F337805
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 134 | 225 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10389875|Ga0163163_103898752 |
| Length | 286 |
| Sequence | MKIFLVRLLSGANNGRLPHRNSRFGKTGFYRFVQNQMEQMSLAVSIRDLSFGYKGQIKKNFSHLNLEINKGERFGIFGPNGAGKTTLMNLMTGLLDYETGSIKILNKEIKTNKKSINRVSGFVPQDFSFYHELSPSENLEFFGAWSGLNKQIIQTKIKELLDILGLWDVRHKPVQKFSGGMKRRVNLAIAVMNEPAILFLDEPTVGVDVQTRHAMINYLKELNAKGTTLIYTSHQLSEAEDLCNTIALIDDGKIIANDPLEKLLNEHQQEGLEGLFLNLTGKEFRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 114 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 117 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 132 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 133 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 134 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.89 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 88.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10003843 | 3300002067 | Bacteria | 5085 |
| 2 | JGI25165J46597_1000957 | 3300003214 | Bacteria | 19672 |
| 3 | rootH2_10061387 | 3300003320 | Bacteria | 4991 |
| 4 | rootH2_10094371 | 3300003320 | Bacteria | 4030 |
| 5 | rootH2_10116599 | 3300003320 | Bacteria | 1569 |
| 6 | rootH1_10000566 | 3300003316 | Bacteria | 33162 |
| 7 | rootH1_10000566 | 3300003323 | Bacteria | 205679 |
| 8 | rootH1_10247096 | 3300003323 | Unclassified | 1460 |
| 9 | rootH1_10328624 | 3300003323 | Bacteria | 3567 |
| 10 | Ga0070658_10000075 | 3300005327 | Bacteria | 95412 |
| 11 | Ga0070658_10066481 | 3300005327 | Bacteria | 2945 |
| 12 | Ga0070677_10084733 | 3300005333 | Bacteria | 1365 |
| 13 | Ga0068869_100187785 | 3300005334 | Bacteria | 1623 |
| 14 | Ga0068869_100283641 | 3300005334 | Bacteria | 1332 |
| 15 | Ga0070680_100011377 | 3300005336 | Bacteria | 6882 |
| 16 | Ga0070682_100000106 | 3300005337 | Bacteria | 74029 |
| 17 | Ga0068868_100015137 | 3300005338 | Bacteria | 5699 |
| 18 | Ga0070660_100008755 | 3300005339 | Bacteria | 7088 |
| 19 | Ga0070660_100032947 | 3300005339 | Bacteria | 3903 |
| 20 | Ga0070660_100056591 | 3300005339 | Bacteria | 3034 |
| 21 | Ga0070668_100166981 | 3300005347 | Bacteria | 1789 |
| 22 | Ga0070669_100039820 | 3300005353 | Bacteria | 3415 |
| 23 | Ga0070675_100086939 | 3300005354 | Bacteria | 2614 |
| 24 | Ga0070671_100155003 | 3300005355 | Bacteria | 1935 |
| 25 | Ga0070674_100066776 | 3300005356 | Bacteria | 2528 |
| 26 | Ga0070659_100001045 | 3300005366 | Bacteria | 20218 |
| 27 | Ga0070659_100016831 | 3300005366 | Bacteria | 5493 |
| 28 | Ga0070667_100015079 | 3300005367 | Bacteria | 6384 |
| 29 | Ga0070667_100094702 | 3300005367 | Bacteria | 2573 |
| 30 | Ga0070667_100358789 | 3300005367 | Bacteria | 1321 |
| 31 | Ga0070667_100712460 | 3300005367 | Unclassified | 929 |
| 32 | Ga0070663_100013428 | 3300005455 | Bacteria | 5223 |
| 33 | Ga0070662_100000167 | 3300005457 | Bacteria | 38204 |
| 34 | Ga0070681_10035380 | 3300005458 | Bacteria | 5017 |
| 35 | Ga0068867_100017794 | 3300005459 | Bacteria | 5047 |
| 36 | Ga0068867_100021893 | 3300005459 | Bacteria | 4565 |
| 37 | Ga0068867_100071773 | 3300005459 | Bacteria | 2590 |
| 38 | Ga0070679_100097257 | 3300005530 | Bacteria | 2931 |
| 39 | Ga0070679_100348747 | 3300005530 | Bacteria | 1428 |
| 40 | Ga0068853_100096833 | 3300005539 | Bacteria | 2604 |
| 41 | Ga0068853_100241188 | 3300005539 | Bacteria | 1657 |
| 42 | Ga0070672_100042980 | 3300005543 | Bacteria | 3481 |
| 43 | Ga0070672_100370951 | 3300005543 | Bacteria | 1223 |
| 44 | Ga0070665_100328567 | 3300005548 | Bacteria | 1533 |
| 45 | Ga0068855_100132046 | 3300005563 | Bacteria | 2851 |
| 46 | Ga0068855_100423367 | 3300005563 | Bacteria | 1456 |
| 47 | Ga0068855_100446774 | 3300005563 | Bacteria | 1411 |
| 48 | Ga0068857_100013369 | 3300005577 | Bacteria | 7149 |
| 49 | Ga0068856_100000044 | 3300005614 | Bacteria | 111437 |
| 50 | Ga0068856_100003367 | 3300005614 | Bacteria | 16201 |
| 51 | Ga0068856_100020596 | 3300005614 | Bacteria | 6408 |
| 52 | Ga0068856_100240828 | 3300005614 | Bacteria | 1824 |
