F337489

General Info

Members Datasets Scaffolds Average Seq Length
225 162 450 463

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000441|Ga0070709_1000044114
Length 506
Sequence MEIRVAGGGGGARVGWRRACGVDYRPAGGTDGGSLGGVTLRLHDTATRSEREFSPVEPGKASLYLCGATVQAPPHIGHIRSGVSFDILVRWLRASGYQVTFCRNVTDIDDKILRVAAGEGVPWWAVSQRNERAFSRAYDVLGCLPPEVEPRATGHIPEMITLMRRLIDGGHAYASGGDVYFDVHSWPAYGALSGQRLDHMRPAEDTETAENKRDPRDFSLWKRAKPGEPAWDTPWGPXXXXWHLECSAMATKYLGPTFDIHGGGLDLVFPHHENELAQSCAAGDGFARYWMHNGLVGVAGEKMSKSLGNSLLVDAMVTQVRPVELRYYLGQVHYRSNIEYSPEALDEAVTAYRRIEGFVVRAAELTGDTQDPAGVGRDALPPAFAAALDNDLGVPQALAVVHETIRDGHNALAAGDHVAVAAALAQVRAMLDVLGLDPLAANWATPGADDDLRAVVKALVGVALDQRQDAKDRKNYEAADAIRDSLRAAGVLIEDTPDGQRWTIKR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
136 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
137 2643221546 Microbacterium sp. Root53 Isolate Unclassified
138 2643221566 Microbacterium sp. Root166 Isolate Unclassified
139 2643221575 Microbacterium sp. Root61 Isolate Unclassified
140 2643221597 Microbacterium sp. Root180 Isolate Unclassified
141 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
142 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
143 2773857759 Microbacterium sp. 1294 Isolate Unclassified
144 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
145 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
146 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
147 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
148 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
149 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
150 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
151 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
152 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
153 2891562705 Microbispora tritici MT50 Isolate Unclassified
154 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
155 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
156 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
157 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
158 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
159 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
160 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
161 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
162 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0
Isolates 12.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 3.56
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10000441 3300005434 Bacteria 25152
2 Ga0065714_10078504 3300005288 Bacteria 2593
3 Ga0070658_10001187 3300005327 Bacteria 22269
4 Ga0070666_10003085 3300005335 Bacteria 10112
5 Ga0070671_100016034 3300005355 Bacteria 6055
6 Ga0070714_100000010 3300005435 Bacteria 262871
7 Ga0070714_100047268 3300005435 Bacteria 3655
8 Ga0070714_100084169 3300005435 Bacteria 2775
9 Ga0070713_100004460 3300005436 Bacteria 9407
10 Ga0070710_10000167 3300005437 Bacteria 30282
11 Ga0070711_100001149 3300005439 Bacteria 14217
12 Ga0070700_100000052 3300005441 Bacteria 85282
13 Ga0070708_100180169 3300005445 Bacteria 1974
14 Ga0070706_100040226 3300005467 Bacteria 4315
15 Ga0070706_100082161 3300005467 Bacteria 2984
16 Ga0070706_100106782 3300005467 Bacteria 2604
17 Ga0070707_100000293 3300005468 Bacteria 49051
