F337489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 162 | 450 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10000441|Ga0070709_1000044114 |
| Length | 506 |
| Sequence | MEIRVAGGGGGARVGWRRACGVDYRPAGGTDGGSLGGVTLRLHDTATRSEREFSPVEPGKASLYLCGATVQAPPHIGHIRSGVSFDILVRWLRASGYQVTFCRNVTDIDDKILRVAAGEGVPWWAVSQRNERAFSRAYDVLGCLPPEVEPRATGHIPEMITLMRRLIDGGHAYASGGDVYFDVHSWPAYGALSGQRLDHMRPAEDTETAENKRDPRDFSLWKRAKPGEPAWDTPWGPXXXXWHLECSAMATKYLGPTFDIHGGGLDLVFPHHENELAQSCAAGDGFARYWMHNGLVGVAGEKMSKSLGNSLLVDAMVTQVRPVELRYYLGQVHYRSNIEYSPEALDEAVTAYRRIEGFVVRAAELTGDTQDPAGVGRDALPPAFAAALDNDLGVPQALAVVHETIRDGHNALAAGDHVAVAAALAQVRAMLDVLGLDPLAANWATPGADDDLRAVVKALVGVALDQRQDAKDRKNYEAADAIRDSLRAAGVLIEDTPDGQRWTIKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 40 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 59 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 60 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 61 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 62 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 63 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 64 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 65 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 66 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 67 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 68 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 69 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 71 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 72 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 73 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 74 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 75 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 109 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 110 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 112 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 114 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 115 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 116 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 117 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 118 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 119 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 124 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 125 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 129 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 134 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 135 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 136 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 137 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 138 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 139 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 140 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 141 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 142 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 143 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 144 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 145 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 146 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 147 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 148 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 149 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 