| 53 | Ga0068856_100581331 | 3300005614 | Bacteria | 1141 |
| 54 | Ga0068852_100091369 | 3300005616 | Bacteria | 2724 |
| 55 | Ga0068852_100443888 | 3300005616 | Unclassified | 1283 |
| 56 | Ga0068864_100255213 | 3300005618 | Bacteria | 1629 |
| 57 | Ga0068861_100107273 | 3300005719 | Bacteria | 2233 |
| 58 | Ga0068861_100192773 | 3300005719 | Bacteria | 1705 |
| 59 | Ga0068870_10102879 | 3300005840 | Bacteria | 1618 |
| 60 | Ga0068860_100048712 | 3300005843 | Bacteria | 4038 |
| 61 | Ga0068860_100228327 | 3300005843 | Bacteria | 1809 |
| 62 | Ga0068862_100698182 | 3300005844 | Bacteria | 983 |
| 63 | Ga0068871_100387774 | 3300006358 | Bacteria | 1242 |
| 64 | Ga0068865_100088082 | 3300006881 | Bacteria | 2245 |
| 65 | Ga0105240_10004296 | 3300009093 | Bacteria | 21764 |
| 66 | Ga0105240_10009293 | 3300009093 | Bacteria | 13938 |
| 67 | Ga0105240_10012464 | 3300009093 | Bacteria | 11730 |
| 68 | Ga0105240_10054067 | 3300009093 | Bacteria | 5034 |
| 69 | Ga0105240_10588742 | 3300009093 | Unclassified | 1226 |
| 70 | Ga0105243_10437701 | 3300009148 | Bacteria | 1223 |
| 71 | Ga0105241_10003945 | 3300009174 | Bacteria | 10980 |
| 72 | Ga0105241_10141537 | 3300009174 | Bacteria | 1959 |
| 73 | Ga0105241_10198700 | 3300009174 | Bacteria | 1673 |
| 74 | Ga0105242_10067742 | 3300009176 | Bacteria | 2952 |
| 75 | Ga0105237_10002306 | 3300009545 | Bacteria | 23725 |
| 76 | Ga0105237_10070166 | 3300009545 | Unclassified | 3499 |
| 77 | Ga0105238_10242144 | 3300009551 | Bacteria | 1781 |
| 78 | Ga0105249_10045567 | 3300009553 | Bacteria | 3989 |
| 79 | Ga0105249_10176537 | 3300009553 | Bacteria | 2075 |
| 80 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 81 | Ga0105239_10005880 | 3300010375 | Bacteria | 14296 |
| 82 | Ga0105239_10022848 | 3300010375 | Bacteria | 6895 |
| 83 | Ga0105239_10144729 | 3300010375 | Bacteria | 2650 |
| 84 | Ga0105246_10009185 | 3300011119 | Bacteria | 6088 |
| 85 | Ga0105246_10018868 | 3300011119 | Bacteria | 4398 |
| 86 | Ga0105246_10316076 | 3300011119 | Bacteria | 1267 |
| 87 | Ga0157373_10024983 | 3300013100 | Bacteria | 4325 |
| 88 | Ga0157373_10227069 | 3300013100 | Unclassified | 1318 |
| 89 | Ga0157371_10000269 | 3300013102 | Bacteria | 70787 |
| 90 | Ga0157371_10001621 | 3300013102 | Bacteria | 23010 |
| 91 | Ga0157370_10204815 | 3300013104 | Bacteria | 1830 |
| 92 | Ga0157370_10213693 | 3300013104 | Bacteria | 1787 |
| 93 | Ga0157370_10652467 | 3300013104 | Bacteria | 962 |
| 94 | Ga0157369_10012411 | 3300013105 | Bacteria | 9671 |
| 95 | Ga0157374_10004549 | 3300013296 | Bacteria | 11638 |
| 96 | Ga0157374_10017006 | 3300013296 | Bacteria | 6403 |
| 97 | Ga0157374_10117302 | 3300013296 | Bacteria | 2565 |
| 98 | Ga0157378_10299187 | 3300013297 | Bacteria | 1557 |
| 99 | Ga0157378_10419204 | 3300013297 | Bacteria | 1323 |
| 100 | Ga0157378_10587912 | 3300013297 | Bacteria | 1123 |
| 101 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 102 | Ga0157372_10001087 | 3300013307 | Bacteria | 29605 |
| 103 | Ga0157372_10010312 | 3300013307 | Bacteria | 9928 |
| 104 | Ga0157372_10121427 | 3300013307 | Bacteria | 3001 |
| 105 | Ga0157375_10092151 | 3300013308 | Bacteria | 3093 |
| 106 | Ga0157375_10164053 | 3300013308 | Bacteria | 2365 |
| 107 | Ga0157375_10235058 | 3300013308 | Bacteria | 1992 |
| 108 | Ga0157375_10315431 | 3300013308 | Bacteria | 1728 |
| 109 | Ga0163163_10332194 | 3300014325 | Bacteria | 1575 |
| 110 | Ga0163163_10389875 | 3300014325 | Bacteria | 1451 |
| 111 | Ga0157376_10540307 | 3300014969 | Bacteria | 1152 |
| 112 | Ga0213872_10013116 | 3300021361 | Bacteria | 3885 |
| 113 | Ga0209563_109127 | 3300025230 | Unclassified | 1521 |
| 114 | Ga0207427_100093 | 3300025231 | Bacteria | 125910 |
| 115 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 116 | Ga0209026_1000930 | 3300025250 | Bacteria | 14845 |
| 117 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 118 | Ga0209233_1001440 | 3300025261 | Bacteria | 9392 |
| 119 | Ga0209455_1010329 | 3300025272 | Bacteria | 2379 |
