031711 Ga0265314_10536589 Ga0265314_105365891 167
34 3300034816 Ga0373930_0000695 Ga0373930_0000695_3148_3651 167
35 3300034816 Ga0373930_0037028 Ga0373930_0037028_224_727 167
36 3300034817 Ga0373948_0000379 Ga0373948_0000379_1231_1734 167
37 3300035084 Ga0373928_0004261 Ga0373928_0004261_1089_1592 167
38 3300035090 Ga0373949_0012437 Ga0373949_0012437_1364_1867 167
39 3300035112 Ga0373932_0000285 Ga0373932_0000285_848_1351 167
40 3300035691 Ga0373931_0000006 Ga0373931_0000006_404248_404751 167
41 3300035691 Ga0373931_0000114 Ga0373931_0000114_35889_36392 167
42 3300049570 Ga0501033_0000576 Ga0501033_0000576_20204_20707 167
43 3300049572 Ga0501036_0233341 Ga0501036_0233341_186_689 167
44 3300049581 Ga0501047_0207282 Ga0501047_0207282_127_630 167
45 3300049823 Ga0501044_0008125 Ga0501044_0008125_8915_9418 167
46 3300005355 Ga0070671_100013220 Ga0070671_1000132205 168
47 3300006038 Ga0075365_10019749 Ga0075365_100197492 168
48 3300006038 Ga0075365_10105559 Ga0075365_101055591 168
49 3300006051 Ga0075364_10295374 Ga0075364_102953742 168
50 3300006177 Ga0075362_10320108 Ga0075362_103201082 168
51 3300006177 Ga0075362_10507721 Ga0075362_105077211 168
52 3300009094 Ga0111539_10351901 Ga0111539_103519012 168
53 3300014968 Ga0157379_10334757 Ga0157379_103347572 168
54 3300025931 Ga0207644_10005942 Ga0207644_1000594210 168
55 3300031852 Ga0307410_10113382 Ga0307410_101133821 168
56 3300031903 Ga0307407_10015153 Ga0307407_100151531 168
57 3300031995 Ga0307409_100215653 Ga0307409_1002156533 168
58 3300032002 Ga0307416_100061847 Ga0307416_1000618474 168
59 3300032002 Ga0307416_102179531 Ga0307416_1021795311 168
60 3300032004 Ga0307414_10039064 Ga0307414_100390641 168
61 3300032005 Ga0307411_10275064 Ga0307411_102750643 168
62 3300050489 nmdc:mga03683_137938_c1 nmdc:mga03683_137938_c1_54_560 168
63 3300050491 nmdc:mga00v17_194639_c1 nmdc:mga00v17_194639_c1_780_1286 168
64 3300050491 nmdc:mga00v17_43875_c1 nmdc:mga00v17_43875_c1_1841_2347 168
65 3300050492 nmdc:mga0yw44_563_c1 nmdc:mga0yw44_563_c1_6683_7189 168
66 3300050492 nmdc:mga0yw44_8578_c1 nmdc:mga0yw44_8578_c1_1959_2465 168
67 3300005331 Ga0070670_101211490 Ga0070670_1012114901 169
68 3300005719 Ga0068861_100243315 Ga0068861_1002433153 169
69 3300006844 Ga0075428_100174297 Ga0075428_1001742971 169
70 3300021384 Ga0213876_10022128 Ga0213876_100221283 169
71 3300025961 Ga0207712_10956057 Ga0207712_109560572 169
72 3300031852 Ga0307410_10271511 Ga0307410_102715112 169
73 3300031995 Ga0307409_100158715 Ga0307409_1001587152 169
74 3300031995 Ga0307409_100343445 Ga0307409_1003434451 169
75 3300032126 Ga0307415_100193269 Ga0307415_1001932692 169
76 3300032126 Ga0307415_101219587 Ga0307415_1012195872 169
77 3300035724 Ga0373933_0505729 Ga0373933_0505729_251_760 169
78 3300039437 Ga0436365_0641211 Ga0436365_0641211_1744_2253 169
79 3300006038 Ga0075365_10225387 Ga0075365_102253872 170
80 3300049584 Ga0501068_0271133 Ga0501068_0271133_161_673 170
81 3300049744 Ga0501083_0752242 Ga0501083_0752242_91_618 170
82 3300050492 nmdc:mga0yw44_192425_c1 nmdc:mga0yw44_192425_c1_818_1333 170
83 3300050492 nmdc:mga0yw44_653107_c1 nmdc:mga0yw44_653107_c1_150_665 170
84 3300053094 Ga0500566_0002875 Ga0500566_0002875_8332_8847 170
85 3300005354 Ga0070675_100089010 Ga0070675_1000890104 171
86 3300005543 Ga0070672_100715765 Ga0070672_1007157652 171
87 3300005548 Ga0070665_101738805 Ga0070665_1017388051 171