150 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 151 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 152 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 153 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 154 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 155 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 156 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 157 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 158 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 159 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 160 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 161 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 162 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.56 |
| Metatranscriptomes | 0 |
| Isolates | 12.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4 |
| Nodule | 0 |
| Rhizoplane | 3.56 |
| Rhizosphere | 77.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10000441 | 3300005434 | Bacteria | 25152 |
| 2 | Ga0065714_10078504 | 3300005288 | Bacteria | 2593 |
| 3 | Ga0070658_10001187 | 3300005327 | Bacteria | 22269 |
| 4 | Ga0070666_10003085 | 3300005335 | Bacteria | 10112 |
| 5 | Ga0070671_100016034 | 3300005355 | Bacteria | 6055 |
| 6 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 7 | Ga0070714_100047268 | 3300005435 | Bacteria | 3655 |
| 8 | Ga0070714_100084169 | 3300005435 | Bacteria | 2775 |
| 9 | Ga0070713_100004460 | 3300005436 | Bacteria | 9407 |
| 10 | Ga0070710_10000167 | 3300005437 | Bacteria | 30282 |
| 11 | Ga0070711_100001149 | 3300005439 | Bacteria | 14217 |
| 12 | Ga0070700_100000052 | 3300005441 | Bacteria | 85282 |
| 13 | Ga0070708_100180169 | 3300005445 | Bacteria | 1974 |
| 14 | Ga0070706_100040226 | 3300005467 | Bacteria | 4315 |
| 15 | Ga0070706_100082161 | 3300005467 | Bacteria | 2984 |
| 16 | Ga0070706_100106782 | 3300005467 | Bacteria | 2604 |
| 17 | Ga0070707_100000293 | 3300005468 | Bacteria | 49051 |
| 18 | Ga0070707_100010098 | 3300005468 | Bacteria | 8786 |
| 19 | Ga0070707_100012405 | 3300005468 | Bacteria | 7959 |
| 20 | Ga0070707_100038648 | 3300005468 | Bacteria | 4560 |
| 21 | Ga0070707_100049124 | 3300005468 | Bacteria | 4043 |
| 22 | Ga0070707_100053530 | 3300005468 | Bacteria | 3869 |
| 23 | Ga0070698_100000106 | 3300005471 | Bacteria | 69519 |
| 24 | Ga0070698_100014887 | 3300005471 | Bacteria | 8222 |
| 25 | Ga0070698_100030097 | 3300005471 | Bacteria | 5632 |
| 26 | Ga0070699_100040178 | 3300005518 | Bacteria | 4051 |
| 27 | Ga0070697_100012528 | 3300005536 | Bacteria | 6645 |
| 28 | Ga0068853_100147763 | 3300005539 | Bacteria | 2114 |
| 29 | Ga0070665_100001947 | 3300005548 | Bacteria | 23263 |
| 30 | Ga0068856_100116853 | 3300005614 | Bacteria | 2668 |
| 31 | Ga0068863_100000795 | 3300005841 | Bacteria | 31676 |
| 32 | Ga0068860_100000297 | 3300005843 | Bacteria | 69029 |
| 33 | Ga0070717_10105039 | 3300006028 | Bacteria | 2403 |
| 34 | Ga0075365_10046395 | 3300006038 | Bacteria | 2853 |
| 35 | Ga0075368_10011842 | 3300006042 | Bacteria | 3182 |
| 36 | Ga0075364_10012731 | 3300006051 | Bacteria | 5158 |
| 37 | Ga0070716_100006626 | 3300006173 | Bacteria | 5665 |
| 38 | Ga0070712_100001455 | 3300006175 | Bacteria | 14428 |
| 39 | Ga0075369_10024059 | 3300006186 | Bacteria | 2522 |