| 120 | Ga0207688_10021799 | 3300025901 | Bacteria | 3503 |
| 121 | Ga0207680_10258545 | 3300025903 | Bacteria | 1204 |
| 122 | Ga0207647_10000209 | 3300025904 | Bacteria | 47604 |
| 123 | Ga0207647_10000463 | 3300025904 | Bacteria | 32923 |
| 124 | Ga0207645_10006683 | 3300025907 | Bacteria | 8237 |
| 125 | Ga0207643_10010665 | 3300025908 | Bacteria | 4952 |
| 126 | Ga0207705_10000102 | 3300025909 | Bacteria | 98105 |
| 127 | Ga0207705_10092508 | 3300025909 | Bacteria | 2216 |
| 128 | Ga0207654_10008073 | 3300025911 | Bacteria | 5305 |
| 129 | Ga0207654_10075746 | 3300025911 | Bacteria | 2012 |
| 130 | Ga0207654_10119153 | 3300025911 | Bacteria | 1654 |
| 131 | Ga0207707_10340400 | 3300025912 | Bacteria | 1293 |
| 132 | Ga0207695_10006768 | 3300025913 | Bacteria | 14780 |
| 133 | Ga0207695_10008363 | 3300025913 | Bacteria | 12962 |
| 134 | Ga0207695_10044680 | 3300025913 | Bacteria | 4709 |
| 135 | Ga0207695_10224615 | 3300025913 | Bacteria | 1784 |
| 136 | Ga0207671_10002483 | 3300025914 | Bacteria | 19710 |
| 137 | Ga0207671_10076709 | 3300025914 | Bacteria | 2501 |
| 138 | Ga0207671_10381967 | 3300025914 | Bacteria | 1119 |
| 139 | Ga0207660_10053988 | 3300025917 | Bacteria | 2866 |
| 140 | Ga0207660_10320987 | 3300025917 | Bacteria | 1237 |
| 141 | Ga0207657_10036426 | 3300025919 | Bacteria | 4403 |
| 142 | Ga0207657_10093174 | 3300025919 | Bacteria | 2509 |
| 143 | Ga0207652_10075892 | 3300025921 | Bacteria | 2930 |
| 144 | Ga0207652_10125046 | 3300025921 | Bacteria | 2290 |
| 145 | Ga0207681_10105412 | 3300025923 | Bacteria | 2041 |
| 146 | Ga0207694_10309872 | 3300025924 | Bacteria | 1301 |
| 147 | Ga0207659_10320075 | 3300025926 | Bacteria | 1279 |
| 148 | Ga0207644_10186790 | 3300025931 | Unclassified | 1628 |
| 149 | Ga0207690_10000770 | 3300025932 | Bacteria | 20723 |
| 150 | Ga0207690_10003147 | 3300025932 | Bacteria | 9907 |
| 151 | Ga0207706_10000257 | 3300025933 | Bacteria | 57965 |
| 152 | Ga0207669_10296045 | 3300025937 | Bacteria | 1228 |
| 153 | Ga0207704_10407698 | 3300025938 | Bacteria | 1074 |
| 154 | Ga0207691_10055552 | 3300025940 | Bacteria | 3608 |
| 155 | Ga0207689_10000466 | 3300025942 | Bacteria | 37961 |
| 156 | Ga0207689_10004188 | 3300025942 | Bacteria | 13113 |
| 157 | Ga0207689_10132044 | 3300025942 | Unclassified | 2055 |
| 158 | Ga0207667_10006040 | 3300025949 | Bacteria | 14732 |
| 159 | Ga0207667_10053592 | 3300025949 | Bacteria | 4244 |
| 160 | Ga0207667_10073635 | 3300025949 | Bacteria | 3549 |
| 161 | Ga0207667_10768432 | 3300025949 | Bacteria | 962 |
| 162 | Ga0207667_10829396 | 3300025949 | Bacteria | 920 |
| 163 | Ga0207651_10173999 | 3300025960 | Bacteria | 1701 |
| 164 | Ga0207668_10316898 | 3300025972 | Unclassified | 1293 |
| 165 | Ga0207640_10301986 | 3300025981 | Bacteria | 1267 |
| 166 | Ga0207677_10183032 | 3300026023 | Unclassified | 1650 |
| 167 | Ga0207639_10261485 | 3300026041 | Bacteria | 1514 |
| 168 | Ga0207678_10024761 | 3300026067 | Bacteria | 5240 |
| 169 | Ga0207702_10000140 | 3300026078 | Bacteria | 87544 |
| 170 | Ga0207702_10021409 | 3300026078 | Bacteria | 5353 |
| 171 | Ga0207702_10067127 | 3300026078 | Bacteria | 3077 |
| 172 | Ga0207702_10662411 | 3300026078 | Bacteria | 1027 |
| 173 | Ga0207648_10004023 | 3300026089 | Bacteria | 15260 |
| 174 | Ga0207648_10444503 | 3300026089 | Bacteria | 1180 |
| 175 | Ga0207674_10054578 | 3300026116 | Bacteria | 4067 |
| 176 | Ga0207674_10455884 | 3300026116 | Bacteria | 1236 |
| 177 | Ga0207675_100016499 | 3300026118 | Bacteria | 6896 |
| 178 | Ga0207675_100018172 | 3300026118 | Bacteria | 6556 |
| 179 | Ga0207675_100824401 | 3300026118 | Bacteria | 942 |
| 180 | Ga0207683_10005934 | 3300026121 | Bacteria | 10469 |
| 181 | Ga0207683_10099198 | 3300026121 | Bacteria | 2599 |
| 182 | Ga0268264_10163883 | 3300028381 | Unclassified | 2005 |
| 183 | Ga0268264_10187743 | 3300028381 | Bacteria | 1882 |
| 184 | Ga0268264_10366950 | 3300028381 | Bacteria | 1375 |
| 185 | Ga0307517_10003309 | 3300028786 | Bacteria | 25165 |
