F337805

General Info

Members Datasets Scaffolds Average Seq Length
225 134 225 250

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10389875|Ga0163163_103898752
Length 286
Sequence MKIFLVRLLSGANNGRLPHRNSRFGKTGFYRFVQNQMEQMSLAVSIRDLSFGYKGQIKKNFSHLNLEINKGERFGIFGPNGAGKTTLMNLMTGLLDYETGSIKILNKEIKTNKKSINRVSGFVPQDFSFYHELSPSENLEFFGAWSGLNKQIIQTKIKELLDILGLWDVRHKPVQKFSGGMKRRVNLAIAVMNEPAILFLDEPTVGVDVQTRHAMINYLKELNAKGTTLIYTSHQLSEAEDLCNTIALIDDGKIIANDPLEKLLNEHQQEGLEGLFLNLTGKEFRD

Samples

Sample ID Description Type Environment
1 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10003843 3300002067 Bacteria 5085
2 JGI25165J46597_1000957 3300003214 Bacteria 19672
3 rootH2_10061387 3300003320 Bacteria 4991
4 rootH2_10094371 3300003320 Bacteria 4030
5 rootH2_10116599 3300003320 Bacteria 1569
6 rootH1_10000566 3300003316 Bacteria 33162
7 rootH1_10000566 3300003323 Bacteria 205679
8 rootH1_10247096 3300003323 Unclassified 1460
9 rootH1_10328624 3300003323 Bacteria 3567
10 Ga0070658_10000075 3300005327 Bacteria 95412
11 Ga0070658_10066481 3300005327 Bacteria 2945
12 Ga0070677_10084733 3300005333 Bacteria 1365
13 Ga0068869_100187785 3300005334 Bacteria 1623
14 Ga0068869_100283641 3300005334 Bacteria 1332
15 Ga0070680_100011377 3300005336 Bacteria 6882
16 Ga0070682_100000106 3300005337 Bacteria 74029
17 Ga0068868_100015137 3300005338 Bacteria 5699
18 Ga0070660_100008755 3300005339 Bacteria 7088
19 Ga0070660_100032947 3300005339 Bacteria 3903
20 Ga0070660_100056591 3300005339 Bacteria 3034
21 Ga0070668_100166981 3300005347 Bacteria 1789
22 Ga0070669_100039820 3300005353 Bacteria 3415
23 Ga0070675_100086939 3300005354 Bacteria 2614
24 Ga0070671_100155003 3300005355 Bacteria 1935
25 Ga0070674_100066776 3300005356 Bacteria 2528
26 Ga0070659_100001045 3300005366 Bacteria 20218
27 Ga0070659_100016831 3300005366 Bacteria 5493
28 Ga0070667_100015079 3300005367 Bacteria 6384
29 Ga0070667_100094702 3300005367 Bacteria 2573
30 Ga0070667_100358789 3300005367 Bacteria 1321
31 Ga0070667_100712460 3300005367 Unclassified 929
32 Ga0070663_100013428 3300005455 Bacteria 5223
33 Ga0070662_100000167 3300005457 Bacteria 38204
34 Ga0070681_10035380 3300005458 Bacteria 5017
35 Ga0068867_100017794 3300005459 Bacteria 5047
36 Ga0068867_100021893 3300005459 Bacteria 4565
37 Ga0068867_100071773 3300005459 Bacteria 2590
38 Ga0070679_100097257 3300005530 Bacteria 2931
39 Ga0070679_100348747 3300005530 Bacteria 1428
40 Ga0068853_100096833 3300005539 Bacteria 2604
41 Ga0068853_100241188 3300005539 Bacteria 1657
42 Ga0070672_100042980 3300005543 Bacteria 3481
43 Ga0070672_100370951 3300005543 Bacteria 1223
44 Ga0070665_100328567 3300005548 Bacteria 1533
45 Ga0068855_100132046 3300005563 Bacteria 2851
46 Ga0068855_100423367 3300005563 Bacteria 1456
47 Ga0068855_100446774 3300005563 Bacteria 1411
48 Ga0068857_100013369 3300005577 Bacteria 7149
49 Ga0068856_100000044 3300005614 Bacteria 111437
50 Ga0068856_100003367 3300005614 Bacteria 16201
51 Ga0068856_100020596 3300005614 Bacteria 6408
52 Ga0068856_100240828 3300005614 Bacteria 1824
53 Ga0068856_100581331 3300005614 Bacteria 1141
54 Ga0068852_100091369 3300005616 Bacteria 2724
55 Ga0068852_100443888 3300005616 Unclassified 1283
56 Ga0068864_100255213 3300005618 Bacteria 1629