| 40 | Ga0068871_100072040 | 3300006358 | Bacteria | 2844 |
| 41 | Ga0075434_100018961 | 3300006871 | Bacteria | 6650 |
| 42 | Ga0075435_100002002 | 3300007076 | Bacteria | 13339 |
| 43 | Ga0105240_10098379 | 3300009093 | Bacteria | 3563 |
| 44 | Ga0105245_10052937 | 3300009098 | Bacteria | 3642 |
| 45 | Ga0105237_10142269 | 3300009545 | Bacteria | 2393 |
| 46 | Ga0157370_10022208 | 3300013104 | Bacteria | 6314 |
| 47 | Ga0157370_10228408 | 3300013104 | Bacteria | 1723 |
| 48 | Ga0157372_10000024 | 3300013307 | Bacteria | 197716 |
| 49 | Ga0163163_10161653 | 3300014325 | Bacteria | 2285 |
| 50 | Ga0157379_10140690 | 3300014968 | Bacteria | 2175 |
| 51 | Ga0213875_10018068 | 3300021388 | Bacteria | 3402 |
| 52 | Ga0207692_10001932 | 3300025898 | Bacteria | 7902 |
| 53 | Ga0207699_10001646 | 3300025906 | Bacteria | 10598 |
| 54 | Ga0207684_10023560 | 3300025910 | Bacteria | 5256 |
| 55 | Ga0207684_10063220 | 3300025910 | Bacteria | 3143 |
| 56 | Ga0207663_10001400 | 3300025916 | Bacteria | 11181 |
| 57 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 58 | Ga0207646_10005142 | 3300025922 | Bacteria | 13865 |
| 59 | Ga0207646_10010918 | 3300025922 | Bacteria | 8823 |
| 60 | Ga0207646_10019247 | 3300025922 | Bacteria | 6347 |
| 61 | Ga0207646_10037061 | 3300025922 | Bacteria | 4398 |
| 62 | Ga0207694_10203092 | 3300025924 | Bacteria | 1613 |
| 63 | Ga0207687_10036241 | 3300025927 | Bacteria | 3359 |
| 64 | Ga0207700_10008415 | 3300025928 | Bacteria | 6389 |
| 65 | Ga0207700_10041611 | 3300025928 | Bacteria | 3363 |
| 66 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 67 | Ga0207664_10000835 | 3300025929 | Bacteria | 20891 |
| 68 | Ga0207664_10005102 | 3300025929 | Bacteria | 8945 |
| 69 | Ga0207665_10005907 | 3300025939 | Bacteria | 8148 |
| 70 | Ga0207668_10013648 | 3300025972 | Bacteria | 5011 |
| 71 | Ga0207658_10007005 | 3300025986 | Bacteria | 7676 |
| 72 | Ga0207708_10000011 | 3300026075 | Bacteria | 214227 |
| 73 | Ga0207702_10008591 | 3300026078 | Bacteria | 8612 |
| 74 | Ga0207641_10002579 | 3300026088 | Bacteria | 16648 |
| 75 | Ga0207674_10084052 | 3300026116 | Bacteria | 3182 |
| 76 | Ga0268266_10004293 | 3300028379 | Bacteria | 13719 |
| 77 | Ga0268264_10000353 | 3300028381 | Bacteria | 69101 |
| 78 | Ga0373934_0000058 | 3300035086 | Bacteria | 37451 |
| 79 | Ga0373934_0018903 | 3300035086 | Bacteria | 2640 |
| 80 | Ga0373923_0005730 | 3300035111 | Bacteria | 4236 |
| 81 | Ga0373953_0001411 | 3300035117 | Bacteria | 6934 |
| 82 | Ga0373954_0012070 | 3300035118 | Bacteria | 3838 |
| 83 | Ga0373954_0045485 | 3300035118 | Bacteria | 2051 |
| 84 | Ga0373954_0053669 | 3300035118 | Bacteria | 1895 |
| 85 | Ga0373956_0002184 | 3300035119 | Bacteria | 8068 |
| 86 | Ga0373956_0031978 | 3300035119 | Bacteria | 2307 |
| 87 | Ga0373955_0000156 | 3300035172 | Bacteria | 27424 |
| 88 | Ga0373924_0003253 | 3300035410 | Bacteria | 5557 |
| 89 | Ga0373924_0007789 | 3300035410 | Bacteria | 3872 |
| 90 | Ga0373924_0023472 | 3300035410 | Bacteria | 2420 |
| 91 | Ga0373935_0000691 | 3300035692 | Bacteria | 17857 |
| 92 | Ga0373935_0022321 | 3300035692 | Bacteria | 3879 |
| 93 | Ga0373933_0000009 | 3300035724 | Bacteria | 112662 |
| 94 | Ga0373947_0000075 | 3300035725 | Bacteria | 50183 |
| 95 | Ga0373947_0024527 | 3300035725 | Bacteria | 3515 |
| 96 | Ga0373937_0000110 | 3300036401 | Bacteria | 77832 |