18 Ga0070707_100010098 3300005468 Bacteria 8786
19 Ga0070707_100012405 3300005468 Bacteria 7959
20 Ga0070707_100038648 3300005468 Bacteria 4560
21 Ga0070707_100049124 3300005468 Bacteria 4043
22 Ga0070707_100053530 3300005468 Bacteria 3869
23 Ga0070698_100000106 3300005471 Bacteria 69519
24 Ga0070698_100014887 3300005471 Bacteria 8222
25 Ga0070698_100030097 3300005471 Bacteria 5632
26 Ga0070699_100040178 3300005518 Bacteria 4051
27 Ga0070697_100012528 3300005536 Bacteria 6645
28 Ga0068853_100147763 3300005539 Bacteria 2114
29 Ga0070665_100001947 3300005548 Bacteria 23263
30 Ga0068856_100116853 3300005614 Bacteria 2668
31 Ga0068863_100000795 3300005841 Bacteria 31676
32 Ga0068860_100000297 3300005843 Bacteria 69029
33 Ga0070717_10105039 3300006028 Bacteria 2403
34 Ga0075365_10046395 3300006038 Bacteria 2853
35 Ga0075368_10011842 3300006042 Bacteria 3182
36 Ga0075364_10012731 3300006051 Bacteria 5158
37 Ga0070716_100006626 3300006173 Bacteria 5665
38 Ga0070712_100001455 3300006175 Bacteria 14428
39 Ga0075369_10024059 3300006186 Bacteria 2522
40 Ga0068871_100072040 3300006358 Bacteria 2844
41 Ga0075434_100018961 3300006871 Bacteria 6650
42 Ga0075435_100002002 3300007076 Bacteria 13339
43 Ga0105240_10098379 3300009093 Bacteria 3563
44 Ga0105245_10052937 3300009098 Bacteria 3642
45 Ga0105237_10142269 3300009545 Bacteria 2393
46 Ga0157370_10022208 3300013104 Bacteria 6314
47 Ga0157370_10228408 3300013104 Bacteria 1723
48 Ga0157372_10000024 3300013307 Bacteria 197716
49 Ga0163163_10161653 3300014325 Bacteria 2285
50 Ga0157379_10140690 3300014968 Bacteria 2175
51 Ga0213875_10018068 3300021388 Bacteria 3402
52 Ga0207692_10001932 3300025898 Bacteria 7902
53 Ga0207699_10001646 3300025906 Bacteria 10598
54 Ga0207684_10023560 3300025910 Bacteria 5256
55 Ga0207684_10063220 3300025910 Bacteria 3143
56 Ga0207663_10001400 3300025916 Bacteria 11181
57 Ga0207646_10000050 3300025922 Bacteria 171554
58 Ga0207646_10005142 3300025922 Bacteria 13865
59 Ga0207646_10010918 3300025922 Bacteria 8823
60 Ga0207646_10019247 3300025922 Bacteria 6347
61 Ga0207646_10037061 3300025922 Bacteria 4398
62 Ga0207694_10203092 3300025924 Bacteria 1613
63 Ga0207687_10036241 3300025927 Bacteria 3359
64 Ga0207700_10008415 3300025928 Bacteria 6389
65 Ga0207700_10041611 3300025928 Bacteria 3363
66 Ga0207664_10000009 3300025929 Bacteria 299246
67 Ga0207664_10000835 3300025929 Bacteria 20891
68 Ga0207664_10005102 3300025929 Bacteria 8945
69 Ga0207665_10005907 3300025939 Bacteria 8148
70 Ga0207668_10013648 3300025972 Bacteria 5011
71 Ga0207658_10007005 3300025986 Bacteria 7676
72 Ga0207708_10000011 3300026075 Bacteria 214227
73 Ga0207702_10008591 3300026078 Bacteria 8612
74 Ga0207641_10002579 3300026088 Bacteria 16648
75 Ga0207674_10084052 3300026116 Bacteria 3182
76 Ga0268266_10004293 3300028379 Bacteria 13719
77 Ga0268264_10000353 3300028381 Bacteria 69101
78 Ga0373934_0000058 3300035086 Bacteria 37451
79 Ga0373934_0018903 3300035086 Bacteria 2640
80 Ga0373923_0005730 3300035111 Bacteria 4236
81 Ga0373953_0001411 3300035117 Bacteria 6934
82 Ga0373954_0012070 3300035118 Bacteria 3838
83 Ga0373954_0045485 3300035118 Bacteria 2051
84 Ga0373954_0053669 3300035118 Bacteria 1895
85 Ga0373956_0002184 3300035119 Bacteria 8068
86 Ga0373956_0031978 3300035119 Bacteria 2307