57 Ga0068861_100107273 3300005719 Bacteria 2233
58 Ga0068861_100192773 3300005719 Bacteria 1705
59 Ga0068870_10102879 3300005840 Bacteria 1618
60 Ga0068860_100048712 3300005843 Bacteria 4038
61 Ga0068860_100228327 3300005843 Bacteria 1809
62 Ga0068862_100698182 3300005844 Bacteria 983
63 Ga0068871_100387774 3300006358 Bacteria 1242
64 Ga0068865_100088082 3300006881 Bacteria 2245
65 Ga0105240_10004296 3300009093 Bacteria 21764
66 Ga0105240_10009293 3300009093 Bacteria 13938
67 Ga0105240_10012464 3300009093 Bacteria 11730
68 Ga0105240_10054067 3300009093 Bacteria 5034
69 Ga0105240_10588742 3300009093 Unclassified 1226
70 Ga0105243_10437701 3300009148 Bacteria 1223
71 Ga0105241_10003945 3300009174 Bacteria 10980
72 Ga0105241_10141537 3300009174 Bacteria 1959
73 Ga0105241_10198700 3300009174 Bacteria 1673
74 Ga0105242_10067742 3300009176 Bacteria 2952
75 Ga0105237_10002306 3300009545 Bacteria 23725
76 Ga0105237_10070166 3300009545 Unclassified 3499
77 Ga0105238_10242144 3300009551 Bacteria 1781
78 Ga0105249_10045567 3300009553 Bacteria 3989
79 Ga0105249_10176537 3300009553 Bacteria 2075
80 Ga0105239_10000002 3300010375 Bacteria 610298
81 Ga0105239_10005880 3300010375 Bacteria 14296
82 Ga0105239_10022848 3300010375 Bacteria 6895
83 Ga0105239_10144729 3300010375 Bacteria 2650
84 Ga0105246_10009185 3300011119 Bacteria 6088
85 Ga0105246_10018868 3300011119 Bacteria 4398
86 Ga0105246_10316076 3300011119 Bacteria 1267
87 Ga0157373_10024983 3300013100 Bacteria 4325
88 Ga0157373_10227069 3300013100 Unclassified 1318
89 Ga0157371_10000269 3300013102 Bacteria 70787
90 Ga0157371_10001621 3300013102 Bacteria 23010
91 Ga0157370_10204815 3300013104 Bacteria 1830
92 Ga0157370_10213693 3300013104 Bacteria 1787
93 Ga0157370_10652467 3300013104 Bacteria 962
94 Ga0157369_10012411 3300013105 Bacteria 9671
95 Ga0157374_10004549 3300013296 Bacteria 11638
96 Ga0157374_10017006 3300013296 Bacteria 6403
97 Ga0157374_10117302 3300013296 Bacteria 2565
98 Ga0157378_10299187 3300013297 Bacteria 1557
99 Ga0157378_10419204 3300013297 Bacteria 1323
100 Ga0157378_10587912 3300013297 Bacteria 1123
101 Ga0157372_10000009 3300013307 Bacteria 302051
102 Ga0157372_10001087 3300013307 Bacteria 29605
103 Ga0157372_10010312 3300013307 Bacteria 9928
104 Ga0157372_10121427 3300013307 Bacteria 3001
105 Ga0157375_10092151 3300013308 Bacteria 3093
106 Ga0157375_10164053 3300013308 Bacteria 2365
107 Ga0157375_10235058 3300013308 Bacteria 1992
108 Ga0157375_10315431 3300013308 Bacteria 1728
109 Ga0163163_10332194 3300014325 Bacteria 1575
110 Ga0163163_10389875 3300014325 Bacteria 1451
111 Ga0157376_10540307 3300014969 Bacteria 1152
112 Ga0213872_10013116 3300021361 Bacteria 3885
113 Ga0209563_109127 3300025230 Unclassified 1521
114 Ga0207427_100093 3300025231 Bacteria 125910
115 Ga0209437_100008 3300025233 Bacteria 921142
116 Ga0209026_1000930 3300025250 Bacteria 14845
117 Ga0209233_1000024 3300025261 Bacteria 695418
118 Ga0209233_1001440 3300025261 Bacteria 9392
119 Ga0209455_1010329 3300025272 Bacteria 2379
120 Ga0207688_10021799 3300025901 Bacteria 3503
121 Ga0207680_10258545 3300025903 Bacteria 1204
122 Ga0207647_10000209 3300025904 Bacteria 47604
123 Ga0207647_10000463 3300025904 Bacteria 32923
124 Ga0207645_10006683 3300025907 Bacteria 8237
