F337488

General Info

Members Datasets Scaffolds Average Seq Length
225 59 450 151

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10075789|Ga0070703_100757892
Length 161
Sequence MARTTSDDVKSMDSIEGVVMKELVTHSDERGFFREIIRETDDFFDHFGQWSHSLMYPGTAKAWHIHQRQTDWWYVMGALKVALYDARDGSPTKGRLMEFLMGDRHASCVKIPPGVAHGCRALELSHILYITSSVYAPDDEGRIPHDDPSIGYDWTAGPEIK

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
53 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
54 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
55 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
56 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
57 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
58 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
59 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 99.56
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10075789 3300005406 Bacteria 1134
2 JGI25404J52841_10000643 3300003659 Bacteria 5304
3 Ga0070703_10006639 3300005406 Bacteria 3239
4 Ga0070709_10074948 3300005434 Bacteria 2194
5 Ga0070709_11547625 3300005434 Unclassified 539
6 Ga0070714_100000370 3300005435 Bacteria 33601
7 Ga0070714_100028529 3300005435 Bacteria 4632
8 Ga0070714_100111208 3300005435 Bacteria 2426
9 Ga0070714_100170114 3300005435 Bacteria 1977
10 Ga0070714_100197287 3300005435 Bacteria 1840
11 Ga0070714_100329292 3300005435 Bacteria 1430
12 Ga0070714_101887149 3300005435 Unclassified 583
13 Ga0070705_100005054 3300005440 Bacteria 6420
14 Ga0070705_100024853 3300005440 Unclassified 3239
15 Ga0070705_100545970 3300005440 Bacteria 888
16 Ga0070694_100346341 3300005444 Bacteria 1150
17 Ga0070694_101033893 3300005444 Bacteria 683
18 Ga0070708_100000423 3300005445 Bacteria 31579
19 Ga0070708_100003003 3300005445 Bacteria 13103
20 Ga0070708_100003847 3300005445 Bacteria 11782
21 Ga0070708_100022454 3300005445 Bacteria 5353
22 Ga0070708_100035739 3300005445 Bacteria 4330
23 Ga0070708_100067229 3300005445 Bacteria 3218
24 Ga0070708_100118835 3300005445 Bacteria 2436
25 Ga0070708_100191739 3300005445 Bacteria 1911
26 Ga0070708_100218661 3300005445 Bacteria 1786
27 Ga0070708_100330411 3300005445 Bacteria 1436
28 Ga0070708_100971819 3300005445 Bacteria 796
29 Ga0070708_101803257 3300005445 Unclassified 568
30 Ga0070706_100000059 3300005467 Bacteria 131531
31 Ga0070706_100000192 3300005467 Bacteria 76632
32 Ga0070706_100000197 3300005467 Bacteria 75627
33 Ga0070706_100001501 3300005467 Bacteria 24501
34 Ga0070706_100002009 3300005467 Bacteria 20909
35 Ga0070706_100016183 3300005467 Bacteria 6888
36 Ga0070706_100029815 3300005467 Bacteria 5026
37 Ga0070706_100236555 3300005467 Bacteria 1705
38 Ga0070706_100569618 3300005467 Bacteria 1053
39 Ga0070706_100629304 3300005467 Bacteria 996
40 Ga0070706_100779204 3300005467 Bacteria 886
41 Ga0070706_100862501 3300005467 Bacteria 837
42 Ga0070706_101504087 3300005467 Bacteria 615
43 Ga0070707_100000024 3300005468 Bacteria 128517
44 Ga0070707_100003592 3300005468 Bacteria 14629
45 Ga0070707_100004631 3300005468 Bacteria 12875
46 Ga0070707_100006053 3300005468 Bacteria 11294
47 Ga0070707_100007778 3300005468 Bacteria 9955