| 97 | Ga0373937_0011293 | 3300036401 | Bacteria | 7833 |
| 98 | Ga0373925_0002022 | 3300037068 | Bacteria | 16779 |
| 99 | Ga0436364_0096312 | 3300037853 | Bacteria | 13762 |
| 100 | Ga0436364_0331985 | 3300037853 | Bacteria | 2229 |
| 101 | Ga0436364_1305561 | 3300037853 | Bacteria | 11157 |
| 102 | Ga0451837_0422477 | 3300041494 | Bacteria | 2519 |
| 103 | Ga0466966_0010782 | 3300044684 | Bacteria | 6074 |
| 104 | Ga0466961_0066842 | 3300044693 | Bacteria | 2283 |
| 105 | Ga0466959_0020784 | 3300045049 | Bacteria | 4838 |
| 106 | Ga0495592_0000049 | 3300046454 | Bacteria | 113704 |
| 107 | Ga0495592_0055076 | 3300046454 | Bacteria | 2943 |
| 108 | Ga0495629_0013908 | 3300046459 | Bacteria | 5802 |
| 109 | Ga0495651_0000007 | 3300046462 | Bacteria | 158577 |
| 110 | Ga0495651_0011876 | 3300046462 | Bacteria | 6700 |
| 111 | Ga0495653_0023346 | 3300046463 | Bacteria | 4998 |
| 112 | Ga0495582_0004911 | 3300046473 | Bacteria | 7492 |
| 113 | Ga0495662_0002836 | 3300046476 | Bacteria | 8767 |
| 114 | Ga0495664_0042687 | 3300046477 | Bacteria | 2686 |
| 115 | Ga0495664_0052526 | 3300046477 | Bacteria | 2422 |
| 116 | Ga0495664_0118241 | 3300046477 | Bacteria | 1602 |
| 117 | Ga0495608_0000076 | 3300046511 | Bacteria | 74854 |
| 118 | Ga0495608_0061745 | 3300046511 | Bacteria | 2463 |
| 119 | Ga0495618_0051873 | 3300046514 | Bacteria | 2591 |
| 120 | Ga0495628_0014731 | 3300046516 | Bacteria | 6545 |
| 121 | Ga0495630_0119433 | 3300046517 | Bacteria | 1999 |
| 122 | Ga0495630_0120094 | 3300046517 | Bacteria | 1994 |
| 123 | Ga0495652_0000168 | 3300046529 | Bacteria | 74913 |
| 124 | Ga0495640_0012041 | 3300046533 | Bacteria | 6628 |
| 125 | Ga0495640_0106052 | 3300046533 | Bacteria | 1840 |
| 126 | Ga0495586_0003099 | 3300046535 | Bacteria | 8963 |
| 127 | Ga0495586_0037808 | 3300046535 | Bacteria | 2591 |
| 128 | Ga0495586_0075671 | 3300046535 | Bacteria | 1843 |
| 129 | Ga0495587_0000032 | 3300046536 | Bacteria | 124143 |
| 130 | Ga0495587_0031490 | 3300046536 | Bacteria | 3211 |
| 131 | Ga0495587_0061781 | 3300046536 | Bacteria | 2194 |
| 132 | Ga0495645_0013759 | 3300046543 | Bacteria | 5732 |
| 133 | Ga0495645_0027673 | 3300046543 | Bacteria | 4119 |
| 134 | Ga0495645_0036287 | 3300046543 | Bacteria | 3593 |
| 135 | Ga0495645_0044673 | 3300046543 | Bacteria | 3231 |
| 136 | Ga0495667_0000072 | 3300046559 | Bacteria | 75080 |
| 137 | Ga0495667_0024665 | 3300046559 | Bacteria | 4050 |
| 138 | Ga0495667_0044578 | 3300046559 | Bacteria | 2937 |
| 139 | Ga0495634_0018427 | 3300046642 | Bacteria | 4970 |
| 140 | Ga0495635_0073817 | 3300046663 | Bacteria | 2337 |
| 141 | Ga0495657_0000106 | 3300046675 | Bacteria | 74585 |
| 142 | Ga0495599_0000062 | 3300046678 | Bacteria | 74940 |
| 143 | Ga0495599_0030553 | 3300046678 | Bacteria | 3380 |
| 144 | Ga0495623_0005307 | 3300046679 | Bacteria | 8444 |
| 145 | Ga0495623_0035025 | 3300046679 | Bacteria | 3218 |
| 146 | Ga0495646_0003238 | 3300046680 | Bacteria | 10125 |
| 147 | Ga0495646_0083861 | 3300046680 | Bacteria | 1851 |
| 148 | Ga0495613_0031339 | 3300046689 | Bacteria | 3949 |
| 149 | Ga0495624_0014674 | 3300046690 | Bacteria | 5306 |
| 150 | Ga0495600_0017423 | 3300046809 | Bacteria | 4569 |
| 151 | Ga0495581_0014410 | 3300047315 | Bacteria | 4585 |
| 152 | Ga0495604_0000062 | 3300047317 | Bacteria | 93264 |