125 Ga0207643_10010665 3300025908 Bacteria 4952
126 Ga0207705_10000102 3300025909 Bacteria 98105
127 Ga0207705_10092508 3300025909 Bacteria 2216
128 Ga0207654_10008073 3300025911 Bacteria 5305
129 Ga0207654_10075746 3300025911 Bacteria 2012
130 Ga0207654_10119153 3300025911 Bacteria 1654
131 Ga0207707_10340400 3300025912 Bacteria 1293
132 Ga0207695_10006768 3300025913 Bacteria 14780
133 Ga0207695_10008363 3300025913 Bacteria 12962
134 Ga0207695_10044680 3300025913 Bacteria 4709
135 Ga0207695_10224615 3300025913 Bacteria 1784
136 Ga0207671_10002483 3300025914 Bacteria 19710
137 Ga0207671_10076709 3300025914 Bacteria 2501
138 Ga0207671_10381967 3300025914 Bacteria 1119
139 Ga0207660_10053988 3300025917 Bacteria 2866
140 Ga0207660_10320987 3300025917 Bacteria 1237
141 Ga0207657_10036426 3300025919 Bacteria 4403
142 Ga0207657_10093174 3300025919 Bacteria 2509
143 Ga0207652_10075892 3300025921 Bacteria 2930
144 Ga0207652_10125046 3300025921 Bacteria 2290
145 Ga0207681_10105412 3300025923 Bacteria 2041
146 Ga0207694_10309872 3300025924 Bacteria 1301
147 Ga0207659_10320075 3300025926 Bacteria 1279
148 Ga0207644_10186790 3300025931 Unclassified 1628
149 Ga0207690_10000770 3300025932 Bacteria 20723
150 Ga0207690_10003147 3300025932 Bacteria 9907
151 Ga0207706_10000257 3300025933 Bacteria 57965
152 Ga0207669_10296045 3300025937 Bacteria 1228
153 Ga0207704_10407698 3300025938 Bacteria 1074
154 Ga0207691_10055552 3300025940 Bacteria 3608
155 Ga0207689_10000466 3300025942 Bacteria 37961
156 Ga0207689_10004188 3300025942 Bacteria 13113
157 Ga0207689_10132044 3300025942 Unclassified 2055
158 Ga0207667_10006040 3300025949 Bacteria 14732
159 Ga0207667_10053592 3300025949 Bacteria 4244
160 Ga0207667_10073635 3300025949 Bacteria 3549
161 Ga0207667_10768432 3300025949 Bacteria 962
162 Ga0207667_10829396 3300025949 Bacteria 920
163 Ga0207651_10173999 3300025960 Bacteria 1701
164 Ga0207668_10316898 3300025972 Unclassified 1293
165 Ga0207640_10301986 3300025981 Bacteria 1267
166 Ga0207677_10183032 3300026023 Unclassified 1650
167 Ga0207639_10261485 3300026041 Bacteria 1514
168 Ga0207678_10024761 3300026067 Bacteria 5240
169 Ga0207702_10000140 3300026078 Bacteria 87544
170 Ga0207702_10021409 3300026078 Bacteria 5353
171 Ga0207702_10067127 3300026078 Bacteria 3077
172 Ga0207702_10662411 3300026078 Bacteria 1027
173 Ga0207648_10004023 3300026089 Bacteria 15260
174 Ga0207648_10444503 3300026089 Bacteria 1180
175 Ga0207674_10054578 3300026116 Bacteria 4067
176 Ga0207674_10455884 3300026116 Bacteria 1236
177 Ga0207675_100016499 3300026118 Bacteria 6896
178 Ga0207675_100018172 3300026118 Bacteria 6556
179 Ga0207675_100824401 3300026118 Bacteria 942
180 Ga0207683_10005934 3300026121 Bacteria 10469
181 Ga0207683_10099198 3300026121 Bacteria 2599
182 Ga0268264_10163883 3300028381 Unclassified 2005
183 Ga0268264_10187743 3300028381 Bacteria 1882
184 Ga0268264_10366950 3300028381 Bacteria 1375
185 Ga0307517_10003309 3300028786 Bacteria 25165
186 Ga0307511_10000104 3300030521 Bacteria 75069
187 Ga0307509_10002733 3300031507 Bacteria 28113
188 Ga0307509_10126152 3300031507 Bacteria 2525
189 Ga0307516_10003007 3300031730 Bacteria 22014
190 Ga0307412_10340118 3300031911 Bacteria 1201
191 Ga0307510_10003634 3300033180 Bacteria 18006