| 186 | Ga0307511_10000104 | 3300030521 | Bacteria | 75069 |
| 187 | Ga0307509_10002733 | 3300031507 | Bacteria | 28113 |
| 188 | Ga0307509_10126152 | 3300031507 | Bacteria | 2525 |
| 189 | Ga0307516_10003007 | 3300031730 | Bacteria | 22014 |
| 190 | Ga0307412_10340118 | 3300031911 | Bacteria | 1201 |
| 191 | Ga0307510_10003634 | 3300033180 | Bacteria | 18006 |
| 192 | Ga0373935_0186061 | 3300035692 | Bacteria | 1428 |
| 193 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 194 | Ga0395899_0002957 | 3300037312 | Bacteria | 13598 |
| 195 | Ga0395899_0046863 | 3300037312 | Bacteria | 3219 |
| 196 | Ga0395900_0000327 | 3300037418 | Bacteria | 70365 |
| 197 | Ga0395900_0024302 | 3300037418 | Bacteria | 6205 |
| 198 | Ga0395900_0060434 | 3300037418 | Bacteria | 3900 |
| 199 | Ga0395905_0001887 | 3300037471 | Bacteria | 24161 |
| 200 | Ga0436365_0130893 | 3300039437 | Bacteria | 2491 |
| 201 | Ga0436361_0773655 | 3300039447 | Bacteria | 3958 |
| 202 | Ga0439445_0052048 | 3300042004 | Unclassified | 1107 |
| 203 | Ga0466969_0041576 | 3300044656 | Bacteria | 2299 |
| 204 | Ga0466966_0014474 | 3300044684 | Bacteria | 5221 |
| 205 | Ga0466959_0051529 | 3300045049 | Bacteria | 3018 |
| 206 | Ga0495631_0007451 | 3300046518 | Bacteria | 5561 |
| 207 | Ga0495625_0134153 | 3300046660 | Bacteria | 1675 |
| 208 | Ga0495661_0008787 | 3300046665 | Bacteria | 6969 |
| 209 | Ga0495661_0021254 | 3300046665 | Bacteria | 4233 |
| 210 | Ga0495649_0107191 | 3300046694 | Unclassified | 1483 |
| 211 | Ga0495687_015885 | 3300047443 | Bacteria | 3807 |
| 212 | Ga0495675_0172480 | 3300047444 | Unclassified | 1328 |
| 213 | Ga0495686_0092254 | 3300047472 | Bacteria | 1837 |
| 214 | Ga0501032_0441311 | 3300049569 | Bacteria | 834 |
| 215 | Ga0501034_0021131 | 3300049571 | Bacteria | 6640 |
| 216 | Ga0501034_0807581 | 3300049571 | Bacteria | 830 |
| 217 | Ga0501037_0019936 | 3300049573 | Bacteria | 4949 |
| 218 | Ga0501043_0076249 | 3300049579 | Bacteria | 2634 |
| 219 | Ga0501047_0055092 | 3300049581 | Bacteria | 3846 |
| 220 | Ga0501070_0032817 | 3300049586 | Bacteria | 4344 |
| 221 | Ga0501035_0394213 | 3300049822 | Bacteria | 1153 |
| 222 | Ga0500635_0018444 | 3300053080 | Bacteria | 2106 |
| 223 | Ga0500583_0000075 | 3300053092 | Bacteria | 59561 |
| 224 | Ga0500556_0090588 | 3300053104 | Bacteria | 1167 |
| 225 | Ga0500562_077214 | 3300053108 | Bacteria | 900 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0092254 | Ga0495686_0092254_623_1327 | 234 |
| 2 | iso_pu_bacteria | 2890804823 | 2890805458 | 241 |
| 3 | 3300005459 | Ga0068867_100071773 | Ga0068867_1000717732 | 246 |
| 4 | 3300005843 | Ga0068860_100228327 | Ga0068860_1002283271 | 246 |
| 5 | 3300026089 | Ga0207648_10444503 | Ga0207648_104445032 | 246 |
| 6 | 3300026116 | Ga0207674_10455884 | Ga0207674_104558842 | 246 |
| 7 | 3300026118 | Ga0207675_100824401 | Ga0207675_1008244011 | 246 |
| 8 | 3300028381 | Ga0268264_10366950 | Ga0268264_103669501 | 246 |
| 9 | 3300031507 | Ga0307509_10002733 | Ga0307509_100027339 | 246 |
| 10 | 3300049569 | Ga0501032_0441311 | Ga0501032_0441311_30_773 | 246 |
| 11 | 3300049571 | Ga0501034_0807581 | Ga0501034_0807581_75_818 | 246 |
| 12 | 3300049573 | Ga0501037_0019936 | Ga0501037_0019936_1313_2056 | 246 |
| 13 | 3300049586 | Ga0501070_0032817 | Ga0501070_0032817_2709_3452 | 246 |
| 14 | 3300003320 | rootH2_10094371 | rootH2_100943712 | 247 |
| 15 | 3300005327 | Ga0070658_10066481 | Ga0070658_100664812 | 247 |
| 16 | 3300005333 | Ga0070677_10084733 | Ga0070677_100847332 | 247 |
| 17 | 3300005334 | Ga0068869_100187785 | Ga0068869_1001877852 | 247 |
| 18 | 3300005334 | Ga0068869_100283641 | Ga0068869_1002836412 | 247 |
| 19 | 3300005338 | Ga0068868_100015137 | Ga0068868_1000151374 | 247 |
| 20 | 3300005347 | Ga0070668_100166981 | Ga0070668_1001669812 | 247 |
| 21 | 3300005353 | Ga0070669_100039820 | Ga0070669_1000398204 | 247 |
| 22 | 3300005354 | Ga0070675_100086939 | Ga0070675_1000869394 | 247 |
| 23 | 3300005356 | Ga0070674_100066776 | Ga0070674_1000667762 | 247 |