88 3300005843 Ga0068860_101079308 Ga0068860_1010793082 171
89 3300005985 Ga0081539_10013931 Ga0081539_100139312 171
90 3300006358 Ga0068871_101376718 Ga0068871_1013767181 171
91 3300006844 Ga0075428_100078927 Ga0075428_1000789276 171
92 3300006846 Ga0075430_100310900 Ga0075430_1003109002 171
93 3300009094 Ga0111539_10171641 Ga0111539_101716414 171
94 3300009148 Ga0105243_10307182 Ga0105243_103071822 171
95 3300009176 Ga0105242_11079340 Ga0105242_110793402 171
96 3300009553 Ga0105249_12146564 Ga0105249_121465641 171
97 3300011119 Ga0105246_10280976 Ga0105246_102809762 171
98 3300013308 Ga0157375_10881979 Ga0157375_108819792 171
99 3300014969 Ga0157376_11004346 Ga0157376_110043461 171
100 3300025908 Ga0207643_10328857 Ga0207643_103288571 171
101 3300025926 Ga0207659_10079920 Ga0207659_100799203 171
102 3300025934 Ga0207686_10724245 Ga0207686_107242452 171
103 3300025935 Ga0207709_10890682 Ga0207709_108906821 171
104 3300025940 Ga0207691_10449741 Ga0207691_104497412 171
105 3300025942 Ga0207689_10688009 Ga0207689_106880092 171
106 3300025960 Ga0207651_11058779 Ga0207651_110587791 171
107 3300025972 Ga0207668_10865723 Ga0207668_108657232 171
108 3300026089 Ga0207648_10275776 Ga0207648_102757762 171
109 3300026089 Ga0207648_10965775 Ga0207648_109657751 171
110 3300026095 Ga0207676_10663359 Ga0207676_106633592 171
111 3300026121 Ga0207683_10564356 Ga0207683_105643563 171
112 3300031251 Ga0265327_10010660 Ga0265327_100106604 171
113 3300031251 Ga0265327_10012895 Ga0265327_100128955 171
114 3300031665 Ga0316575_10142113 Ga0316575_101421132 171
115 3300035171 Ga0373946_0326841 Ga0373946_0326841_215_730 171
116 3300035398 Ga0316574_0581022 Ga0316574_0581022_135_656 171
117 3300036647 Ga0316582_0147182 Ga0316582_0147182_293_814 171
118 3300046518 Ga0495631_0228949 Ga0495631_0228949_208_723 171
119 3300046616 Ga0495668_0654251 Ga0495668_0654251_25_540 171
120 3300046642 Ga0495634_0752995 Ga0495634_0752995_29_544 171
121 3300046681 Ga0495647_0317649 Ga0495647_0317649_79_594 171
122 3300046694 Ga0495649_0559376 Ga0495649_0559376_31_546 171
123 3300048914 Ga0496111_0366918 Ga0496111_0366918_473_988 171
124 3300048917 Ga0496114_1478229 Ga0496114_1478229_22_537 171
125 3300049571 Ga0501034_0020436 Ga0501034_0020436_996_1511 171
126 3300049572 Ga0501036_0069022 Ga0501036_0069022_2279_2794 171
127 3300049573 Ga0501037_0073872 Ga0501037_0073872_167_682 171
128 3300049579 Ga0501043_0253068 Ga0501043_0253068_175_690 171
129 3300049580 Ga0501046_0030610 Ga0501046_0030610_3443_3958 171
130 3300049581 Ga0501047_0003572 Ga0501047_0003572_11597_12112 171
131 3300049582 Ga0501048_0173423 Ga0501048_0173423_125_640 171
132 3300049586 Ga0501070_0002867 Ga0501070_0002867_2936_3451 171
133 3300049587 Ga0501071_0602391 Ga0501071_0602391_118_639 171
134 3300049742 Ga0501080_0048584 Ga0501080_0048584_3179_3694 171
135 3300049744 Ga0501083_0130147 Ga0501083_0130147_187_702 171
136 3300049823 Ga0501044_0186595 Ga0501044_0186595_837_1352 171
137 3300050507 nmdc:mga05p37_619279_c1 nmdc:mga05p37_619279_c1_554_1075 171
138 3300050509 nmdc:mga0qj67_645835_c1 nmdc:mga0qj67_645835_c1_130_651 171
139 3300050511 nmdc:mga08y16_124124_c1 nmdc:mga08y16_124124_c1_1993_2514 171
140 3300053085 Ga0495619_0232336 Ga0495619_0232336_685_1200 171
141 3300060353 Ga0501082_0189408 Ga0501082_0189408_777_1292 171
142 3300031251 Ga0265327_10139319 Ga0265327_101393191 172
