F337457

General Info

Members Datasets Scaffolds Average Seq Length
225 144 450 143

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100177638|Ga0070660_1001776382
Length 152
Sequence VKPEAIRRSLDRSGLRCTPQRYAVMAFLLEHHGHPTAAEIYDAVNRADPRSSRATTYNNLRDLVEGGLVREVAVEGRAARFDAKLMRHHHFICDRCGDVEDIEWYDVPKPAPRSLGPRVLRECELIFRGLCSACARRRSVPKPHPKEKKRVD

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 20.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100177638 3300005339 Bacteria 1722
2 Ga0068869_100024251 3300005334 Bacteria 4200
3 Ga0070682_100579211 3300005337 Bacteria 883
4 Ga0070709_10190971 3300005434 Unclassified 1444
5 Ga0070714_100279378 3300005435 Bacteria 1551
6 Ga0070714_100664504 3300005435 Bacteria 1004
7 Ga0070713_100048342 3300005436 Bacteria 3502
8 Ga0070713_100559307 3300005436 Bacteria 1084
9 Ga0070711_100638377 3300005439 Bacteria 892
10 Ga0070678_101418409 3300005456 Unclassified 649
11 Ga0070681_10002519 3300005458 Bacteria 16791
12 Ga0070681_10003357 3300005458 Bacteria 14972
13 Ga0070681_10057012 3300005458 Bacteria 3887
14 Ga0070679_100025938 3300005530 Bacteria 5751
15 Ga0070679_100578549 3300005530 Bacteria 1067
16 Ga0070684_100822164 3300005535 Bacteria 869
17 Ga0070693_100044906 3300005547 Bacteria 2502
18 Ga0070693_100689704 3300005547 Unclassified 747
19 Ga0070665_100120808 3300005548 Bacteria 2621
20 Ga0068855_100100340 3300005563 Bacteria 3333
21 Ga0068857_100250124 3300005577 Bacteria 1625
22 Ga0068856_100547528 3300005614 Bacteria 1178
23 Ga0068852_101809995 3300005616 Unclassified 633
24 Ga0068859_101285388 3300005617 Unclassified 806
25 Ga0068863_100251941 3300005841 Bacteria 1706
26 Ga0068858_101639789 3300005842 Unclassified 635
27 Ga0068860_100129069 3300005843 Bacteria 2424
28 Ga0070717_10023527 3300006028 Bacteria 4884
29 Ga0070717_10776851 3300006028 Bacteria 871
30 Ga0068871_100413801 3300006358 Bacteria 1203
31 Ga0097620_101285722 3300006931 Unclassified 806
32 Ga0075435_100922697 3300007076 Bacteria 762
33 Ga0105240_10250998 3300009093 Bacteria 2046
34 Ga0105240_11615287 3300009093 Unclassified 678
35 Ga0105240_11756393 3300009093 Unclassified 647
36 Ga0105245_10363017 3300009098 Bacteria 1438
37 Ga0105245_10436043 3300009098 Bacteria 1316
38 Ga0105245_10471969 3300009098 Bacteria 1266
39 Ga0105245_10710721 3300009098 Bacteria 1039
40 Ga0105247_11093755 3300009101 Unclassified 628
41 Ga0114129_11033268 3300009147 Bacteria 1033
42 Ga0105242_10028710 3300009176 Bacteria 4430
43 Ga0105242_10120553 3300009176 Unclassified 2250
44 Ga0105242_10918741 3300009176 Unclassified 877
45 Ga0105248_10152691 3300009177 Bacteria 2605
46 Ga0105248_10167102 3300009177 Unclassified 2479
47 Ga0105248_10391747 3300009177 Bacteria 1564
48 Ga0105237_10045158 3300009545 Bacteria 4435
49 Ga0105237_12113775 3300009545 Unclassified 572
50 Ga0105238_10232925 3300009551 Bacteria 1818
51 Ga0105238_11019795 3300009551 Bacteria 849
52 Ga0105249_10118654 3300009553 Bacteria 2511
53 Ga0099796_10085409 3300010159 Bacteria 1165
54 Ga0105246_10153851 3300011119 Bacteria 1744
55 Ga0105246_10480438 3300011119 Bacteria 1051
56 Ga0157370_11422440 3300013104 Unclassified 624
57 Ga0157374_10050392 3300013296 Bacteria 3870
58 Ga0157374_10329253 3300013296 Bacteria 1515
59 Ga0157374_10704470 3300013296 Bacteria 1023
60 Ga0157378_11263122 3300013297 Bacteria 779
61 Ga0157372_10614625 3300013307 Bacteria 1267
62 Ga0157375_10589519 3300013308 Unclassified 1271
63 Ga0163163_10488332 3300014325 Bacteria 1293
64 Ga0163163_10829552 3300014325 Bacteria 988
65 Ga0157377_10335420 3300014745 Bacteria 1009
66 Ga0163161_11024865 3300017792 Bacteria 706
67 Ga0207692_11082009 3300025898 Bacteria 531
68 Ga0207680_10550026 3300025903 Bacteria 824
69 Ga0207699_10583037 3300025906 Bacteria 813
70 Ga0207699_11050026 3300025906 Unclassified 603
71 Ga0207684_10140513 3300025910 Bacteria 2075
72 Ga0207654_10031321 3300025911 Bacteria 2928
73 Ga0207654_10042454 3300025911 Bacteria 2574
74 Ga0207707_10049225 3300025912 Bacteria 3671
75 Ga0207707_10077348 3300025912 Bacteria 2905
76 Ga0207707_10349508 3300025912 Unclassified 1274
77 Ga0207695_10030747 3300025913 Bacteria 5908
78 Ga0207695_10041014 3300025913 Bacteria 4956
79 Ga0207695_10333519 3300025913 Bacteria 1405
80 Ga0207695_11457224 3300025913 Unclassified 565
81 Ga0207671_10027261 3300025914 Bacteria 4271
82 Ga0207671_10941982 3300025914 Unclassified 682
83 Ga0207660_10714793 3300025917 Unclassified 817
84 Ga0207657_10177562 3300025919 Bacteria 1723
85 Ga0207652_10336531 3300025921 Bacteria 1363
86 Ga0207652_11294790 3300025921 Unclassified 631
87 Ga0207694_10002231 3300025924 Bacteria 15894
88 Ga0207694_10168544 3300025924 Bacteria 1772
89 Ga0207694_10298868 3300025924 Bacteria 1325
90 Ga0207650_10842439 3300025925 Bacteria 778
91 Ga0207687_10013432 3300025927 Bacteria 5346
92 Ga0207687_10134271 3300025927 Bacteria 1870
93 Ga0207700_10020368 3300025928 Bacteria 4503
94 Ga0207664_10003519 3300025929 Bacteria 10464
95 Ga0207686_10003395 3300025934 Bacteria 8552
96 Ga0207686_10008694 3300025934 Bacteria 5485
97 Ga0207686_11086483 3300025934 Unclassified 652
98 Ga0207709_10268957 3300025935 Bacteria 1253
99 Ga0207665_10613543 3300025939 Unclassified 850
100 Ga0207711_10227983 3300025941 Bacteria 1706
101 Ga0207711_11030151 3300025941 Unclassified 763
102 Ga0207711_12124358 3300025941 Unclassified 504
103 Ga0207689_10231778 3300025942 Bacteria 1526
104 Ga0207661_10159148 3300025944 Bacteria 1958
105 Ga0207661_11610651 3300025944 Unclassified 594
106 Ga0207679_10435878 3300025945 Bacteria 1159
107 Ga0207667_10072598 3300025949 Bacteria 3576
108 Ga0207667_10226046 3300025949 Bacteria 1917
109 Ga0207667_10666708 3300025949 Bacteria 1045
110 Ga0207658_10496693 3300025986 Bacteria 1086
111 Ga0207677_10060438 3300026023 Bacteria 2619
112 Ga0207677_10321379 3300026023 Bacteria 1286
113 Ga0207703_10490933 3300026035 Bacteria 1151
114 Ga0207639_10215092 3300026041 Bacteria 1657
115 Ga0207639_10585167 3300026041 Bacteria 1028
116 Ga0207702_10996560 3300026078 Unclassified 831
117 Ga0207648_10259345 3300026089 Bacteria 1551
118 Ga0207648_10390838 3300026089 Bacteria 1259
119 Ga0207676_11070939 3300026095 Bacteria 796
120 Ga0207676_11968699 3300026095 Unclassified 583
121 Ga0207674_10013346 3300026116 Bacteria 9120
122 Ga0207674_10066897 3300026116 Bacteria 3618
123 Ga0207698_11310731 3300026142 Unclassified 739
124 Ga0268266_10045369 3300028379 Bacteria 3760
125 Ga0268264_11033388 3300028381 Unclassified 829
126 Ga0265319_1001250 3300028563 Bacteria 15514
127 Ga0265318_10000320 3300028577 Bacteria 38387
128 Ga0265338_10164292 3300028800 Unclassified 1711
129 Ga0265760_10054794 3300031090 Bacteria 1205
130 Ga0265332_10020242 3300031238 Bacteria 2937
131 Ga0265320_10000118 3300031240 Bacteria 68945
132 Ga0265325_10074388 3300031241 Bacteria 1699
133 Ga0265329_10000050 3300031242 Bacteria 51098
134 Ga0265340_10010721 3300031247 Bacteria 4896
135 Ga0265339_10001712 3300031249 Bacteria 16166
136 Ga0265331_10000135 3300031250 Bacteria 96750
137 Ga0265316_10000531 3300031344 Bacteria 42984
138 Ga0265313_10007671 3300031595 Bacteria 7312
139 Ga0265314_10599738 3300031711 Bacteria 567
140 Ga0265342_10000694 3300031712 Bacteria 35309
141 Ga0373926_0068149 3300035083 Bacteria 1304
142 Ga0373934_0003707 3300035086 Bacteria 5622
143 Ga0373953_0036126 3300035117 Bacteria 1944
144 Ga0373954_0004111 3300035118 Bacteria 6238
145 Ga0373954_0026333 3300035118 Bacteria 2666
146 Ga0373956_0000656 3300035119 Bacteria 14220
147 Ga0373943_0030890 3300035170 Bacteria 2539
148 Ga0373943_0301617 3300035170 Bacteria 910
149 Ga0373955_0001940 3300035172 Bacteria 8927
150 Ga0373955_0283371 3300035172 Bacteria 997
151 Ga0373955_0980056 3300035172 Bacteria 520
152 Ga0373935_0055913 3300035692 Bacteria 2515
153 Ga0373935_0393825 3300035692 Bacteria 994
154 Ga0373927_0000936 3300035695 Bacteria 22186
155 Ga0373933_0000375 3300035724 Bacteria 28675
156 Ga0373933_0111030 3300035724 Bacteria 1710
157 Ga0373933_0836042 3300035724 Unclassified 606
158 Ga0373947_0015815 3300035725 Bacteria 4334
159 Ga0373947_0041581 3300035725 Bacteria 2741
160 Ga0373937_0000082 3300036401 Bacteria 87971
161 Ga0373937_0004958 3300036401 Bacteria 11319
162 Ga0373937_0160843 3300036401 Bacteria 2105
163 Ga0373937_0420909 3300036401 Bacteria 1268
164 Ga0373937_0549010 3300036401 Bacteria 1097
165 Ga0373925_0000097 3300037068 Bacteria 94132
166 Ga0373925_1244415 3300037068 Bacteria 611
167 Ga0436364_1489768 3300037853 Unclassified 1052
168 Ga0436365_0886667 3300039437 Bacteria 1793
169 Ga0436365_1796780 3300039437 Bacteria 2858
170 Ga0436361_0749453 3300039447 Unclassified 749
171 Ga0436363_1171158 3300039450 Unclassified 639
172 Ga0495592_0060107 3300046454 Bacteria 2796
173 Ga0495651_0000281 3300046462 Bacteria 39620
174 Ga0495651_0025630 3300046462 Bacteria 4592
175 Ga0495651_0895255 3300046462 Bacteria 543
176 Ga0495653_0165739 3300046463 Bacteria 1529
177 Ga0495580_0010389 3300046472 Bacteria 7256
178 Ga0495580_0549787 3300046472 Unclassified 767
179 Ga0495639_0368078 3300046475 Bacteria 723
180 Ga0495662_0388850 3300046476 Unclassified 685
181 Ga0495664_0251336 3300046477 Bacteria 1069
182 Ga0495585_0218367 3300046492 Unclassified 963
183 Ga0495608_0011412 3300046511 Bacteria 6184
184 Ga0495608_0174584 3300046511 Bacteria 1362
185 Ga0495608_0288709 3300046511 Bacteria 1017
186 Ga0495628_0785372 3300046516 Bacteria 667
187 Ga0495586_0558340 3300046535 Unclassified 661
188 Ga0495587_0000670 3300046536 Bacteria 22971
189 Ga0495645_0133463 3300046543 Bacteria 1738
190 Ga0495645_0157458 3300046543 Bacteria 1573
191 Ga0495667_0003266 3300046559 Bacteria 10872
192 Ga0495667_0010980 3300046559 Bacteria 6121
193 Ga0495667_0173501 3300046559 Bacteria 1385
194 Ga0495667_0559080 3300046559 Bacteria 714
195 Ga0495635_0085042 3300046663 Bacteria 2164
196 Ga0495635_0197544 3300046663 Unclassified 1365
197 Ga0495599_0329620 3300046678 Unclassified 918
198 Ga0495623_0017476 3300046679 Bacteria 4634
199 Ga0495623_0032560 3300046679 Bacteria 3350
200 Ga0495669_0256286 3300046684 Bacteria 840
201 Ga0495669_0611361 3300046684 Unclassified 530
202 Ga0495600_0054207 3300046809 Bacteria 2619
203 Ga0495600_0187008 3300046809 Bacteria 1333
204 Ga0495604_0007722 3300047317 Bacteria 8519
205 Ga0495604_0047659 3300047317 Bacteria 3337
206 Ga0495604_0065791 3300047317 Bacteria 2758
207 Ga0495680_0010996 3300047322 Bacteria 8040
208 Ga0495675_0026045 3300047444 Bacteria 3727
209 Ga0495675_0091292 3300047444 Bacteria 1912
210 Ga0495675_0324954 3300047444 Unclassified 909
211 Ga0495677_0240509 3300047445 Bacteria 707
212 Ga0495684_0078765 3300047471 Bacteria 2501
213 Ga0495684_0386663 3300047471 Bacteria 985
214 Ga0495684_0399435 3300047471 Unclassified 965
215 Ga0495602_0595741 3300048088 Bacteria 761
216 Ga0496100_1552934 3300048903 Unclassified 523
217 Ga0496104_0843165 3300048907 Unclassified 822
218 Ga0496115_0077550 3300048918 Bacteria 2702
219 Ga0496115_0102522 3300048918 Bacteria 2347
220 Ga0496115_0429100 3300048918 Bacteria 1070
221 Ga0501047_0470910 3300049581 Bacteria 1084
222 Ga0501083_0281135 3300049744 Bacteria 1083
223 nmdc:mga0qj67_327846_c1 3300050509 Bacteria 1239
224 Ga0495601_0144895 3300053077 Bacteria 1550
225 Ga0495619_0195984 3300053085 Bacteria 1398
226 Ga0070660_100177638
227 Ga0068869_100024251
228 Ga0070682_100579211
229 Ga0070709_10190971
230 Ga0070714_100279378
231 Ga0070714_100664504
232 Ga0070713_100048342
233 Ga0070713_100559307
234 Ga0070711_100638377
235 Ga0070678_101418409
236 Ga0070681_10002519
237 Ga0070681_10003357
238 Ga0070681_10057012
239 Ga0070679_100025938
240 Ga0070679_100578549
241 Ga0070684_100822164
242 Ga0070693_100044906
243 Ga0070693_100689704
244 Ga0070665_100120808
245 Ga0068855_100100340
246 Ga0068857_100250124
247 Ga0068856_100547528
248 Ga0068852_101809995
249 Ga0068859_101285388
250 Ga0068863_100251941
251 Ga0068858_101639789
252 Ga0068860_100129069
253 Ga0070717_10023527
254 Ga0070717_10776851
255 Ga0068871_100413801
256 Ga0097620_101285722
257 Ga0075435_100922697
258 Ga0105240_10250998
259 Ga0105240_11615287
260 Ga0105240_11756393
261 Ga0105245_10363017
262 Ga0105245_10436043
263 Ga0105245_10471969
264 Ga0105245_10710721
265 Ga0105247_11093755
266 Ga0114129_11033268
267 Ga0105242_10028710
268 Ga0105242_10120553
269 Ga0105242_10918741
270 Ga0105248_10152691
271 Ga0105248_10167102
272 Ga0105248_10391747
273 Ga0105237_10045158
274 Ga0105237_12113775
275 Ga0105238_10232925
276 Ga0105238_11019795
277 Ga0105249_10118654
278 Ga0099796_10085409
279 Ga0105246_10153851
280 Ga0105246_10480438
281 Ga0157370_11422440
282 Ga0157374_10050392
283 Ga0157374_10329253
284 Ga0157374_10704470
285 Ga0157378_11263122
286 Ga0157372_10614625
287 Ga0157375_10589519
288 Ga0163163_10488332
289 Ga0163163_10829552
290 Ga0157377_10335420
291 Ga0163161_11024865
292 Ga0207692_11082009
293 Ga0207680_10550026
294 Ga0207699_10583037
295 Ga0207699_11050026
296 Ga0207684_10140513
297 Ga0207654_10031321
298 Ga0207654_10042454
299 Ga0207707_10049225
300 Ga0207707_10077348
301 Ga0207707_10349508
302 Ga0207695_10030747
303 Ga0207695_10041014
304 Ga0207695_10333519
305 Ga0207695_11457224
306 Ga0207671_10027261
307 Ga0207671_10941982
308 Ga0207660_10714793
309 Ga0207657_10177562
310 Ga0207652_10336531
311 Ga0207652_11294790
312 Ga0207694_10002231
313 Ga0207694_10168544
314 Ga0207694_10298868
315 Ga0207650_10842439
316 Ga0207687_10013432
317 Ga0207687_10134271
318 Ga0207700_10020368
319 Ga0207664_10003519
320 Ga0207686_10003395
321 Ga0207686_10008694
322 Ga0207686_11086483
323 Ga0207709_10268957
324 Ga0207665_10613543
325 Ga0207711_10227983
326 Ga0207711_11030151
327 Ga0207711_12124358
328 Ga0207689_10231778
329 Ga0207661_10159148
330 Ga0207661_11610651
331 Ga0207679_10435878
332 Ga0207667_10072598
333 Ga0207667_10226046
334 Ga0207667_10666708
335 Ga0207658_10496693
336 Ga0207677_10060438
337 Ga0207677_10321379
338 Ga0207703_10490933
339 Ga0207639_10215092
340 Ga0207639_10585167
341 Ga0207702_10996560
342 Ga0207648_10259345
343 Ga0207648_10390838
344 Ga0207676_11070939
345 Ga0207676_11968699
346 Ga0207674_10013346
347 Ga0207674_10066897
348 Ga0207698_11310731
349 Ga0268266_10045369
350 Ga0268264_11033388
351 Ga0265319_1001250
352 Ga0265318_10000320
353 Ga0265338_10164292
354 Ga0265760_10054794
355 Ga0265332_10020242
356 Ga0265320_10000118
357 Ga0265325_10074388
358 Ga0265329_10000050
359 Ga0265340_10010721
360 Ga0265339_10001712
361 Ga0265331_10000135
362 Ga0265316_10000531
363 Ga0265313_10007671
364 Ga0265314_10599738
365 Ga0265342_10000694
366 Ga0373926_0068149
367 Ga0373934_0003707
368 Ga0373953_0036126
369 Ga0373954_0004111
370 Ga0373954_0026333
371 Ga0373956_0000656
372 Ga0373943_0030890
373 Ga0373943_0301617
374 Ga0373955_0001940
375 Ga0373955_0283371
376 Ga0373955_0980056
377 Ga0373935_0055913
378 Ga0373935_0393825
379 Ga0373927_0000936
380 Ga0373933_0000375
381 Ga0373933_0111030
382 Ga0373933_0836042
383 Ga0373947_0015815
384 Ga0373947_0041581
385 Ga0373937_0000082
386 Ga0373937_0004958
387 Ga0373937_0160843
388 Ga0373937_0420909
389 Ga0373937_0549010
390 Ga0373925_0000097
391 Ga0373925_1244415
392 Ga0436364_1489768
393 Ga0436365_0886667
394 Ga0436365_1796780
395 Ga0436361_0749453
396 Ga0436363_1171158
397 Ga0495592_0060107
398 Ga0495651_0000281
399 Ga0495651_0025630
400 Ga0495651_0895255
401 Ga0495653_0165739
402 Ga0495580_0010389
403 Ga0495580_0549787
404 Ga0495639_0368078
405 Ga0495662_0388850
406 Ga0495664_0251336
407 Ga0495585_0218367
408 Ga0495608_0011412
409 Ga0495608_0174584
410 Ga0495608_0288709
411 Ga0495628_0785372
412 Ga0495586_0558340
413 Ga0495587_0000670
414 Ga0495645_0133463
415 Ga0495645_0157458
416 Ga0495667_0003266
417 Ga0495667_0010980
418 Ga0495667_0173501
419 Ga0495667_0559080
420 Ga0495635_0085042
421 Ga0495635_0197544
422 Ga0495599_0329620
423 Ga0495623_0017476
424 Ga0495623_0032560
425 Ga0495669_0256286
426 Ga0495669_0611361
427 Ga0495600_0054207
428 Ga0495600_0187008
429 Ga0495604_0007722
430 Ga0495604_0047659
431 Ga0495604_0065791
432 Ga0495680_0010996
433 Ga0495675_0026045
434 Ga0495675_0091292
435 Ga0495675_0324954
436 Ga0495677_0240509
437 Ga0495684_0078765
438 Ga0495684_0386663
439 Ga0495684_0399435
440 Ga0495602_0595741
441 Ga0496100_1552934
442 Ga0496104_0843165
443 Ga0496115_0077550
444 Ga0496115_0102522
445 Ga0496115_0429100
446 Ga0501047_0470910
447 Ga0501083_0281135
448 nmdc:mga0qj67_327846_c1
449 Ga0495601_0144895
450 Ga0495619_0195984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

12

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lva-assembly1.cif.gz_A crystal structure of a c-terminal fragment of moorella thermoacetica elongation factor selb 0.8833 18 81
5l0p-assembly1.cif.gz_A-2 symmetry-based assembly of a two-dimensional protein lattice 0.8744 7 81
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8644 20 81
2g9w-assembly1.cif.gz_B crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis 0.8559 16 81
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8529 20 82
ID Description Score Start End Superfamily
2fu4B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8712 7 81 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8644 20 81 1.10.10.10
5fd6D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.856 6 80 1.10.10.10
3f8nB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.854 3 81 1.10.10.10
2fe3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8539 3 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2K4QAN2-F1-model_v4 deleted 0.6896 3 109
AF-A0A1G2X8E1-F1-model_v4 Transcriptional repressor 0.6882 3 103 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A380DX00-F1-model_v4 Peroxide-responsive repressor PerR 0.681 3 109 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A1F3DFW3-F1-model_v4 Transcriptional repressor 0.6786 1 109 GO:0000976
GO:0003700
GO:0005737
GO:0008270
GO:0045892
GO:1900376
AF-A0A2S8PEK7-F1-model_v4 Transcriptional repressor 0.6766 1 107 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376

Map