| 24 | 3300005367 | Ga0070667_100015079 | Ga0070667_1000150792 | 247 |
| 25 | 3300005367 | Ga0070667_100094702 | Ga0070667_1000947022 | 247 |
| 26 | 3300005367 | Ga0070667_100358789 | Ga0070667_1003587891 | 247 |
| 27 | 3300005459 | Ga0068867_100017794 | Ga0068867_1000177945 | 247 |
| 28 | 3300005459 | Ga0068867_100021893 | Ga0068867_1000218934 | 247 |
| 29 | 3300005539 | Ga0068853_100096833 | Ga0068853_1000968333 | 247 |
| 30 | 3300005543 | Ga0070672_100042980 | Ga0070672_1000429805 | 247 |
| 31 | 3300005548 | Ga0070665_100328567 | Ga0070665_1003285672 | 247 |
| 32 | 3300005616 | Ga0068852_100091369 | Ga0068852_1000913693 | 247 |
| 33 | 3300005618 | Ga0068864_100255213 | Ga0068864_1002552132 | 247 |
| 34 | 3300005719 | Ga0068861_100107273 | Ga0068861_1001072732 | 247 |
| 35 | 3300005719 | Ga0068861_100192773 | Ga0068861_1001927732 | 247 |
| 36 | 3300005840 | Ga0068870_10102879 | Ga0068870_101028791 | 247 |
| 37 | 3300005843 | Ga0068860_100048712 | Ga0068860_1000487125 | 247 |
| 38 | 3300005844 | Ga0068862_100698182 | Ga0068862_1006981822 | 247 |
| 39 | 3300006358 | Ga0068871_100387774 | Ga0068871_1003877741 | 247 |
| 40 | 3300006881 | Ga0068865_100088082 | Ga0068865_1000880822 | 247 |
| 41 | 3300009093 | Ga0105240_10588742 | Ga0105240_105887422 | 247 |
| 42 | 3300009148 | Ga0105243_10437701 | Ga0105243_104377012 | 247 |
| 43 | 3300009553 | Ga0105249_10176537 | Ga0105249_101765372 | 247 |
| 44 | 3300011119 | Ga0105246_10316076 | Ga0105246_103160762 | 247 |
| 45 | 3300013296 | Ga0157374_10017006 | Ga0157374_100170065 | 247 |
| 46 | 3300013297 | Ga0157378_10587912 | Ga0157378_105879122 | 247 |
| 47 | 3300014325 | Ga0163163_10332194 | Ga0163163_103321942 | 247 |
| 48 | 3300025901 | Ga0207688_10021799 | Ga0207688_100217994 | 247 |
| 49 | 3300025903 | Ga0207680_10258545 | Ga0207680_102585452 | 247 |
| 50 | 3300025907 | Ga0207645_10006683 | Ga0207645_100066831 | 247 |
| 51 | 3300025908 | Ga0207643_10010665 | Ga0207643_100106655 | 247 |
| 52 | 3300025923 | Ga0207681_10105412 | Ga0207681_101054122 | 247 |
| 53 | 3300025926 | Ga0207659_10320075 | Ga0207659_103200752 | 247 |
| 54 | 3300025938 | Ga0207704_10407698 | Ga0207704_104076981 | 247 |
| 55 | 3300025940 | Ga0207691_10055552 | Ga0207691_100555522 | 247 |
| 56 | 3300025942 | Ga0207689_10000466 | Ga0207689_1000046631 | 247 |
| 57 | 3300025942 | Ga0207689_10004188 | Ga0207689_100041886 | 247 |
| 58 | 3300025942 | Ga0207689_10132044 | Ga0207689_101320442 | 247 |
| 59 | 3300025960 | Ga0207651_10173999 | Ga0207651_101739992 | 247 |
| 60 | 3300025972 | Ga0207668_10316898 | Ga0207668_103168982 | 247 |
| 61 | 3300025981 | Ga0207640_10301986 | Ga0207640_103019862 | 247 |
| 62 | 3300026089 | Ga0207648_10004023 | Ga0207648_100040238 | 247 |
| 63 | 3300026118 | Ga0207675_100016499 | Ga0207675_1000164998 | 247 |
| 64 | 3300026118 | Ga0207675_100018172 | Ga0207675_1000181722 | 247 |
| 65 | 3300026121 | Ga0207683_10005934 | Ga0207683_100059348 | 247 |
| 66 | 3300028381 | Ga0268264_10163883 | Ga0268264_101638832 | 247 |
| 67 | 3300028381 | Ga0268264_10187743 | Ga0268264_101877432 | 247 |
| 68 | 3300039437 | Ga0436365_0130893 | Ga0436365_0130893_331_1074 | 247 |
| 69 | 3300049571 | Ga0501034_0021131 | Ga0501034_0021131_5877_6620 | 247 |
| 70 | 3300049579 | Ga0501043_0076249 | Ga0501043_0076249_1744_2487 | 247 |
| 71 | 3300049581 | Ga0501047_0055092 | Ga0501047_0055092_2583_3326 | 247 |
| 72 | 3300049822 | Ga0501035_0394213 | Ga0501035_0394213_251_994 | 247 |
| 73 | 3300003323 | rootH1_10247096 | rootH1_102470961 | 248 |
| 74 | 3300005337 | Ga0070682_100000106 | Ga0070682_10000010612 | 248 |
| 75 | 3300005455 | Ga0070663_100013428 | Ga0070663_1000134282 | 248 |
| 76 | 3300005614 | Ga0068856_100581331 | Ga0068856_1005813311 | 248 |
| 77 | 3300005616 | Ga0068852_100443888 | Ga0068852_1004438882 | 248 |
| 78 | 3300013102 | Ga0157371_10001621 | Ga0157371_100016216 | 248 |
| 79 | 3300013104 | Ga0157370_10213693 | Ga0157370_102136932 | 248 |
| 80 | 3300013104 | Ga0157370_10652467 | Ga0157370_106524671 | 248 |