| 153 | Ga0495680_0000101 | 3300047322 | Bacteria | 78550 |
| 154 | Ga0495680_0038666 | 3300047322 | Bacteria | 3811 |
| 155 | Ga0495680_0077183 | 3300047322 | Bacteria | 2523 |
| 156 | Ga0495675_0000116 | 3300047444 | Bacteria | 57631 |
| 157 | Ga0495684_0127423 | 3300047471 | Bacteria | 1914 |
| 158 | Ga0495593_0017476 | 3300047673 | Bacteria | 4037 |
| 159 | Ga0495602_0000115 | 3300048088 | Bacteria | 75982 |
| 160 | Ga0495602_0056525 | 3300048088 | Bacteria | 3449 |
| 161 | Ga0495602_0129898 | 3300048088 | Bacteria | 2011 |
| 162 | Ga0496104_0044667 | 3300048907 | Bacteria | 4163 |
| 163 | Ga0496104_0144820 | 3300048907 | Bacteria | 2281 |
| 164 | Ga0496105_0009832 | 3300048908 | Bacteria | 7496 |
| 165 | Ga0496105_0272147 | 3300048908 | Bacteria | 1367 |
| 166 | Ga0496109_0029654 | 3300048912 | Bacteria | 4901 |
| 167 | Ga0496113_0003952 | 3300048916 | Bacteria | 8999 |
| 168 | Ga0496114_0040269 | 3300048917 | Bacteria | 3867 |
| 169 | Ga0496115_0120968 | 3300048918 | Bacteria | 2154 |
| 170 | Ga0496117_0001882 | 3300048920 | Bacteria | 28223 |
| 171 | Ga0496118_0011658 | 3300048921 | Bacteria | 8549 |
| 172 | Ga0496118_0107183 | 3300048921 | Bacteria | 1867 |
| 173 | Ga0496119_0002996 | 3300048922 | Bacteria | 17913 |
| 174 | Ga0496122_0000420 | 3300048925 | Bacteria | 89921 |
| 175 | Ga0496122_0001338 | 3300048925 | Bacteria | 40252 |
| 176 | Ga0496123_0000354 | 3300048926 | Bacteria | 86153 |
| 177 | Ga0496123_0013226 | 3300048926 | Bacteria | 6954 |
| 178 | Ga0496123_0027178 | 3300048926 | Bacteria | 4268 |
| 179 | Ga0496124_0002851 | 3300048927 | Bacteria | 21850 |
| 180 | Ga0496125_0022745 | 3300048928 | Bacteria | 5811 |
| 181 | Ga0501042_0005703 | 3300049578 | Bacteria | 8037 |
| 182 | Ga0501047_0067685 | 3300049581 | Bacteria | 3441 |
| 183 | nmdc:mga00v17_12530_c1 | 3300050491 | Bacteria | 4681 |
| 184 | nmdc:mga00v17_67927_c1 | 3300050491 | Bacteria | 2203 |
| 185 | nmdc:mga0yw44_69036_c1 | 3300050492 | Bacteria | 2188 |
| 186 | nmdc:mga0n895_14546_c1 | 3300050512 | Bacteria | 7152 |
| 187 | nmdc:mga0rr50_2048_c1 | 3300050513 | Bacteria | 11241 |
| 188 | nmdc:mga0rr50_257238_c1 | 3300050513 | Bacteria | 1452 |
| 189 | nmdc:mga08x19_6258_c1 | 3300050514 | Bacteria | 7048 |
| 190 | nmdc:mga0sz30_29050_c1 | 3300050516 | Bacteria | 2277 |
| 191 | Ga0495601_0036688 | 3300053077 | Bacteria | 3063 |
| 192 | Ga0495612_0004906 | 3300053078 | Bacteria | 5534 |
| 193 | Ga0495595_0001153 | 3300053084 | Bacteria | 10235 |
| 194 | Ga0495595_0008234 | 3300053084 | Bacteria | 4281 |
| 195 | Ga0495619_0002071 | 3300053085 | Bacteria | 13328 |
| 196 | Ga0500616_0000115 | 3300053153 | Bacteria | 147212 |
| 197 | Ga0590075_012084 | 3300059424 | Bacteria | 2094 |
| 198 | 2515852363 | 2515154155 | Bacteria | 7985436 |
| 199 | 2588109283 | 2585428157 | Bacteria | 3018951 |
| 200 | 2643754430 | 2643221546 | Bacteria | 2910897 |
| 201 | 2643849022 | 2643221566 | Bacteria | 3460379 |
| 202 | 2643886308 | 2643221575 | Bacteria | 4022601 |
| 203 | 2643995198 | 2643221597 | Bacteria | 3347721 |
| 204 | 2676477530 | 2675903058 | Bacteria | 6822861 |
| 205 | 2676489891 | 2675903060 | Bacteria | 10051191 |
| 206 | 2774383327 | 2773857759 | Bacteria | 2963774 |
| 207 | 2774398677 | 2773857763 | Bacteria | 4180068 |
| 208 | 2795780339 | 2795385470 | Bacteria | 8317180 |