87 Ga0373955_0000156 3300035172 Bacteria 27424
88 Ga0373924_0003253 3300035410 Bacteria 5557
89 Ga0373924_0007789 3300035410 Bacteria 3872
90 Ga0373924_0023472 3300035410 Bacteria 2420
91 Ga0373935_0000691 3300035692 Bacteria 17857
92 Ga0373935_0022321 3300035692 Bacteria 3879
93 Ga0373933_0000009 3300035724 Bacteria 112662
94 Ga0373947_0000075 3300035725 Bacteria 50183
95 Ga0373947_0024527 3300035725 Bacteria 3515
96 Ga0373937_0000110 3300036401 Bacteria 77832
97 Ga0373937_0011293 3300036401 Bacteria 7833
98 Ga0373925_0002022 3300037068 Bacteria 16779
99 Ga0436364_0096312 3300037853 Bacteria 13762
100 Ga0436364_0331985 3300037853 Bacteria 2229
101 Ga0436364_1305561 3300037853 Bacteria 11157
102 Ga0451837_0422477 3300041494 Bacteria 2519
103 Ga0466966_0010782 3300044684 Bacteria 6074
104 Ga0466961_0066842 3300044693 Bacteria 2283
105 Ga0466959_0020784 3300045049 Bacteria 4838
106 Ga0495592_0000049 3300046454 Bacteria 113704
107 Ga0495592_0055076 3300046454 Bacteria 2943
108 Ga0495629_0013908 3300046459 Bacteria 5802
109 Ga0495651_0000007 3300046462 Bacteria 158577
110 Ga0495651_0011876 3300046462 Bacteria 6700
111 Ga0495653_0023346 3300046463 Bacteria 4998
112 Ga0495582_0004911 3300046473 Bacteria 7492
113 Ga0495662_0002836 3300046476 Bacteria 8767
114 Ga0495664_0042687 3300046477 Bacteria 2686
115 Ga0495664_0052526 3300046477 Bacteria 2422
116 Ga0495664_0118241 3300046477 Bacteria 1602
117 Ga0495608_0000076 3300046511 Bacteria 74854
118 Ga0495608_0061745 3300046511 Bacteria 2463
119 Ga0495618_0051873 3300046514 Bacteria 2591
120 Ga0495628_0014731 3300046516 Bacteria 6545
121 Ga0495630_0119433 3300046517 Bacteria 1999
122 Ga0495630_0120094 3300046517 Bacteria 1994
123 Ga0495652_0000168 3300046529 Bacteria 74913
124 Ga0495640_0012041 3300046533 Bacteria 6628
125 Ga0495640_0106052 3300046533 Bacteria 1840
126 Ga0495586_0003099 3300046535 Bacteria 8963
127 Ga0495586_0037808 3300046535 Bacteria 2591
128 Ga0495586_0075671 3300046535 Bacteria 1843
129 Ga0495587_0000032 3300046536 Bacteria 124143
130 Ga0495587_0031490 3300046536 Bacteria 3211
131 Ga0495587_0061781 3300046536 Bacteria 2194
132 Ga0495645_0013759 3300046543 Bacteria 5732
133 Ga0495645_0027673 3300046543 Bacteria 4119
134 Ga0495645_0036287 3300046543 Bacteria 3593
135 Ga0495645_0044673 3300046543 Bacteria 3231
136 Ga0495667_0000072 3300046559 Bacteria 75080
137 Ga0495667_0024665 3300046559 Bacteria 4050
138 Ga0495667_0044578 3300046559 Bacteria 2937
139 Ga0495634_0018427 3300046642 Bacteria 4970
140 Ga0495635_0073817 3300046663 Bacteria 2337
141 Ga0495657_0000106 3300046675 Bacteria 74585
142 Ga0495599_0000062 3300046678 Bacteria 74940
143 Ga0495599_0030553 3300046678 Bacteria 3380
144 Ga0495623_0005307 3300046679 Bacteria 8444
145 Ga0495623_0035025 3300046679 Bacteria 3218
146 Ga0495646_0003238 3300046680 Bacteria 10125
147 Ga0495646_0083861 3300046680 Bacteria 1851
148 Ga0495613_0031339 3300046689 Bacteria 3949
149 Ga0495624_0014674 3300046690 Bacteria 5306
150 Ga0495600_0017423 3300046809 Bacteria 4569
151 Ga0495581_0014410 3300047315 Bacteria 4585
152 Ga0495604_0000062 3300047317 Bacteria 93264
153 Ga0495680_0000101 3300047322 Bacteria 78550
154 Ga0495680_0038666 3300047322 Bacteria 3811
155 Ga0495680_0077183 3300047322 Bacteria 2523