192 Ga0373935_0186061 3300035692 Bacteria 1428
193 Ga0395899_0000001 3300037312 Bacteria 1750322
194 Ga0395899_0002957 3300037312 Bacteria 13598
195 Ga0395899_0046863 3300037312 Bacteria 3219
196 Ga0395900_0000327 3300037418 Bacteria 70365
197 Ga0395900_0024302 3300037418 Bacteria 6205
198 Ga0395900_0060434 3300037418 Bacteria 3900
199 Ga0395905_0001887 3300037471 Bacteria 24161
200 Ga0436365_0130893 3300039437 Bacteria 2491
201 Ga0436361_0773655 3300039447 Bacteria 3958
202 Ga0439445_0052048 3300042004 Unclassified 1107
203 Ga0466969_0041576 3300044656 Bacteria 2299
204 Ga0466966_0014474 3300044684 Bacteria 5221
205 Ga0466959_0051529 3300045049 Bacteria 3018
206 Ga0495631_0007451 3300046518 Bacteria 5561
207 Ga0495625_0134153 3300046660 Bacteria 1675
208 Ga0495661_0008787 3300046665 Bacteria 6969
209 Ga0495661_0021254 3300046665 Bacteria 4233
210 Ga0495649_0107191 3300046694 Unclassified 1483
211 Ga0495687_015885 3300047443 Bacteria 3807
212 Ga0495675_0172480 3300047444 Unclassified 1328
213 Ga0495686_0092254 3300047472 Bacteria 1837
214 Ga0501032_0441311 3300049569 Bacteria 834
215 Ga0501034_0021131 3300049571 Bacteria 6640
216 Ga0501034_0807581 3300049571 Bacteria 830
217 Ga0501037_0019936 3300049573 Bacteria 4949
218 Ga0501043_0076249 3300049579 Bacteria 2634
219 Ga0501047_0055092 3300049581 Bacteria 3846
220 Ga0501070_0032817 3300049586 Bacteria 4344
221 Ga0501035_0394213 3300049822 Bacteria 1153
222 Ga0500635_0018444 3300053080 Bacteria 2106
223 Ga0500583_0000075 3300053092 Bacteria 59561
224 Ga0500556_0090588 3300053104 Bacteria 1167
225 Ga0500562_077214 3300053108 Bacteria 900

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0092254 Ga0495686_0092254_623_1327 234
2 iso_pu_bacteria 2890804823 2890805458 241
3 3300005459 Ga0068867_100071773 Ga0068867_1000717732 246
4 3300005843 Ga0068860_100228327 Ga0068860_1002283271 246
5 3300026089 Ga0207648_10444503 Ga0207648_104445032 246
6 3300026116 Ga0207674_10455884 Ga0207674_104558842 246
7 3300026118 Ga0207675_100824401 Ga0207675_1008244011 246
8 3300028381 Ga0268264_10366950 Ga0268264_103669501 246
9 3300031507 Ga0307509_10002733 Ga0307509_100027339 246
10 3300049569 Ga0501032_0441311 Ga0501032_0441311_30_773 246
11 3300049571 Ga0501034_0807581 Ga0501034_0807581_75_818 246
12 3300049573 Ga0501037_0019936 Ga0501037_0019936_1313_2056 246
13 3300049586 Ga0501070_0032817 Ga0501070_0032817_2709_3452 246
14 3300003320 rootH2_10094371 rootH2_100943712 247
15 3300005327 Ga0070658_10066481 Ga0070658_100664812 247
16 3300005333 Ga0070677_10084733 Ga0070677_100847332 247
17 3300005334 Ga0068869_100187785 Ga0068869_1001877852 247
18 3300005334 Ga0068869_100283641 Ga0068869_1002836412 247
19 3300005338 Ga0068868_100015137 Ga0068868_1000151374 247
20 3300005347 Ga0070668_100166981 Ga0070668_1001669812 247
21 3300005353 Ga0070669_100039820 Ga0070669_1000398204 247
22 3300005354 Ga0070675_100086939 Ga0070675_1000869394 247
23 3300005356 Ga0070674_100066776 Ga0070674_1000667762 247
24 3300005367 Ga0070667_100015079 Ga0070667_1000150792 247
25 3300005367 Ga0070667_100094702 Ga0070667_1000947022 247
26 3300005367 Ga0070667_100358789 Ga0070667_1003587891 247
27 3300005459 Ga0068867_100017794 Ga0068867_1000177945 247
28 3300005459 Ga0068867_100021893 Ga0068867_1000218934 247