143 3300046454 Ga0495592_0091178 Ga0495592_0091178_1165_1749 173
144 3300046462 Ga0495651_0477843 Ga0495651_0477843_162_746 173
145 3300046463 Ga0495653_0360204 Ga0495653_0360204_314_898 173
146 3300046511 Ga0495608_0101102 Ga0495608_0101102_931_1515 173
147 3300046516 Ga0495628_0384116 Ga0495628_0384116_183_767 173
148 3300046663 Ga0495635_0296864 Ga0495635_0296864_164_748 173
149 3300048916 Ga0496113_0451328 Ga0496113_0451328_196_756 173
150 3300053084 Ga0495595_0043729 Ga0495595_0043729_488_1072 173
151 3300048904 Ga0496101_0437176 Ga0496101_0437176_451_975 174
152 3300048908 Ga0496105_0124406 Ga0496105_0124406_17_541 174
153 3300006846 Ga0075430_100872430 Ga0075430_1008724302 177
154 3300046473 Ga0495582_0163679 Ga0495582_0163679_656_1219 177
155 3300050509 nmdc:mga0qj67_24148_c1 nmdc:mga0qj67_24148_c1_2074_2607 177
156 3300046517 Ga0495630_0671923 Ga0495630_0671923_127_663 178
157 3300053077 Ga0495601_0121146 Ga0495601_0121146_361_912 178
158 3300005937 Ga0081455_10214205 Ga0081455_102142053 179
159 3300014326 Ga0157380_10600213 Ga0157380_106002131 179
160 3300014326 Ga0157380_11335390 Ga0157380_113353902 179
161 3300044684 Ga0466966_0181498 Ga0466966_0181498_225_788 179
162 3300046454 Ga0495592_0296894 Ga0495592_0296894_117_665 179
163 3300046461 Ga0495641_0215111 Ga0495641_0215111_204_743 179
164 3300046517 Ga0495630_0046344 Ga0495630_0046344_1969_2517 179
165 3300046533 Ga0495640_0072209 Ga0495640_0072209_1115_1663 179
166 3300046689 Ga0495613_0157593 Ga0495613_0157593_778_1326 179
167 3300046809 Ga0495600_0295395 Ga0495600_0295395_285_833 179
168 3300047317 Ga0495604_0168099 Ga0495604_0168099_677_1225 179
169 3300047319 Ga0495674_0178396 Ga0495674_0178396_277_825 179
170 3300047322 Ga0495680_0146761 Ga0495680_0146761_797_1345 179
171 3300048904 Ga0496101_0349595 Ga0496101_0349595_214_753 179
172 3300048912 Ga0496109_0420181 Ga0496109_0420181_236_775 179
173 3300049575 Ga0501039_1015972 Ga0501039_1015972_74_613 179
174 3300053084 Ga0495595_0093582 Ga0495595_0093582_280_828 179
175 3300053085 Ga0495619_0057652 Ga0495619_0057652_1955_2503 179
176 3300005329 Ga0070683_100981687 Ga0070683_1009816871 180
177 3300005437 Ga0070710_10580010 Ga0070710_105800101 180
178 3300005456 Ga0070678_100638432 Ga0070678_1006384322 180
179 3300005458 Ga0070681_10343391 Ga0070681_103433911 180
180 3300006028 Ga0070717_10514921 Ga0070717_105149212 180
181 3300006051 Ga0075364_10325228 Ga0075364_103252282 180
182 3300006051 Ga0075364_10737300 Ga0075364_107373002 180
183 3300006163 Ga0070715_10166334 Ga0070715_101663342 180
184 3300009093 Ga0105240_10803456 Ga0105240_108034562 180
185 3300025898 Ga0207692_10363741 Ga0207692_103637412 180
186 3300025905 Ga0207685_10201727 Ga0207685_102017272 180
187 3300025916 Ga0207663_10319742 Ga0207663_103197423 180
188 3300025928 Ga0207700_10565556 Ga0207700_105655562 180
189 3300028379 Ga0268266_10504923 Ga0268266_105049233 180
190 3300028654 Ga0265322_10057143 Ga0265322_100571432 180
191 3300035113 Ga0373936_0098505 Ga0373936_0098505_171_716 180
192 3300046463 Ga0495653_0017139 Ga0495653_0017139_5302_5847 180
193 3300046463 Ga0495653_0477959 Ga0495653_0477959_72_614 180
194 3300046473 Ga0495582_0036567 Ga0495582_0036567_61_606 180
195 3300046511 Ga0495608_0215722 Ga0495608_0215722_169_714 180
196 3300046516 Ga0495628_0115386 Ga0495628_0115386_1476_2021 180
197 3300046517 Ga0495630_0019826 Ga0495630_0019826_4029_4574 180