48 Ga0070707_100016706 3300005468 Bacteria 6890
49 Ga0070707_100025063 3300005468 Bacteria 5657
50 Ga0070707_100027301 3300005468 Bacteria 5431
51 Ga0070707_100031657 3300005468 Bacteria 5040
52 Ga0070707_100073419 3300005468 Bacteria 3298
53 Ga0070707_100183291 3300005468 Bacteria 2041
54 Ga0070707_100303894 3300005468 Bacteria 1550
55 Ga0070707_100373534 3300005468 Bacteria 1385
56 Ga0070707_100373701 3300005468 Bacteria 1385
57 Ga0070707_100767749 3300005468 Bacteria 927
58 Ga0070707_100857424 3300005468 Bacteria 872
59 Ga0070698_100006767 3300005471 Bacteria 12428
60 Ga0070698_100023124 3300005471 Bacteria 6499
61 Ga0070698_100031978 3300005471 Bacteria 5452
62 Ga0070698_100046286 3300005471 Bacteria 4448
63 Ga0070698_100072373 3300005471 Bacteria 3455
64 Ga0070698_100089473 3300005471 Bacteria 3062
65 Ga0070698_100151554 3300005471 Unclassified 2266
66 Ga0070698_100184422 3300005471 Unclassified 2025
67 Ga0070698_100313046 3300005471 Bacteria 1501
68 Ga0070698_100395347 3300005471 Bacteria 1315
69 Ga0070698_100475884 3300005471 Bacteria 1186
70 Ga0070698_100615774 3300005471 Bacteria 1026
71 Ga0070698_100627717 3300005471 Bacteria 1015
72 Ga0070699_100000046 3300005518 Bacteria 124488
73 Ga0070699_100000126 3300005518 Bacteria 70354
74 Ga0070699_100000366 3300005518 Bacteria 44267
75 Ga0070699_100002360 3300005518 Bacteria 16934
76 Ga0070699_100026266 3300005518 Bacteria 5022
77 Ga0070699_100049131 3300005518 Bacteria 3652
78 Ga0070699_100230912 3300005518 Bacteria 1650
79 Ga0070699_100386894 3300005518 Bacteria 1263
80 Ga0070699_100811129 3300005518 Bacteria 856
81 Ga0070679_100165480 3300005530 Bacteria 2185
82 Ga0070697_100000213 3300005536 Bacteria 47455
83 Ga0070697_100010090 3300005536 Bacteria 7367
84 Ga0070697_100014873 3300005536 Bacteria 6107
85 Ga0070697_100015549 3300005536 Bacteria 5975
86 Ga0070697_100019185 3300005536 Bacteria 5399
87 Ga0070697_100026586 3300005536 Bacteria 4625
88 Ga0070697_100037814 3300005536 Bacteria 3898
89 Ga0070697_100066643 3300005536 Bacteria 2944
90 Ga0070697_100096516 3300005536 Bacteria 2452
91 Ga0070697_100100337 3300005536 Bacteria 2404
92 Ga0070697_100160023 3300005536 Bacteria 1902
93 Ga0070697_100185177 3300005536 Bacteria 1766
94 Ga0070697_100236782 3300005536 Bacteria 1558
95 Ga0070697_100898245 3300005536 Bacteria 786
96 Ga0070695_100110721 3300005545 Bacteria 1863
97 Ga0070695_100198402 3300005545 Bacteria 1432
98 Ga0070695_100254933 3300005545 Bacteria 1279
99 Ga0070695_101741434 3300005545 Unclassified 522
100 Ga0070696_100057978 3300005546 Bacteria 2704
101 Ga0070696_100230132 3300005546 Bacteria 1394
102 Ga0070696_100399819 3300005546 Bacteria 1074
103 Ga0070693_100048419 3300005547 Bacteria 2421
104 Ga0070704_100007932 3300005549 Bacteria 6337
105 Ga0070704_100174042 3300005549 Bacteria 1715
106 Ga0070704_100812268 3300005549 Bacteria 836
107 Ga0081540_1000343 3300005983 Bacteria 47660
108 Ga0070717_10000065 3300006028 Bacteria 88895
109 Ga0070717_10000120 3300006028 Bacteria 61157
110 Ga0075432_10064333 3300006058 Bacteria 1310
111 Ga0070716_100173290 3300006173 Bacteria 1410