29 3300005539 Ga0068853_100096833 Ga0068853_1000968333 247
30 3300005543 Ga0070672_100042980 Ga0070672_1000429805 247
31 3300005548 Ga0070665_100328567 Ga0070665_1003285672 247
32 3300005616 Ga0068852_100091369 Ga0068852_1000913693 247
33 3300005618 Ga0068864_100255213 Ga0068864_1002552132 247
34 3300005719 Ga0068861_100107273 Ga0068861_1001072732 247
35 3300005719 Ga0068861_100192773 Ga0068861_1001927732 247
36 3300005840 Ga0068870_10102879 Ga0068870_101028791 247
37 3300005843 Ga0068860_100048712 Ga0068860_1000487125 247
38 3300005844 Ga0068862_100698182 Ga0068862_1006981822 247
39 3300006358 Ga0068871_100387774 Ga0068871_1003877741 247
40 3300006881 Ga0068865_100088082 Ga0068865_1000880822 247
41 3300009093 Ga0105240_10588742 Ga0105240_105887422 247
42 3300009148 Ga0105243_10437701 Ga0105243_104377012 247
43 3300009553 Ga0105249_10176537 Ga0105249_101765372 247
44 3300011119 Ga0105246_10316076 Ga0105246_103160762 247
45 3300013296 Ga0157374_10017006 Ga0157374_100170065 247
46 3300013297 Ga0157378_10587912 Ga0157378_105879122 247
47 3300014325 Ga0163163_10332194 Ga0163163_103321942 247
48 3300025901 Ga0207688_10021799 Ga0207688_100217994 247
49 3300025903 Ga0207680_10258545 Ga0207680_102585452 247
50 3300025907 Ga0207645_10006683 Ga0207645_100066831 247
51 3300025908 Ga0207643_10010665 Ga0207643_100106655 247
52 3300025923 Ga0207681_10105412 Ga0207681_101054122 247
53 3300025926 Ga0207659_10320075 Ga0207659_103200752 247
54 3300025938 Ga0207704_10407698 Ga0207704_104076981 247
55 3300025940 Ga0207691_10055552 Ga0207691_100555522 247
56 3300025942 Ga0207689_10000466 Ga0207689_1000046631 247
57 3300025942 Ga0207689_10004188 Ga0207689_100041886 247
58 3300025942 Ga0207689_10132044 Ga0207689_101320442 247
59 3300025960 Ga0207651_10173999 Ga0207651_101739992 247
60 3300025972 Ga0207668_10316898 Ga0207668_103168982 247
61 3300025981 Ga0207640_10301986 Ga0207640_103019862 247
62 3300026089 Ga0207648_10004023 Ga0207648_100040238 247
63 3300026118 Ga0207675_100016499 Ga0207675_1000164998 247
64 3300026118 Ga0207675_100018172 Ga0207675_1000181722 247
65 3300026121 Ga0207683_10005934 Ga0207683_100059348 247
66 3300028381 Ga0268264_10163883 Ga0268264_101638832 247
67 3300028381 Ga0268264_10187743 Ga0268264_101877432 247
68 3300039437 Ga0436365_0130893 Ga0436365_0130893_331_1074 247
69 3300049571 Ga0501034_0021131 Ga0501034_0021131_5877_6620 247
70 3300049579 Ga0501043_0076249 Ga0501043_0076249_1744_2487 247
71 3300049581 Ga0501047_0055092 Ga0501047_0055092_2583_3326 247
72 3300049822 Ga0501035_0394213 Ga0501035_0394213_251_994 247
73 3300003323 rootH1_10247096 rootH1_102470961 248
74 3300005337 Ga0070682_100000106 Ga0070682_10000010612 248
75 3300005455 Ga0070663_100013428 Ga0070663_1000134282 248
76 3300005614 Ga0068856_100581331 Ga0068856_1005813311 248
77 3300005616 Ga0068852_100443888 Ga0068852_1004438882 248
78 3300013102 Ga0157371_10001621 Ga0157371_100016216 248
79 3300013104 Ga0157370_10213693 Ga0157370_102136932 248
80 3300013104 Ga0157370_10652467 Ga0157370_106524671 248
81 3300013105 Ga0157369_10012411 Ga0157369_100124119 248
82 3300013307 Ga0157372_10000009 Ga0157372_10000009110 248
83 3300013308 Ga0157375_10315431 Ga0157375_103154312 248
84 3300025931 Ga0207644_10186790 Ga0207644_101867902 248