| 209 | 2827634788 | 2827628540 | Bacteria | 6858585 |
| 210 | 2833711757 | 2833709550 | Bacteria | 4008291 |
| 211 | 2856741537 | 2856741275 | Bacteria | 8096094 |
| 212 | 2873314476 | 2873314349 | Bacteria | 8512634 |
| 213 | 2884694704 | 2884693830 | Bacteria | 11273186 |
| 214 | 2891401199 | 2891395885 | Bacteria | 9251614 |
| 215 | 2891560103 | 2891554331 | Bacteria | 8812224 |
| 216 | 2891563535 | 2891562705 | Bacteria | 8039471 |
| 217 | 2895433210 | 2895427314 | Bacteria | 13147766 |
| 218 | 2895447149 | 2895442618 | Bacteria | 11027144 |
| 219 | 2906801021 | 2906799679 | Bacteria | 4031749 |
| 220 | 3003004910 | 3002998708 | Bacteria | 11715108 |
| 221 | 8004214775 | 8004212874 | Bacteria | 2861420 |
| 222 | 8046353634 | 8046352972 | Bacteria | 3613806 |
| 223 | 8053952130 | 8053945823 | Bacteria | 8962862 |
| 224 | 8055071144 | 8055066027 | Bacteria | 9479577 |
| 225 | 8055175948 | 8055172936 | Bacteria | 9305943 |
| 226 | Ga0070709_10000441 | |||
| 227 | Ga0065714_10078504 | |||
| 228 | Ga0070658_10001187 | |||
| 229 | Ga0070666_10003085 | |||
| 230 | Ga0070671_100016034 | |||
| 231 | Ga0070714_100000010 | |||
| 232 | Ga0070714_100047268 | |||
| 233 | Ga0070714_100084169 | |||
| 234 | Ga0070713_100004460 | |||
| 235 | Ga0070710_10000167 | |||
| 236 | Ga0070711_100001149 | |||
| 237 | Ga0070700_100000052 | |||
| 238 | Ga0070708_100180169 | |||
| 239 | Ga0070706_100040226 | |||
| 240 | Ga0070706_100082161 | |||
| 241 | Ga0070706_100106782 | |||
| 242 | Ga0070707_100000293 | |||
| 243 | Ga0070707_100010098 | |||
| 244 | Ga0070707_100012405 | |||
| 245 | Ga0070707_100038648 | |||
| 246 | Ga0070707_100049124 | |||
| 247 | Ga0070707_100053530 | |||
| 248 | Ga0070698_100000106 | |||
| 249 | Ga0070698_100014887 | |||
| 250 | Ga0070698_100030097 | |||
| 251 | Ga0070699_100040178 | |||
| 252 | Ga0070697_100012528 | |||
| 253 | Ga0068853_100147763 | |||
| 254 | Ga0070665_100001947 | |||
| 255 | Ga0068856_100116853 | |||
| 256 | Ga0068863_100000795 | |||
| 257 | Ga0068860_100000297 | |||
| 258 | Ga0070717_10105039 | |||
| 259 | Ga0075365_10046395 | |||
| 260 | Ga0075368_10011842 | |||
| 261 | Ga0075364_10012731 | |||
| 262 | Ga0070716_100006626 | |||
| 263 | Ga0070712_100001455 | |||
| 264 | Ga0075369_10024059 | |||
| 265 | Ga0068871_100072040 | |||
| 266 | Ga0075434_100018961 | |||
| 267 | Ga0075435_100002002 | |||
| 268 | Ga0105240_10098379 | |||
| 269 | Ga0105245_10052937 | |||
| 270 | Ga0105237_10142269 | |||
| 271 | Ga0157370_10022208 | |||
| 272 | Ga0157370_10228408 | |||
| 273 | Ga0157372_10000024 | |||
| 274 | Ga0163163_10161653 | |||
| 275 | Ga0157379_10140690 | |||
| 276 | Ga0213875_10018068 | |||
| 277 | Ga0207692_10001932 | |||
| 278 | Ga0207699_10001646 | |||
| 279 | Ga0207684_10023560 | |||
| 280 | Ga0207684_10063220 | |||
| 281 | Ga0207663_10001400 | |||
| 282 | Ga0207646_10000050 | |||
| 283 | Ga0207646_10005142 | |||
| 284 | Ga0207646_10010918 | |||
| 285 | Ga0207646_10019247 | |||
| 286 | Ga0207646_10037061 | |||
| 287 | Ga0207694_10203092 | |||
| 288 | Ga0207687_10036241 | |||
| 289 | Ga0207700_10008415 | |||
| 290 | Ga0207700_10041611 | |||
| 291 | Ga0207664_10000009 | |||
| 292 | Ga0207664_10000835 | |||
| 293 | Ga0207664_10005102 | |||
| 294 | Ga0207665_10005907 | |||
| 295 | Ga0207668_10013648 | |||
| 296 | Ga0207658_10007005 | |||
| 297 | Ga0207708_10000011 | |||
| 298 | Ga0207702_10008591 | |||
| 299 | Ga0207641_10002579 | |||
| 300 | Ga0207674_10084052 | |||
| 301 | Ga0268266_10004293 | |||
| 302 | Ga0268264_10000353 | |||
| 303 | Ga0373934_0000058 | |||
| 304 | Ga0373934_0018903 | |||
| 305 | Ga0373923_0005730 | |||
| 306 | Ga0373953_0001411 | |||
| 307 | Ga0373954_0012070 | |||
| 308 | Ga0373954_0045485 | |||
| 309 | Ga0373954_0053669 | |||
| 310 | Ga0373956_0002184 | |||
| 311 | Ga0373956_0031978 | |||
| 312 | Ga0373955_0000156 | |||
| 313 | Ga0373924_0003253 | |||
| 314 | Ga0373924_0007789 | |||
| 315 | Ga0373924_0023472 | |||
| 316 | Ga0373935_0000691 | |||
| 317 | Ga0373935_0022321 | |||
| 318 | Ga0373933_0000009 | |||
| 319 | Ga0373947_0000075 | |||
| 320 | Ga0373947_0024527 | |||
| 321 | Ga0373937_0000110 | |||
| 322 | Ga0373937_0011293 | |||
| 323 | Ga0373925_0002022 | |||
| 324 | Ga0436364_0096312 | |||
| 325 | Ga0436364_0331985 | |||
| 326 | Ga0436364_1305561 | |||
| 327 | Ga0451837_0422477 | |||
| 328 | Ga0466966_0010782 | |||
| 329 | Ga0466961_0066842 | |||
| 330 | Ga0466959_0020784 | |||
| 331 | Ga0495592_0000049 | |||
| 332 | Ga0495592_0055076 | |||
| 333 | Ga0495629_0013908 | |||
| 334 | Ga0495651_0000007 | |||
| 335 | Ga0495651_0011876 | |||
| 336 | Ga0495653_0023346 | |||
| 337 | Ga0495582_0004911 | |||
| 338 | Ga0495662_0002836 | |||
| 339 | Ga0495664_0042687 | |||
| 340 | Ga0495664_0052526 | |||
| 341 | Ga0495664_0118241 | |||
| 342 | Ga0495608_0000076 | |||
| 343 | Ga0495608_0061745 | |||
| 344 | Ga0495618_0051873 | |||
| 345 | Ga0495628_0014731 | |||
| 346 | Ga0495630_0119433 | |||
| 347 | Ga0495630_0120094 | |||
| 348 | Ga0495652_0000168 | |||
| 349 | Ga0495640_0012041 | |||
| 350 | Ga0495640_0106052 | |||
| 351 | Ga0495586_0003099 | |||
| 352 | Ga0495586_0037808 | |||
| 353 | Ga0495586_0075671 | |||
| 354 | Ga0495587_0000032 | |||
| 355 | Ga0495587_0031490 | |||
| 356 | Ga0495587_0061781 | |||
| 357 | Ga0495645_0013759 | |||
| 358 | Ga0495645_0027673 | |||
| 359 | Ga0495645_0036287 | |||
| 360 | Ga0495645_0044673 | |||
| 361 | Ga0495667_0000072 | |||
| 362 | Ga0495667_0024665 | |||
| 363 | Ga0495667_0044578 | |||
| 364 | Ga0495634_0018427 | |||
| 365 | Ga0495635_0073817 | |||
| 366 | Ga0495657_0000106 | |||
| 367 | Ga0495599_0000062 | |||
| 368 | Ga0495599_0030553 | |||
| 369 | Ga0495623_0005307 | |||
| 370 | Ga0495623_0035025 | |||
| 371 | Ga0495646_0003238 | |||
| 372 | Ga0495646_0083861 | |||
| 373 | Ga0495613_0031339 | |||
| 374 | Ga0495624_0014674 | |||
| 375 | Ga0495600_0017423 | |||
| 376 | Ga0495581_0014410 | |||
| 377 | Ga0495604_0000062 | |||
| 378 | Ga0495680_0000101 | |||
| 379 | Ga0495680_0038666 | |||
| 380 | Ga0495680_0077183 | |||
| 381 | Ga0495675_0000116 | |||
| 382 | Ga0495684_0127423 | |||
| 383 | Ga0495593_0017476 | |||
| 384 | Ga0495602_0000115 | |||
| 385 | Ga0495602_0056525 | |||
| 386 | Ga0495602_0129898 | |||
| 387 | Ga0496104_0044667 | |||
| 388 | Ga0496104_0144820 | |||
| 389 | Ga0496105_0009832 | |||
| 390 | Ga0496105_0272147 | |||
| 391 | Ga0496109_0029654 | |||
| 392 | Ga0496113_0003952 | |||
| 393 | Ga0496114_0040269 | |||
| 394 | Ga0496115_0120968 | |||
| 395 | Ga0496117_0001882 | |||
| 396 | Ga0496118_0011658 | |||
| 397 | Ga0496118_0107183 | |||
| 398 | Ga0496119_0002996 | |||
| 399 | Ga0496122_0000420 | |||
| 400 | Ga0496122_0001338 | |||
| 401 | Ga0496123_0000354 | |||
| 402 | Ga0496123_0013226 | |||
| 403 | Ga0496123_0027178 | |||
| 404 | Ga0496124_0002851 | |||
| 405 | Ga0496125_0022745 | |||
| 406 | Ga0501042_0005703 | |||
| 407 | Ga0501047_0067685 | |||
| 408 | nmdc:mga00v17_12530_c1 | |||
| 409 | nmdc:mga00v17_67927_c1 | |||
| 410 | nmdc:mga0yw44_69036_c1 | |||
| 411 | nmdc:mga0n895_14546_c1 | |||
| 412 | nmdc:mga0rr50_2048_c1 | |||
| 413 | nmdc:mga0rr50_257238_c1 | |||
| 414 | nmdc:mga08x19_6258_c1 | |||
| 415 | nmdc:mga0sz30_29050_c1 | |||
| 416 | Ga0495601_0036688 | |||
| 417 | Ga0495612_0004906 | |||
| 418 | Ga0495595_0001153 | |||
| 419 | Ga0495595_0008234 | |||
| 420 | Ga0495619_0002071 | |||
| 421 | Ga0500616_0000115 | |||
| 422 | Ga0590075_012084 | |||
| 423 | 2515852363 | |||
| 424 | 2588109283 | |||
| 425 | 2643754430 | |||
| 426 | 2643849022 | |||
| 427 | 2643886308 | |||
| 428 | 2643995198 | |||
| 429 | 2676477530 | |||
| 430 | 2676489891 | |||
| 431 | 2774383327 | |||
| 432 | 2774398677 | |||
| 433 | 2795780339 | |||
| 434 | 2827634788 | |||
| 435 | 2833711757 | |||
| 436 | 2856741537 | |||
| 437 | 2873314476 | |||
| 438 | 2884694704 | |||
| 439 | 2891401199 | |||
| 440 | 2891560103 | |||
| 441 | 2891563535 | |||
| 442 | 2895433210 | |||
| 443 | 2895447149 | |||
| 444 | 2906801021 | |||
| 445 | 3003004910 | |||
| 446 | 8004214775 | |||
| 447 | 8046353634 | |||
| 448 | 8053952130 | |||
| 449 | 8055071144 | |||
| 450 | 8055175948 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqo-assembly1.cif.gz_A | structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. | 0.9314 | 4 | 412 |
| 1li5-assembly2.cif.gz_B | crystal structure of cysteinyl-trna synthetase | 0.9271 | 8 | 412 |
| 1li7-assembly1.cif.gz_A | crystal structure of cysteinyl-trna synthetase with cysteine substrate bound | 0.9264 | 8 | 412 |
| 1li7-assembly2.cif.gz_B | crystal structure of cysteinyl-trna synthetase with cysteine substrate bound | 0.9227 | 8 | 412 |
| 3tqo-assembly1.cif.gz_A | structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. | 0.922 | 4 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1li7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9557 | 23 | 310 | 3.40.50.620 |
| 1li7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9523 | 23 | 310 | 3.40.50.620 |
| af_P9WFW1_1_304_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9466 | 1 | 307 | 3.40.50.620 |
| af_Q2G2M6_1_304_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9448 | 8 | 310 | 3.40.50.620 |
| af_P9WFW1_1_304_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9406 | 1 | 307 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382D4Z0-F1-model_v4 | tRNA synthetases class I catalytic domain-containing protein | 0.9752 | 6 | 165 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-J1F6D8-F1-model_v4 | Cysteinyl-tRNA synthetase | 0.9745 | 9 | 135 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A3N5PRA2-F1-model_v4 | Cysteine--tRNA ligase (EC 6.1.1.16) | 0.9744 | 9 | 164 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A2E6GAX5-F1-model_v4 | Cysteine--tRNA ligase | 0.974 | 6 | 148 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-Q6ADI1-F1-model_v4 | Cysteine--tRNA ligase (EC 6.1.1.16) (Cysteinyl-tRNA synthetase) (CysRS) | 0.9721 | 6 | 471 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 GO:0008270 |