156 Ga0495675_0000116 3300047444 Bacteria 57631
157 Ga0495684_0127423 3300047471 Bacteria 1914
158 Ga0495593_0017476 3300047673 Bacteria 4037
159 Ga0495602_0000115 3300048088 Bacteria 75982
160 Ga0495602_0056525 3300048088 Bacteria 3449
161 Ga0495602_0129898 3300048088 Bacteria 2011
162 Ga0496104_0044667 3300048907 Bacteria 4163
163 Ga0496104_0144820 3300048907 Bacteria 2281
164 Ga0496105_0009832 3300048908 Bacteria 7496
165 Ga0496105_0272147 3300048908 Bacteria 1367
166 Ga0496109_0029654 3300048912 Bacteria 4901
167 Ga0496113_0003952 3300048916 Bacteria 8999
168 Ga0496114_0040269 3300048917 Bacteria 3867
169 Ga0496115_0120968 3300048918 Bacteria 2154
170 Ga0496117_0001882 3300048920 Bacteria 28223
171 Ga0496118_0011658 3300048921 Bacteria 8549
172 Ga0496118_0107183 3300048921 Bacteria 1867
173 Ga0496119_0002996 3300048922 Bacteria 17913
174 Ga0496122_0000420 3300048925 Bacteria 89921
175 Ga0496122_0001338 3300048925 Bacteria 40252
176 Ga0496123_0000354 3300048926 Bacteria 86153
177 Ga0496123_0013226 3300048926 Bacteria 6954
178 Ga0496123_0027178 3300048926 Bacteria 4268
179 Ga0496124_0002851 3300048927 Bacteria 21850
180 Ga0496125_0022745 3300048928 Bacteria 5811
181 Ga0501042_0005703 3300049578 Bacteria 8037
182 Ga0501047_0067685 3300049581 Bacteria 3441
183 nmdc:mga00v17_12530_c1 3300050491 Bacteria 4681
184 nmdc:mga00v17_67927_c1 3300050491 Bacteria 2203
185 nmdc:mga0yw44_69036_c1 3300050492 Bacteria 2188
186 nmdc:mga0n895_14546_c1 3300050512 Bacteria 7152
187 nmdc:mga0rr50_2048_c1 3300050513 Bacteria 11241
188 nmdc:mga0rr50_257238_c1 3300050513 Bacteria 1452
189 nmdc:mga08x19_6258_c1 3300050514 Bacteria 7048
190 nmdc:mga0sz30_29050_c1 3300050516 Bacteria 2277
191 Ga0495601_0036688 3300053077 Bacteria 3063
192 Ga0495612_0004906 3300053078 Bacteria 5534
193 Ga0495595_0001153 3300053084 Bacteria 10235
194 Ga0495595_0008234 3300053084 Bacteria 4281
195 Ga0495619_0002071 3300053085 Bacteria 13328
196 Ga0500616_0000115 3300053153 Bacteria 147212
197 Ga0590075_012084 3300059424 Bacteria 2094
198 2515852363 2515154155 Bacteria 7985436
199 2588109283 2585428157 Bacteria 3018951
200 2643754430 2643221546 Bacteria 2910897
201 2643849022 2643221566 Bacteria 3460379
202 2643886308 2643221575 Bacteria 4022601
203 2643995198 2643221597 Bacteria 3347721
204 2676477530 2675903058 Bacteria 6822861
205 2676489891 2675903060 Bacteria 10051191
206 2774383327 2773857759 Bacteria 2963774
207 2774398677 2773857763 Bacteria 4180068
208 2795780339 2795385470 Bacteria 8317180
209 2827634788 2827628540 Bacteria 6858585
210 2833711757 2833709550 Bacteria 4008291
211 2856741537 2856741275 Bacteria 8096094
212 2873314476 2873314349 Bacteria 8512634
213 2884694704 2884693830 Bacteria 11273186
214 2891401199 2891395885 Bacteria 9251614
215 2891560103 2891554331 Bacteria 8812224
216 2891563535 2891562705 Bacteria 8039471
217 2895433210 2895427314 Bacteria 13147766
218 2895447149 2895442618 Bacteria 11027144
219 2906801021 2906799679 Bacteria 4031749
220 3003004910 3002998708 Bacteria 11715108
221 8004214775 8004212874 Bacteria 2861420
222 8046353634 8046352972 Bacteria 3613806
223 8053952130 8053945823 Bacteria 8962862
224 8055071144 8055066027 Bacteria 9479577
225 8055175948 8055172936 Bacteria 9305943
226 Ga0070709_10000441
227 Ga0065714_10078504