198 3300046533 Ga0495640_0122522 Ga0495640_0122522_809_1351 180
199 3300046536 Ga0495587_0286379 Ga0495587_0286379_300_842 180
200 3300046559 Ga0495667_0148875 Ga0495667_0148875_748_1293 180
201 3300046683 Ga0495658_0030836 Ga0495658_0030836_1611_2156 180
202 3300046689 Ga0495613_0097913 Ga0495613_0097913_728_1273 180
203 3300047317 Ga0495604_0121465 Ga0495604_0121465_789_1331 180
204 3300047444 Ga0495675_0049215 Ga0495675_0049215_2096_2641 180
205 3300047471 Ga0495684_0220582 Ga0495684_0220582_155_700 180
206 3300048903 Ga0496100_0057860 Ga0496100_0057860_1180_1722 180
207 3300048903 Ga0496100_0288036 Ga0496100_0288036_611_1153 180
208 3300048904 Ga0496101_0044535 Ga0496101_0044535_360_911 180
209 3300048904 Ga0496101_0142399 Ga0496101_0142399_394_936 180
210 3300048905 Ga0496102_0007629 Ga0496102_0007629_4835_5377 180
211 3300048906 Ga0496103_0117673 Ga0496103_0117673_1066_1608 180
212 3300048907 Ga0496104_0013787 Ga0496104_0013787_6086_6628 180
213 3300048907 Ga0496104_0064248 Ga0496104_0064248_505_1047 180
214 3300048908 Ga0496105_0013176 Ga0496105_0013176_4813_5355 180
215 3300048909 Ga0496106_0067975 Ga0496106_0067975_1180_1722 180
216 3300048910 Ga0496107_0070065 Ga0496107_0070065_1275_1817 180
217 3300048918 Ga0496115_0016463 Ga0496115_0016463_351_893 180
218 3300050491 nmdc:mga00v17_356896_c1 nmdc:mga00v17_356896_c1_55_600 180
219 3300050491 nmdc:mga00v17_653529_c1 nmdc:mga00v17_653529_c1_73_618 180
220 3300053077 Ga0495601_0295740 Ga0495601_0295740_385_936 180
221 3300053084 Ga0495595_0084193 Ga0495595_0084193_936_1478 180
222 3300053084 Ga0495595_0090866 Ga0495595_0090866_391_936 180
223 3300053085 Ga0495619_0034661 Ga0495619_0034661_1658_2200 180
224 3300053085 Ga0495619_0188719 Ga0495619_0188719_350_895 180
225 3300053085 Ga0495619_0785806 Ga0495619_0785806_86_628 180

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j16-assembly2.cif.gz_B apo & sulphate bound forms of sdp-1 0.8215 14 166
7jvx-assembly1.cif.gz_A crystal structure of pten (aa 7-353 followed by spacer tgggsggtgggsggtgggcy ligated to peptide psdptptdpsdpenepfded) 0.8142 12 163
3emu-assembly1.cif.gz_A crystal structure of a leucine rich repeat and phosphatase domain containing protein from entamoeba histolytica 0.8124 14 165
2j17-assembly1.cif.gz_A ptyr bound form of sdp-1 0.8091 14 166
5z5a-assembly3.cif.gz_C crystal structure of tk-ptp in the active form 0.8057 13 165
ID Description Score Start End Superfamily
3emuA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8124 14 165 3.90.190.10
af_Q7XC53_86_235_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8086 14 164 3.90.190.10
af_F1R5W3_136_290_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7945 9 165 3.90.190.10
1fpzC00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7936 11 167 3.90.190.10
5z5aA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7889 13 164 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A6I3DHS1-F1-model_v4 Uncharacterized protein 0.9697 17 168
AF-A0A6N9EXH7-F1-model_v4 Tyrosine specific protein phosphatases domain-containing protein 0.9661 1 164
AF-A0A7W1TX46-F1-model_v4 Phosphatase 0.9608 9 165
AF-A0A7Y3KWV0-F1-model_v4 Uncharacterized protein 0.9576 1 161
AF-A0A2E6DLV9-F1-model_v4 Tyrosine specific protein phosphatases domain-containing protein 0.9575 1 164

Feature Viewer

pLDDT pTM Quality
90.18 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map