| 81 | 3300013105 | Ga0157369_10012411 | Ga0157369_100124119 | 248 |
| 82 | 3300013307 | Ga0157372_10000009 | Ga0157372_10000009110 | 248 |
| 83 | 3300013308 | Ga0157375_10315431 | Ga0157375_103154312 | 248 |
| 84 | 3300025931 | Ga0207644_10186790 | Ga0207644_101867902 | 248 |
| 85 | 3300026067 | Ga0207678_10024761 | Ga0207678_100247615 | 248 |
| 86 | 3300026078 | Ga0207702_10662411 | Ga0207702_106624111 | 248 |
| 87 | 3300026121 | Ga0207683_10099198 | Ga0207683_100991982 | 248 |
| 88 | 3300030521 | Ga0307511_10000104 | Ga0307511_100001046 | 248 |
| 89 | 3300031730 | Ga0307516_10003007 | Ga0307516_100030074 | 248 |
| 90 | 3300037312 | Ga0395899_0002957 | Ga0395899_0002957_10081_10827 | 248 |
| 91 | 3300044656 | Ga0466969_0041576 | Ga0466969_0041576_1463_2209 | 248 |
| 92 | 3300044684 | Ga0466966_0014474 | Ga0466966_0014474_1232_1978 | 248 |
| 93 | 3300045049 | Ga0466959_0051529 | Ga0466959_0051529_1452_2198 | 248 |
| 94 | 3300053108 | Ga0500562_077214 | Ga0500562_077214_88_834 | 248 |
| 95 | 3300005339 | Ga0070660_100008755 | Ga0070660_1000087556 | 249 |
| 96 | 3300005339 | Ga0070660_100032947 | Ga0070660_1000329472 | 249 |
| 97 | 3300005366 | Ga0070659_100001045 | Ga0070659_10000104514 | 249 |
| 98 | 3300005539 | Ga0068853_100241188 | Ga0068853_1002411882 | 249 |
| 99 | 3300005563 | Ga0068855_100446774 | Ga0068855_1004467742 | 249 |
| 100 | 3300025250 | Ga0209026_1000930 | Ga0209026_10009302 | 249 |
| 101 | 3300025919 | Ga0207657_10036426 | Ga0207657_100364264 | 249 |
| 102 | 3300025932 | Ga0207690_10000770 | Ga0207690_1000077012 | 249 |
| 103 | 3300025949 | Ga0207667_10768432 | Ga0207667_107684322 | 249 |
| 104 | 3300026041 | Ga0207639_10261485 | Ga0207639_102614852 | 249 |
| 105 | 3300046665 | Ga0495661_0008787 | Ga0495661_0008787_1345_2094 | 249 |
| 106 | 3300046665 | Ga0495661_0021254 | Ga0495661_0021254_1308_2057 | 249 |
| 107 | 3300053092 | Ga0500583_0000075 | Ga0500583_0000075_22519_23268 | 249 |
| 108 | 3300053104 | Ga0500556_0090588 | Ga0500556_0090588_178_927 | 249 |
| 109 | 3300005614 | Ga0068856_100003367 | Ga0068856_1000033679 | 250 |
| 110 | 3300009174 | Ga0105241_10198700 | Ga0105241_101987002 | 250 |
| 111 | 3300009176 | Ga0105242_10067742 | Ga0105242_100677422 | 250 |
| 112 | 3300009553 | Ga0105249_10045567 | Ga0105249_100455674 | 250 |
| 113 | 3300010375 | Ga0105239_10022848 | Ga0105239_100228487 | 250 |
| 114 | 3300011119 | Ga0105246_10018868 | Ga0105246_100188685 | 250 |
| 115 | 3300013297 | Ga0157378_10299187 | Ga0157378_102991872 | 250 |
| 116 | 3300013308 | Ga0157375_10164053 | Ga0157375_101640532 | 250 |
| 117 | 3300013308 | Ga0157375_10235058 | Ga0157375_102350582 | 250 |
| 118 | 3300014325 | Ga0163163_10389875 | Ga0163163_103898752 | 250 |
| 119 | 3300014969 | Ga0157376_10540307 | Ga0157376_105403072 | 250 |
| 120 | 3300025914 | Ga0207671_10076709 | Ga0207671_100767092 | 250 |
| 121 | 3300025917 | Ga0207660_10320987 | Ga0207660_103209871 | 250 |
| 122 | 3300025921 | Ga0207652_10125046 | Ga0207652_101250462 | 250 |
| 123 | 3300026078 | Ga0207702_10021409 | Ga0207702_100214092 | 250 |
| 124 | 3300031911 | Ga0307412_10340118 | Ga0307412_103401182 | 250 |
| 125 | 3300037312 | Ga0395899_0046863 | Ga0395899_0046863_1332_2090 | 250 |
| 126 | 3300037418 | Ga0395900_0024302 | Ga0395900_0024302_3360_4118 | 250 |
| 127 | 3300037471 | Ga0395905_0001887 | Ga0395905_0001887_15129_15887 | 250 |
| 128 | 3300002067 | JGI24735J21928_10003843 | JGI24735J21928_100038432 | 251 |
| 129 | 3300003214 | JGI25165J46597_1000957 | JGI25165J46597_100095722 | 251 |
| 130 | 3300003320 | rootH2_10061387 | rootH2_100613876 | 251 |
| 131 | 3300003320 | rootH2_10116599 | rootH2_101165992 | 251 |
| 132 | 3300003323 | rootH1_10000566 | rootH1_10000566154 | 251 |
| 133 | 3300003323 | rootH1_10328624 | rootH1_103286246 | 251 |
| 134 | 3300005327 | Ga0070658_10000075 | Ga0070658_1000007524 | 251 |
| 135 | 3300005336 | Ga0070680_100011377 | Ga0070680_1000113771 | 251 |
| 136 | 3300005339 | Ga0070660_100056591 | Ga0070660_1000565914 | 251 |