85 3300026067 Ga0207678_10024761 Ga0207678_100247615 248
86 3300026078 Ga0207702_10662411 Ga0207702_106624111 248
87 3300026121 Ga0207683_10099198 Ga0207683_100991982 248
88 3300030521 Ga0307511_10000104 Ga0307511_100001046 248
89 3300031730 Ga0307516_10003007 Ga0307516_100030074 248
90 3300037312 Ga0395899_0002957 Ga0395899_0002957_10081_10827 248
91 3300044656 Ga0466969_0041576 Ga0466969_0041576_1463_2209 248
92 3300044684 Ga0466966_0014474 Ga0466966_0014474_1232_1978 248
93 3300045049 Ga0466959_0051529 Ga0466959_0051529_1452_2198 248
94 3300053108 Ga0500562_077214 Ga0500562_077214_88_834 248
95 3300005339 Ga0070660_100008755 Ga0070660_1000087556 249
96 3300005339 Ga0070660_100032947 Ga0070660_1000329472 249
97 3300005366 Ga0070659_100001045 Ga0070659_10000104514 249
98 3300005539 Ga0068853_100241188 Ga0068853_1002411882 249
99 3300005563 Ga0068855_100446774 Ga0068855_1004467742 249
100 3300025250 Ga0209026_1000930 Ga0209026_10009302 249
101 3300025919 Ga0207657_10036426 Ga0207657_100364264 249
102 3300025932 Ga0207690_10000770 Ga0207690_1000077012 249
103 3300025949 Ga0207667_10768432 Ga0207667_107684322 249
104 3300026041 Ga0207639_10261485 Ga0207639_102614852 249
105 3300046665 Ga0495661_0008787 Ga0495661_0008787_1345_2094 249
106 3300046665 Ga0495661_0021254 Ga0495661_0021254_1308_2057 249
107 3300053092 Ga0500583_0000075 Ga0500583_0000075_22519_23268 249
108 3300053104 Ga0500556_0090588 Ga0500556_0090588_178_927 249
109 3300005614 Ga0068856_100003367 Ga0068856_1000033679 250
110 3300009174 Ga0105241_10198700 Ga0105241_101987002 250
111 3300009176 Ga0105242_10067742 Ga0105242_100677422 250
112 3300009553 Ga0105249_10045567 Ga0105249_100455674 250
113 3300010375 Ga0105239_10022848 Ga0105239_100228487 250
114 3300011119 Ga0105246_10018868 Ga0105246_100188685 250
115 3300013297 Ga0157378_10299187 Ga0157378_102991872 250
116 3300013308 Ga0157375_10164053 Ga0157375_101640532 250
117 3300013308 Ga0157375_10235058 Ga0157375_102350582 250
118 3300014325 Ga0163163_10389875 Ga0163163_103898752 250
119 3300014969 Ga0157376_10540307 Ga0157376_105403072 250
120 3300025914 Ga0207671_10076709 Ga0207671_100767092 250
121 3300025917 Ga0207660_10320987 Ga0207660_103209871 250
122 3300025921 Ga0207652_10125046 Ga0207652_101250462 250
123 3300026078 Ga0207702_10021409 Ga0207702_100214092 250
124 3300031911 Ga0307412_10340118 Ga0307412_103401182 250
125 3300037312 Ga0395899_0046863 Ga0395899_0046863_1332_2090 250
126 3300037418 Ga0395900_0024302 Ga0395900_0024302_3360_4118 250
127 3300037471 Ga0395905_0001887 Ga0395905_0001887_15129_15887 250
128 3300002067 JGI24735J21928_10003843 JGI24735J21928_100038432 251
129 3300003214 JGI25165J46597_1000957 JGI25165J46597_100095722 251
130 3300003320 rootH2_10061387 rootH2_100613876 251
131 3300003320 rootH2_10116599 rootH2_101165992 251
132 3300003323 rootH1_10000566 rootH1_10000566154 251
133 3300003323 rootH1_10328624 rootH1_103286246 251
134 3300005327 Ga0070658_10000075 Ga0070658_1000007524 251
135 3300005336 Ga0070680_100011377 Ga0070680_1000113771 251
136 3300005339 Ga0070660_100056591 Ga0070660_1000565914 251
137 3300005355 Ga0070671_100155003 Ga0070671_1001550032 251
138 3300005366 Ga0070659_100016831 Ga0070659_1000168312 251
139 3300005367 Ga0070667_100712460 Ga0070667_1007124601 251
140 3300005457 Ga0070662_100000167 Ga0070662_1000001676 251
141 3300005458 Ga0070681_10035380 Ga0070681_100353802 251
142 3300005530 Ga0070679_100097257 Ga0070679_1000972574 251
143 3300005530 Ga0070679_100348747 Ga0070679_1003487472 251
144 3300005543 Ga0070672_100370951 Ga0070672_1003709512 251
145 3300005563 Ga0068855_100132046 Ga0068855_1001320462 251
146 3300005563 Ga0068855_100423367 Ga0068855_1004233672 251
147 3300005577 Ga0068857_100013369 Ga0068857_1000133695 251
148 3300005614 Ga0068856_100000044 Ga0068856_10000004494 251
149 3300005614 Ga0068856_100020596 Ga0068856_1000205966 251
150 3300005614 Ga0068856_100240828 Ga0068856_1002408281 251
151 3300009093 Ga0105240_10004296 Ga0105240_1000429615 251
152 3300009093 Ga0105240_10009293 Ga0105240_1000929313 251
153 3300009093 Ga0105240_10012464 Ga0105240_100124649 251
154 3300009093 Ga0105240_10054067 Ga0105240_100540677 251
155 3300009174 Ga0105241_10003945 Ga0105241_1000394510 251
156 3300009174 Ga0105241_10141537 Ga0105241_101415372 251
157 3300009545 Ga0105237_10002306 Ga0105237_1000230623 251
158 3300009545 Ga0105237_10070166 Ga0105237_100701666 251
159 3300009551 Ga0105238_10242144 Ga0105238_102421442 251
160 3300010375 Ga0105239_10000002 Ga0105239_10000002289 251
161 3300010375 Ga0105239_10005880 Ga0105239_100058802 251
162 3300010375 Ga0105239_10144729 Ga0105239_101447292 251
163 3300011119 Ga0105246_10009185 Ga0105246_100091854 251
164 3300013100 Ga0157373_10024983 Ga0157373_100249832 251
165 3300013100 Ga0157373_10227069 Ga0157373_102270692 251
166 3300013102 Ga0157371_10000269 Ga0157371_1000026921 251
167 3300013104 Ga0157370_10204815 Ga0157370_102048152 251
168 3300013296 Ga0157374_10004549 Ga0157374_1000454913 251
169 3300013296 Ga0157374_10117302 Ga0157374_101173023 251
170 3300013297 Ga0157378_10419204 Ga0157378_104192042 251
171 3300013307 Ga0157372_10001087 Ga0157372_100010874 251
172 3300013307 Ga0157372_10010312 Ga0157372_100103129 251
173 3300013307 Ga0157372_10121427 Ga0157372_101214274 251
174 3300013308 Ga0157375_10092151 Ga0157375_100921512 251
175 3300021361 Ga0213872_10013116 Ga0213872_100131163 251
176 3300025230 Ga0209563_109127 Ga0209563_1091272 251
177 3300025231 Ga0207427_100093 Ga0207427_10009365 251
178 3300025233 Ga0209437_100008 Ga0209437_100008483 251
179 3300025261 Ga0209233_1000024 Ga0209233_1000024174 251
180 3300025261 Ga0209233_1001440 Ga0209233_10014402 251
181 3300025272 Ga0209455_1010329 Ga0209455_10103292 251
182 3300025904 Ga0207647_10000209 Ga0207647_1000020931 251
183 3300025904 Ga0207647_10000463 Ga0207647_1000046333 251
184 3300025909 Ga0207705_10000102 Ga0207705_1000010225 251
185 3300025909 Ga0207705_10092508 Ga0207705_100925082 251
186 3300025911 Ga0207654_10008073 Ga0207654_100080732 251
187 3300025911 Ga0207654_10075746 Ga0207654_100757463 251
188 3300025911 Ga0207654_10119153 Ga0207654_101191532 251
189 3300025912 Ga0207707_10340400 Ga0207707_103404002 251
190 3300025913 Ga0207695_10006768 Ga0207695_1000676812 251
191 3300025913 Ga0207695_10008363 Ga0207695_1000836310 251
192 3300025913 Ga0207695_10044680 Ga0207695_100446802 251
193 3300025913 Ga0207695_10224615 Ga0207695_102246152 251
194 3300025914 Ga0207671_10002483 Ga0207671_1000248318 251