112 Ga0070716_100192030 3300006173 Bacteria 1350
113 Ga0070716_101493149 3300006173 Unclassified 552
114 Ga0075433_10007418 3300006852 Bacteria 8707
115 Ga0075433_10130130 3300006852 Bacteria 2236
116 Ga0075433_10237459 3300006852 Bacteria 1618
117 Ga0075433_10768445 3300006852 Bacteria 842
118 Ga0075434_100040390 3300006871 Bacteria 4619
119 Ga0075434_100127926 3300006871 Bacteria 2557
120 Ga0075434_100683456 3300006871 Bacteria 1044
121 Ga0075436_100005909 3300006914 Bacteria 8409
122 Ga0075436_100021143 3300006914 Bacteria 4464
123 Ga0075436_100045501 3300006914 Bacteria 3027
124 Ga0075436_100058577 3300006914 Bacteria 2660
125 Ga0075436_100137453 3300006914 Bacteria 1716
126 Ga0075436_100509943 3300006914 Bacteria 880
127 Ga0075436_100694477 3300006914 Bacteria 753
128 Ga0075436_101252425 3300006914 Bacteria 560
129 Ga0075435_100015247 3300007076 Bacteria 5773
130 Ga0075435_100052048 3300007076 Bacteria 3299
131 Ga0099794_10000174 3300007265 Bacteria 23500
132 Ga0099794_10036902 3300007265 Bacteria 2312
133 Ga0099794_10143549 3300007265 Bacteria 1210
134 Ga0099794_10424615 3300007265 Bacteria 696
135 Ga0114129_11186016 3300009147 Bacteria 952
136 Ga0105249_12017844 3300009553 Unclassified 649
137 Ga0157370_11424495 3300013104 Bacteria 623
138 Ga0157378_10591923 3300013297 Unclassified 1119
139 Ga0207653_10002874 3300025885 Bacteria 5466
140 Ga0207653_10005178 3300025885 Bacteria 4077
141 Ga0207699_10069883 3300025906 Bacteria 2143
142 Ga0207684_10000005 3300025910 Bacteria 736617
143 Ga0207684_10000021 3300025910 Bacteria 340887
144 Ga0207684_10000035 3300025910 Bacteria 289353
145 Ga0207684_10000084 3300025910 Bacteria 176027
146 Ga0207684_10000111 3300025910 Bacteria 153495
147 Ga0207684_10017816 3300025910 Bacteria 6091
148 Ga0207684_10020072 3300025910 Bacteria 5709
149 Ga0207684_10025249 3300025910 Bacteria 5064
150 Ga0207684_10095795 3300025910 Bacteria 2533
151 Ga0207684_10114683 3300025910 Bacteria 2307
152 Ga0207684_10122404 3300025910 Bacteria 2231
153 Ga0207684_10130155 3300025910 Bacteria 2160
154 Ga0207684_10234606 3300025910 Bacteria 1583
155 Ga0207684_10559129 3300025910 Bacteria 978
156 Ga0207693_10404959 3300025915 Bacteria 1066
157 Ga0207652_10982194 3300025921 Bacteria 743
158 Ga0207646_10000031 3300025922 Bacteria 219144
159 Ga0207646_10000182 3300025922 Bacteria 85800
160 Ga0207646_10000449 3300025922 Bacteria 54972
161 Ga0207646_10000655 3300025922 Bacteria 44749
162 Ga0207646_10002095 3300025922 Bacteria 23926
163 Ga0207646_10002114 3300025922 Bacteria 23793
164 Ga0207646_10002964 3300025922 Bacteria 19649
165 Ga0207646_10003454 3300025922 Bacteria 17843
166 Ga0207646_10004556 3300025922 Bacteria 14992
167 Ga0207646_10008983 3300025922 Bacteria 9942
168 Ga0207646_10009231 3300025922 Bacteria 9771
169 Ga0207646_10019544 3300025922 Bacteria 6293
170 Ga0207646_10039526 3300025922 Bacteria 4246
171 Ga0207646_10059721 3300025922 Bacteria 3405
172 Ga0207646_10144769 3300025922 Bacteria 2141
173 Ga0207646_10263566 3300025922 Bacteria 1557
174 Ga0207646_10360078 3300025922 Bacteria 1314
175 Ga0207646_10503450 3300025922 Bacteria 1091
176 Ga0207664_10000351 3300025929 Bacteria 33627
177 Ga0207664_10067659 3300025929 Bacteria 2867
178 Ga0207664_10161108 3300025929 Bacteria 1913
179 Ga0207664_10363484 3300025929 Bacteria 1282
180 Ga0207664_10380053 3300025929 Bacteria 1254
181 Ga0207664_10689238 3300025929 Bacteria 919
182 Ga0207664_11146333 3300025929 Bacteria 694
183 Ga0207664_11313861 3300025929 Unclassified 643
184 Ga0207665_10068642 3300025939 Bacteria 2416
185 Ga0207665_10086845 3300025939 Bacteria 2161
186 Ga0207665_10483704 3300025939 Bacteria 954
187 Ga0207665_10555690 3300025939 Bacteria 892
188 Ga0207648_10242107 3300026089 Bacteria 1606
189 Ga0207675_100204272 3300026118 Bacteria 1898
190 Ga0209588_1000640 3300027671 Bacteria 8831
191 Ga0209588_1076193 3300027671 Bacteria 1084
192 Ga0207428_10353555 3300027907 Bacteria 1081
193 Ga0265332_10006772 3300031238 Bacteria 5192
194 Ga0316579_10299439 3300031691 Bacteria 777
195 Ga0316579_10369427 3300031691 Unclassified 693
196 Ga0316577_10021752 3300031733 Unclassified 3559
197 Ga0316582_0330911 3300036647 Bacteria 1048
198 Ga0316582_0566420 3300036647 Unclassified 782
199 Ga0316584_0044074 3300036712 Bacteria 3327
200 Ga0316584_0138273 3300036712 Bacteria 1818
201 Ga0316581_0013849 3300037588 Unclassified 2291
202 Ga0316581_0192279 3300037588 Unclassified 628
203 Ga0451577_0134532 3300042876 Bacteria 2219
204 Ga0453683_0269578 3300044673 Bacteria 1086
205 Ga0451576_0906140 3300045051 Bacteria 925
206 Ga0501069_0139760 3300049585 Bacteria 1389
207 nmdc:mga0k408_30115_c1 3300050493 Bacteria 3092
208 nmdc:mga0n895_113880_c1 3300050512 Bacteria 2723
209 nmdc:mga0n895_39181_c1 3300050512 Bacteria 4596
210 nmdc:mga0rr50_16381_c1 3300050513 Bacteria 4923
211 nmdc:mga0rr50_33033_c1 3300050513 Bacteria 3694
212 nmdc:mga0rr50_805251_c1 3300050513 Bacteria 802
213 nmdc:mga08x19_1742_c1 3300050514 Bacteria 13404
214 nmdc:mga08x19_177856_c1 3300050514 Bacteria 1452
215 nmdc:mga08x19_23072_c1 3300050514 Bacteria 3859
216 nmdc:mga08x19_36616_c1 3300050514 Bacteria 3109
217 nmdc:mga08x19_413578_c1 3300050514 Bacteria 947
218 nmdc:mga08x19_64402_c1 3300050514 Bacteria 2380
219 nmdc:mga08x19_719658_c1 3300050514 Bacteria 709
220 nmdc:mga0a205_1170201_c1 3300050515 Bacteria 617
221 nmdc:mga0a205_126973_c1 3300050515 Bacteria 2450
222 nmdc:mga0a205_261238_c1 3300050515 Bacteria 1609
223 nmdc:mga0a205_49155_c1 3300050515 Bacteria 4070
224 Ga0501084_1103212 3300054114 Bacteria 666
225 Ga0501082_0774666 3300060353 Bacteria 839
226 Ga0070703_10075789
227 JGI25404J52841_10000643
228 Ga0070703_10006639
229 Ga0070709_10074948
230 Ga0070709_11547625
231 Ga0070714_100000370
232 Ga0070714_100028529
233 Ga0070714_100111208
234 Ga0070714_100170114
235 Ga0070714_100197287
236 Ga0070714_100329292
237 Ga0070714_101887149
238 Ga0070705_100005054
239 Ga0070705_100024853
240 Ga0070705_100545970
241 Ga0070694_100346341
242 Ga0070694_101033893
243 Ga0070708_100000423
244 Ga0070708_100003003
245 Ga0070708_100003847
246 Ga0070708_100022454
247 Ga0070708_100035739
248 Ga0070708_100067229
249 Ga0070708_100118835
250 Ga0070708_100191739
251 Ga0070708_100218661
252 Ga0070708_100330411
253 Ga0070708_100971819
254 Ga0070708_101803257
255 Ga0070706_100000059
256 Ga0070706_100000192
257 Ga0070706_100000197
258 Ga0070706_100001501
259 Ga0070706_100002009
260 Ga0070706_100016183
261 Ga0070706_100029815
262 Ga0070706_100236555
263 Ga0070706_100569618
264 Ga0070706_100629304
265 Ga0070706_100779204
266 Ga0070706_100862501
267 Ga0070706_101504087
268 Ga0070707_100000024
269 Ga0070707_100003592
270 Ga0070707_100004631
271 Ga0070707_100006053
272 Ga0070707_100007778
273 Ga0070707_100016706
274 Ga0070707_100025063
275 Ga0070707_100027301
276 Ga0070707_100031657
277 Ga0070707_100073419
278 Ga0070707_100183291
279 Ga0070707_100303894
280 Ga0070707_100373534
281 Ga0070707_100373701
282 Ga0070707_100767749
283 Ga0070707_100857424
284 Ga0070698_100006767
285 Ga0070698_100023124
286 Ga0070698_100031978
287 Ga0070698_100046286
288 Ga0070698_100072373
289 Ga0070698_100089473
290 Ga0070698_100151554
291 Ga0070698_100184422
292 Ga0070698_100313046
293 Ga0070698_100395347
294 Ga0070698_100475884
295 Ga0070698_100615774
296 Ga0070698_100627717
297 Ga0070699_100000046
298 Ga0070699_100000126
299 Ga0070699_100000366
300 Ga0070699_100002360
301 Ga0070699_100026266
302 Ga0070699_100049131
303 Ga0070699_100230912
304 Ga0070699_100386894
305 Ga0070699_100811129
306 Ga0070679_100165480
307 Ga0070697_100000213
308 Ga0070697_100010090
309 Ga0070697_100014873
310 Ga0070697_100015549
311 Ga0070697_100019185
312 Ga0070697_100026586
313 Ga0070697_100037814
314 Ga0070697_100066643
315 Ga0070697_100096516
316 Ga0070697_100100337
317 Ga0070697_100160023
318 Ga0070697_100185177
319 Ga0070697_100236782
320 Ga0070697_100898245
321 Ga0070695_100110721
322 Ga0070695_100198402
323 Ga0070695_100254933
324 Ga0070695_101741434
325 Ga0070696_100057978
326 Ga0070696_100230132
327 Ga0070696_100399819
328 Ga0070693_100048419
329 Ga0070704_100007932
330 Ga0070704_100174042
331 Ga0070704_100812268
332 Ga0081540_1000343
333 Ga0070717_10000065
334 Ga0070717_10000120
335 Ga0075432_10064333
336 Ga0070716_100173290
337 Ga0070716_100192030
338 Ga0070716_101493149
339 Ga0075433_10007418
340 Ga0075433_10130130
341 Ga0075433_10237459
342 Ga0075433_10768445
343 Ga0075434_100040390
344 Ga0075434_100127926
345 Ga0075434_100683456
346 Ga0075436_100005909
347 Ga0075436_100021143
348 Ga0075436_100045501
349 Ga0075436_100058577
350 Ga0075436_100137453
351 Ga0075436_100509943
352 Ga0075436_100694477
353 Ga0075436_101252425
354 Ga0075435_100015247
355 Ga0075435_100052048
356 Ga0099794_10000174
357 Ga0099794_10036902
358 Ga0099794_10143549
359 Ga0099794_10424615
360 Ga0114129_11186016
361 Ga0105249_12017844
362 Ga0157370_11424495
363 Ga0157378_10591923
364 Ga0207653_10002874
365 Ga0207653_10005178
366 Ga0207699_10069883
367 Ga0207684_10000005
368 Ga0207684_10000021
369 Ga0207684_10000035
370 Ga0207684_10000084
371 Ga0207684_10000111
372 Ga0207684_10017816
373 Ga0207684_10020072
374 Ga0207684_10025249
375 Ga0207684_10095795
376 Ga0207684_10114683
377 Ga0207684_10122404
378 Ga0207684_10130155
379 Ga0207684_10234606
380 Ga0207684_10559129
381 Ga0207693_10404959
382 Ga0207652_10982194
383 Ga0207646_10000031
384 Ga0207646_10000182
385 Ga0207646_10000449
386 Ga0207646_10000655
387 Ga0207646_10002095
388 Ga0207646_10002114
389 Ga0207646_10002964
390 Ga0207646_10003454
391 Ga0207646_10004556
392 Ga0207646_10008983
393 Ga0207646_10009231
394 Ga0207646_10019544
395 Ga0207646_10039526
396 Ga0207646_10059721
397 Ga0207646_10144769
398 Ga0207646_10263566
399 Ga0207646_10360078
400 Ga0207646_10503450
401 Ga0207664_10000351
402 Ga0207664_10067659
403 Ga0207664_10161108
404 Ga0207664_10363484
405 Ga0207664_10380053
406 Ga0207664_10689238
407 Ga0207664_11146333
408 Ga0207664_11313861
409 Ga0207665_10068642
410 Ga0207665_10086845
411 Ga0207665_10483704
412 Ga0207665_10555690
413 Ga0207648_10242107
414 Ga0207675_100204272
415 Ga0209588_1000640
416 Ga0209588_1076193
417 Ga0207428_10353555
418 Ga0265332_10006772
419 Ga0316579_10299439
420 Ga0316579_10369427
421 Ga0316577_10021752
422 Ga0316582_0330911
423 Ga0316582_0566420
424 Ga0316584_0044074
425 Ga0316584_0138273
426 Ga0316581_0013849
427 Ga0316581_0192279
428 Ga0451577_0134532
429 Ga0453683_0269578
430 Ga0451576_0906140
431 Ga0501069_0139760
432 nmdc:mga0k408_30115_c1
433 nmdc:mga0n895_113880_c1
434 nmdc:mga0n895_39181_c1
435 nmdc:mga0rr50_16381_c1
436 nmdc:mga0rr50_33033_c1
437 nmdc:mga0rr50_805251_c1
438 nmdc:mga08x19_1742_c1
439 nmdc:mga08x19_177856_c1
440 nmdc:mga08x19_23072_c1
441 nmdc:mga08x19_36616_c1
442 nmdc:mga08x19_413578_c1
443 nmdc:mga08x19_64402_c1
444 nmdc:mga08x19_719658_c1
445 nmdc:mga0a205_1170201_c1
446 nmdc:mga0a205_126973_c1
447 nmdc:mga0a205_261238_c1
448 nmdc:mga0a205_49155_c1
449 Ga0501084_1103212
450 Ga0501082_0774666

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

12

161

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.9273 2 149
4hn0-assembly1.cif.gz_B crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis 0.895 2 145
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.8927 2 149
7pwh-assembly1.cif.gz_AAA structure of the dtdp-sugar epimerase strm 0.8907 2 145
4mzu-assembly2.cif.gz_J crystal structure of fdtd, a bifunctional ketoisomerase/n-acetyltransferase from shewanella denitrificans 0.8848 2 133
ID Description Score Start End Superfamily
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9112 2 149 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8866 4 145 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8836 2 149 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8803 2 145 2.60.120.10
4mzuI02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8718 2 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3E0N757-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.979 1 147 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3E0N757-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9725 1 147 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6I2SS48-F1-model_v4 Uncharacterized protein 0.969 1 153 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2E1KSV8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9583 1 137 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6I2SS48-F1-model_v4 Uncharacterized protein 0.9565 1 153 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map