| 137 | 3300005355 | Ga0070671_100155003 | Ga0070671_1001550032 | 251 |
| 138 | 3300005366 | Ga0070659_100016831 | Ga0070659_1000168312 | 251 |
| 139 | 3300005367 | Ga0070667_100712460 | Ga0070667_1007124601 | 251 |
| 140 | 3300005457 | Ga0070662_100000167 | Ga0070662_1000001676 | 251 |
| 141 | 3300005458 | Ga0070681_10035380 | Ga0070681_100353802 | 251 |
| 142 | 3300005530 | Ga0070679_100097257 | Ga0070679_1000972574 | 251 |
| 143 | 3300005530 | Ga0070679_100348747 | Ga0070679_1003487472 | 251 |
| 144 | 3300005543 | Ga0070672_100370951 | Ga0070672_1003709512 | 251 |
| 145 | 3300005563 | Ga0068855_100132046 | Ga0068855_1001320462 | 251 |
| 146 | 3300005563 | Ga0068855_100423367 | Ga0068855_1004233672 | 251 |
| 147 | 3300005577 | Ga0068857_100013369 | Ga0068857_1000133695 | 251 |
| 148 | 3300005614 | Ga0068856_100000044 | Ga0068856_10000004494 | 251 |
| 149 | 3300005614 | Ga0068856_100020596 | Ga0068856_1000205966 | 251 |
| 150 | 3300005614 | Ga0068856_100240828 | Ga0068856_1002408281 | 251 |
| 151 | 3300009093 | Ga0105240_10004296 | Ga0105240_1000429615 | 251 |
| 152 | 3300009093 | Ga0105240_10009293 | Ga0105240_1000929313 | 251 |
| 153 | 3300009093 | Ga0105240_10012464 | Ga0105240_100124649 | 251 |
| 154 | 3300009093 | Ga0105240_10054067 | Ga0105240_100540677 | 251 |
| 155 | 3300009174 | Ga0105241_10003945 | Ga0105241_1000394510 | 251 |
| 156 | 3300009174 | Ga0105241_10141537 | Ga0105241_101415372 | 251 |
| 157 | 3300009545 | Ga0105237_10002306 | Ga0105237_1000230623 | 251 |
| 158 | 3300009545 | Ga0105237_10070166 | Ga0105237_100701666 | 251 |
| 159 | 3300009551 | Ga0105238_10242144 | Ga0105238_102421442 | 251 |
| 160 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002289 | 251 |
| 161 | 3300010375 | Ga0105239_10005880 | Ga0105239_100058802 | 251 |
| 162 | 3300010375 | Ga0105239_10144729 | Ga0105239_101447292 | 251 |
| 163 | 3300011119 | Ga0105246_10009185 | Ga0105246_100091854 | 251 |
| 164 | 3300013100 | Ga0157373_10024983 | Ga0157373_100249832 | 251 |
| 165 | 3300013100 | Ga0157373_10227069 | Ga0157373_102270692 | 251 |
| 166 | 3300013102 | Ga0157371_10000269 | Ga0157371_1000026921 | 251 |
| 167 | 3300013104 | Ga0157370_10204815 | Ga0157370_102048152 | 251 |
| 168 | 3300013296 | Ga0157374_10004549 | Ga0157374_1000454913 | 251 |
| 169 | 3300013296 | Ga0157374_10117302 | Ga0157374_101173023 | 251 |
| 170 | 3300013297 | Ga0157378_10419204 | Ga0157378_104192042 | 251 |
| 171 | 3300013307 | Ga0157372_10001087 | Ga0157372_100010874 | 251 |
| 172 | 3300013307 | Ga0157372_10010312 | Ga0157372_100103129 | 251 |
| 173 | 3300013307 | Ga0157372_10121427 | Ga0157372_101214274 | 251 |
| 174 | 3300013308 | Ga0157375_10092151 | Ga0157375_100921512 | 251 |
| 175 | 3300021361 | Ga0213872_10013116 | Ga0213872_100131163 | 251 |
| 176 | 3300025230 | Ga0209563_109127 | Ga0209563_1091272 | 251 |
| 177 | 3300025231 | Ga0207427_100093 | Ga0207427_10009365 | 251 |
| 178 | 3300025233 | Ga0209437_100008 | Ga0209437_100008483 | 251 |
| 179 | 3300025261 | Ga0209233_1000024 | Ga0209233_1000024174 | 251 |
| 180 | 3300025261 | Ga0209233_1001440 | Ga0209233_10014402 | 251 |
| 181 | 3300025272 | Ga0209455_1010329 | Ga0209455_10103292 | 251 |
| 182 | 3300025904 | Ga0207647_10000209 | Ga0207647_1000020931 | 251 |
| 183 | 3300025904 | Ga0207647_10000463 | Ga0207647_1000046333 | 251 |
| 184 | 3300025909 | Ga0207705_10000102 | Ga0207705_1000010225 | 251 |
| 185 | 3300025909 | Ga0207705_10092508 | Ga0207705_100925082 | 251 |
| 186 | 3300025911 | Ga0207654_10008073 | Ga0207654_100080732 | 251 |
| 187 | 3300025911 | Ga0207654_10075746 | Ga0207654_100757463 | 251 |
| 188 | 3300025911 | Ga0207654_10119153 | Ga0207654_101191532 | 251 |
| 189 | 3300025912 | Ga0207707_10340400 | Ga0207707_103404002 | 251 |
| 190 | 3300025913 | Ga0207695_10006768 | Ga0207695_1000676812 | 251 |
| 191 | 3300025913 | Ga0207695_10008363 | Ga0207695_1000836310 | 251 |
| 192 | 3300025913 | Ga0207695_10044680 | Ga0207695_100446802 | 251 |
| 193 | 3300025913 | Ga0207695_10224615 | Ga0207695_102246152 | 251 |