195 3300025914 Ga0207671_10381967 Ga0207671_103819672 251
196 3300025917 Ga0207660_10053988 Ga0207660_100539882 251
197 3300025919 Ga0207657_10093174 Ga0207657_100931742 251
198 3300025921 Ga0207652_10075892 Ga0207652_100758924 251
199 3300025924 Ga0207694_10309872 Ga0207694_103098722 251
200 3300025932 Ga0207690_10003147 Ga0207690_100031473 251
201 3300025933 Ga0207706_10000257 Ga0207706_1000025734 251
202 3300025937 Ga0207669_10296045 Ga0207669_102960453 251
203 3300025949 Ga0207667_10006040 Ga0207667_1000604013 251
204 3300025949 Ga0207667_10053592 Ga0207667_100535922 251
205 3300025949 Ga0207667_10073635 Ga0207667_100736354 251
206 3300025949 Ga0207667_10829396 Ga0207667_108293962 251
207 3300026023 Ga0207677_10183032 Ga0207677_101830322 251
208 3300026078 Ga0207702_10000140 Ga0207702_1000014075 251
209 3300026078 Ga0207702_10067127 Ga0207702_100671273 251
210 3300026116 Ga0207674_10054578 Ga0207674_100545782 251
211 3300028786 Ga0307517_10003309 Ga0307517_100033099 251
212 3300031507 Ga0307509_10126152 Ga0307509_101261522 251
213 3300033180 Ga0307510_10003634 Ga0307510_1000363416 251
214 3300035692 Ga0373935_0186061 Ga0373935_0186061_301_1059 251
215 3300037312 Ga0395899_0000001 Ga0395899_0000001_1227217_1227978 251
216 3300037418 Ga0395900_0000327 Ga0395900_0000327_37662_38426 251
217 3300037418 Ga0395900_0060434 Ga0395900_0060434_1934_2698 251
218 3300039447 Ga0436361_0773655 Ga0436361_0773655_1145_1906 251
219 3300042004 Ga0439445_0052048 Ga0439445_0052048_60_815 251
220 3300046518 Ga0495631_0007451 Ga0495631_0007451_72_833 251
221 3300046660 Ga0495625_0134153 Ga0495625_0134153_770_1531 251
222 3300046694 Ga0495649_0107191 Ga0495649_0107191_228_989 251
223 3300047443 Ga0495687_015885 Ga0495687_015885_1898_2659 251
224 3300047444 Ga0495675_0172480 Ga0495675_0172480_125_883 251
225 3300053080 Ga0500635_0018444 Ga0500635_0018444_1321_2076 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

61

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9458 6 231
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9418 7 229
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9376 6 233
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9353 7 230
7e7i-assembly1.cif.gz_A cryo-em structure of human abca4 in the apo state 0.9348 7 231
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 7 228 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 7 230 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9534 9 231 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 6 237 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 8 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A139WBE8-F1-model_v4 ATP-binding cassette sub-family A member 3-like Protein 0.9692 33 230 GO:0005319
GO:0005524
GO:0006869
GO:0016020
GO:0016887
GO:0042626
GO:0043231
GO:0140359
AF-A0A2G9XGG2-F1-model_v4 ABC transporter 0.9652 6 231 GO:0005524
GO:0016887
AF-A0A428Z536-F1-model_v4 Transport permease protein 0.9634 7 232 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-K1YG27-F1-model_v4 ABC transporter domain-containing protein 0.9628 6 231 GO:0005524
GO:0016887
AF-A0A0V8J7U4-F1-model_v4 Antibiotic ABC transporter ATP-binding protein 0.961 7 231 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map