228 Ga0070658_10001187
229 Ga0070666_10003085
230 Ga0070671_100016034
231 Ga0070714_100000010
232 Ga0070714_100047268
233 Ga0070714_100084169
234 Ga0070713_100004460
235 Ga0070710_10000167
236 Ga0070711_100001149
237 Ga0070700_100000052
238 Ga0070708_100180169
239 Ga0070706_100040226
240 Ga0070706_100082161
241 Ga0070706_100106782
242 Ga0070707_100000293
243 Ga0070707_100010098
244 Ga0070707_100012405
245 Ga0070707_100038648
246 Ga0070707_100049124
247 Ga0070707_100053530
248 Ga0070698_100000106
249 Ga0070698_100014887
250 Ga0070698_100030097
251 Ga0070699_100040178
252 Ga0070697_100012528
253 Ga0068853_100147763
254 Ga0070665_100001947
255 Ga0068856_100116853
256 Ga0068863_100000795
257 Ga0068860_100000297
258 Ga0070717_10105039
259 Ga0075365_10046395
260 Ga0075368_10011842
261 Ga0075364_10012731
262 Ga0070716_100006626
263 Ga0070712_100001455
264 Ga0075369_10024059
265 Ga0068871_100072040
266 Ga0075434_100018961
267 Ga0075435_100002002
268 Ga0105240_10098379
269 Ga0105245_10052937
270 Ga0105237_10142269
271 Ga0157370_10022208
272 Ga0157370_10228408
273 Ga0157372_10000024
274 Ga0163163_10161653
275 Ga0157379_10140690
276 Ga0213875_10018068
277 Ga0207692_10001932
278 Ga0207699_10001646
279 Ga0207684_10023560
280 Ga0207684_10063220
281 Ga0207663_10001400
282 Ga0207646_10000050
283 Ga0207646_10005142
284 Ga0207646_10010918
285 Ga0207646_10019247
286 Ga0207646_10037061
287 Ga0207694_10203092
288 Ga0207687_10036241
289 Ga0207700_10008415
290 Ga0207700_10041611
291 Ga0207664_10000009
292 Ga0207664_10000835
293 Ga0207664_10005102
294 Ga0207665_10005907
295 Ga0207668_10013648
296 Ga0207658_10007005
297 Ga0207708_10000011
298 Ga0207702_10008591
299 Ga0207641_10002579
300 Ga0207674_10084052
301 Ga0268266_10004293
302 Ga0268264_10000353
303 Ga0373934_0000058
304 Ga0373934_0018903
305 Ga0373923_0005730
306 Ga0373953_0001411
307 Ga0373954_0012070
308 Ga0373954_0045485
309 Ga0373954_0053669
310 Ga0373956_0002184
311 Ga0373956_0031978
312 Ga0373955_0000156
313 Ga0373924_0003253
314 Ga0373924_0007789
315 Ga0373924_0023472
316 Ga0373935_0000691
317 Ga0373935_0022321
318 Ga0373933_0000009
319 Ga0373947_0000075
320 Ga0373947_0024527
321 Ga0373937_0000110
322 Ga0373937_0011293
323 Ga0373925_0002022
324 Ga0436364_0096312
325 Ga0436364_0331985
326 Ga0436364_1305561
327 Ga0451837_0422477
328 Ga0466966_0010782
329 Ga0466961_0066842
330 Ga0466959_0020784
331 Ga0495592_0000049
332 Ga0495592_0055076
333 Ga0495629_0013908
334 Ga0495651_0000007
335 Ga0495651_0011876
336 Ga0495653_0023346
337 Ga0495582_0004911
338 Ga0495662_0002836
339 Ga0495664_0042687
340 Ga0495664_0052526
341 Ga0495664_0118241
342 Ga0495608_0000076
343 Ga0495608_0061745
344 Ga0495618_0051873
345 Ga0495628_0014731
346 Ga0495630_0119433
347 Ga0495630_0120094
348 Ga0495652_0000168
349 Ga0495640_0012041
350 Ga0495640_0106052
351 Ga0495586_0003099
352 Ga0495586_0037808
353 Ga0495586_0075671
354 Ga0495587_0000032
355 Ga0495587_0031490
356 Ga0495587_0061781
357 Ga0495645_0013759
358 Ga0495645_0027673
359 Ga0495645_0036287
360 Ga0495645_0044673
361 Ga0495667_0000072
362 Ga0495667_0024665
363 Ga0495667_0044578
364 Ga0495634_0018427
365 Ga0495635_0073817
366 Ga0495657_0000106
367 Ga0495599_0000062
368 Ga0495599_0030553
369 Ga0495623_0005307
370 Ga0495623_0035025
371 Ga0495646_0003238
372 Ga0495646_0083861
373 Ga0495613_0031339
374 Ga0495624_0014674
375 Ga0495600_0017423
376 Ga0495581_0014410
377 Ga0495604_0000062
378 Ga0495680_0000101
379 Ga0495680_0038666
380 Ga0495680_0077183
381 Ga0495675_0000116
382 Ga0495684_0127423
383 Ga0495593_0017476
384 Ga0495602_0000115
385 Ga0495602_0056525
386 Ga0495602_0129898
387 Ga0496104_0044667
388 Ga0496104_0144820
389 Ga0496105_0009832
390 Ga0496105_0272147
391 Ga0496109_0029654
392 Ga0496113_0003952
393 Ga0496114_0040269
394 Ga0496115_0120968
395 Ga0496117_0001882
396 Ga0496118_0011658
397 Ga0496118_0107183
398 Ga0496119_0002996
399 Ga0496122_0000420
400 Ga0496122_0001338
401 Ga0496123_0000354
402 Ga0496123_0013226
403 Ga0496123_0027178
404 Ga0496124_0002851
405 Ga0496125_0022745
406 Ga0501042_0005703
407 Ga0501047_0067685
408 nmdc:mga00v17_12530_c1
409 nmdc:mga00v17_67927_c1
410 nmdc:mga0yw44_69036_c1
411 nmdc:mga0n895_14546_c1
412 nmdc:mga0rr50_2048_c1
413 nmdc:mga0rr50_257238_c1
414 nmdc:mga08x19_6258_c1
415 nmdc:mga0sz30_29050_c1
416 Ga0495601_0036688
417 Ga0495612_0004906
418 Ga0495595_0001153
419 Ga0495595_0008234
420 Ga0495619_0002071
421 Ga0500616_0000115
422 Ga0590075_012084
423 2515852363
424 2588109283
425 2643754430
426 2643849022
427 2643886308
428 2643995198
429 2676477530
430 2676489891
431 2774383327
432 2774398677
433 2795780339
434 2827634788
435 2833711757
436 2856741537
437 2873314476
438 2884694704
439 2891401199
440 2891560103
441 2891563535
442 2895433210
443 2895447149
444 2906801021
445 3003004910
446 8004214775
447 8046353634
448 8053952130
449 8055071144
450 8055175948

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

52

350

0.99

PF09190

DALR_2

DALR domain

383

439

0.94

PF23493

449

502

0.93

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

67

144

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.9314 4 412
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9271 8 412
1li7-assembly1.cif.gz_A crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9264 8 412
1li7-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9227 8 412
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.922 4 412
ID Description Score Start End Superfamily
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9557 23 310 3.40.50.620
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9523 23 310 3.40.50.620
af_P9WFW1_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9466 1 307 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9448 8 310 3.40.50.620
af_P9WFW1_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9406 1 307 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A382D4Z0-F1-model_v4 tRNA synthetases class I catalytic domain-containing protein 0.9752 6 165 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-J1F6D8-F1-model_v4 Cysteinyl-tRNA synthetase 0.9745 9 135 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3N5PRA2-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9744 9 164 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A2E6GAX5-F1-model_v4 Cysteine--tRNA ligase 0.974 6 148 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-Q6ADI1-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) (Cysteinyl-tRNA synthetase) (CysRS) 0.9721 6 471 GO:0004817
GO:0005524
GO:0005829
GO:0006423
GO:0008270

Map