| 194 | 3300025914 | Ga0207671_10002483 | Ga0207671_1000248318 | 251 |
| 195 | 3300025914 | Ga0207671_10381967 | Ga0207671_103819672 | 251 |
| 196 | 3300025917 | Ga0207660_10053988 | Ga0207660_100539882 | 251 |
| 197 | 3300025919 | Ga0207657_10093174 | Ga0207657_100931742 | 251 |
| 198 | 3300025921 | Ga0207652_10075892 | Ga0207652_100758924 | 251 |
| 199 | 3300025924 | Ga0207694_10309872 | Ga0207694_103098722 | 251 |
| 200 | 3300025932 | Ga0207690_10003147 | Ga0207690_100031473 | 251 |
| 201 | 3300025933 | Ga0207706_10000257 | Ga0207706_1000025734 | 251 |
| 202 | 3300025937 | Ga0207669_10296045 | Ga0207669_102960453 | 251 |
| 203 | 3300025949 | Ga0207667_10006040 | Ga0207667_1000604013 | 251 |
| 204 | 3300025949 | Ga0207667_10053592 | Ga0207667_100535922 | 251 |
| 205 | 3300025949 | Ga0207667_10073635 | Ga0207667_100736354 | 251 |
| 206 | 3300025949 | Ga0207667_10829396 | Ga0207667_108293962 | 251 |
| 207 | 3300026023 | Ga0207677_10183032 | Ga0207677_101830322 | 251 |
| 208 | 3300026078 | Ga0207702_10000140 | Ga0207702_1000014075 | 251 |
| 209 | 3300026078 | Ga0207702_10067127 | Ga0207702_100671273 | 251 |
| 210 | 3300026116 | Ga0207674_10054578 | Ga0207674_100545782 | 251 |
| 211 | 3300028786 | Ga0307517_10003309 | Ga0307517_100033099 | 251 |
| 212 | 3300031507 | Ga0307509_10126152 | Ga0307509_101261522 | 251 |
| 213 | 3300033180 | Ga0307510_10003634 | Ga0307510_1000363416 | 251 |
| 214 | 3300035692 | Ga0373935_0186061 | Ga0373935_0186061_301_1059 | 251 |
| 215 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1227217_1227978 | 251 |
| 216 | 3300037418 | Ga0395900_0000327 | Ga0395900_0000327_37662_38426 | 251 |
| 217 | 3300037418 | Ga0395900_0060434 | Ga0395900_0060434_1934_2698 | 251 |
| 218 | 3300039447 | Ga0436361_0773655 | Ga0436361_0773655_1145_1906 | 251 |
| 219 | 3300042004 | Ga0439445_0052048 | Ga0439445_0052048_60_815 | 251 |
| 220 | 3300046518 | Ga0495631_0007451 | Ga0495631_0007451_72_833 | 251 |
| 221 | 3300046660 | Ga0495625_0134153 | Ga0495625_0134153_770_1531 | 251 |
| 222 | 3300046694 | Ga0495649_0107191 | Ga0495649_0107191_228_989 | 251 |
| 223 | 3300047443 | Ga0495687_015885 | Ga0495687_015885_1898_2659 | 251 |
| 224 | 3300047444 | Ga0495675_0172480 | Ga0495675_0172480_125_883 | 251 |
| 225 | 3300053080 | Ga0500635_0018444 | Ga0500635_0018444_1321_2076 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lkp-assembly1.cif.gz_A | structure of atp-free human abca4 | 0.9458 | 6 | 231 |
| 7osf-assembly1.cif.gz_B | abc transporter complex nosdfyl, r-domain 1 | 0.9418 | 7 | 229 |
| 8edw-assembly1.cif.gz_A | cryo-em structure of human abca7 in bpl/ch nanodiscs | 0.9376 | 6 | 233 |
| 7tbw-assembly1.cif.gz_A | the structure of atp-bound abca1 | 0.9353 | 7 | 230 |
| 7e7i-assembly1.cif.gz_A | cryo-em structure of human abca4 in the apo state | 0.9348 | 7 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58429_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9624 | 7 | 228 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9599 | 7 | 230 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9534 | 9 | 231 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9522 | 6 | 237 | 3.40.50.300 |
| af_Q2FVS3_1_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9515 | 8 | 237 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A139WBE8-F1-model_v4 | ATP-binding cassette sub-family A member 3-like Protein | 0.9692 | 33 | 230 |
GO:0005319
GO:0005524 GO:0006869 GO:0016020 GO:0016887 GO:0042626 GO:0043231 GO:0140359 |
| AF-A0A2G9XGG2-F1-model_v4 | ABC transporter | 0.9652 | 6 | 231 |
GO:0005524
GO:0016887 |
| AF-A0A428Z536-F1-model_v4 | Transport permease protein | 0.9634 | 7 | 232 |
GO:0005524
GO:0005886 GO:0016887 GO:0043215 GO:0046677 GO:0140359 GO:1900753 |
| AF-K1YG27-F1-model_v4 | ABC transporter domain-containing protein | 0.9628 | 6 | 231 |
GO:0005524
GO:0016887 |
| AF-A0A0V8J7U4-F1-model_v4 | Antibiotic ABC transporter ATP-binding protein | 0.961 | 7 | 231 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar