F337421

General Info

Members Datasets Scaffolds Average Seq Length
225 122 450 247

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100055748|Ga0070683_1000557484
Length 284
Sequence VAWAASSPACFLGIYWAVGVGETGAGEAVAXXXGEVHPVAGDNMELLKELVSKLEHAFSDRLVSVILYGSAASPVHADRFSDLNVLCVLKQVMPQELMEGEPVLNWWREKGHPWPLLMSEDEVHNSADCFPIEFHDMKERRRVLYGLDVIADLHVDMRNYRTQVEHELRSKLLRLRQQGASLLSQSAKLLALCVDSVNTFCVLGRHALELDGKKPKSERRAVVRQLAEVLHADMKPFEILLDIREDKSGVDAGGLADPGELFAQYLVCISRLITFVDGLDGQRG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.44
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100055748 3300005329 Bacteria 3668
2 Ga0070658_10294121 3300005327 Bacteria 1384
3 Ga0070683_100026531 3300005329 Bacteria 5218
4 Ga0070683_100113832 3300005329 Bacteria 2553
5 Ga0070683_100189725 3300005329 Unclassified 1951
6 Ga0068869_100510297 3300005334 Unclassified 1005
7 Ga0070680_100023209 3300005336 Bacteria 4946
8 Ga0070680_100054971 3300005336 Bacteria 3252
9 Ga0070689_100377456 3300005340 Bacteria 1194
10 Ga0070691_10003121 3300005341 Bacteria 7425
11 Ga0070661_100062234 3300005344 Bacteria 2740
12 Ga0070661_100083447 3300005344 Unclassified 2360
13 Ga0070692_10282348 3300005345 Bacteria 1007
14 Ga0070713_100025822 3300005436 Bacteria 4601
15 Ga0070713_100053550 3300005436 Bacteria 3344
16 Ga0070711_100132688 3300005439 Bacteria 1857
17 Ga0070705_100251627 3300005440 Bacteria 1241
18 Ga0070663_100372578 3300005455 Bacteria 1161
19 Ga0070681_10052127 3300005458 Bacteria 4081
20 Ga0070681_10099302 3300005458 Unclassified 2857
21 Ga0070681_10142933 3300005458 Bacteria 2322
22 Ga0070699_100241819 3300005518 Bacteria 1611
23 Ga0070679_100010338 3300005530 Bacteria 8848
24 Ga0070679_100047991 3300005530 Bacteria 4255
25 Ga0070679_100169657 3300005530 Unclassified 2155
26 Ga0070679_100241882 3300005530 Unclassified 1762
27 Ga0070684_100020785 3300005535 Bacteria 5447
28 Ga0070684_100428217 3300005535 Bacteria 1222
29 Ga0068853_100115218 3300005539 Bacteria 2392
30 Ga0070695_100267865 3300005545 Bacteria 1250
31 Ga0070696_100075793 3300005546 Bacteria 2374
32 Ga0070665_100168770 3300005548 Bacteria 2190
33 Ga0070665_100268620 3300005548 Bacteria 1707
34 Ga0070665_100275333 3300005548 Unclassified 1685
35 Ga0068855_100012177 3300005563 Bacteria 10393
36 Ga0068855_100149711 3300005563 Bacteria 2654
37 Ga0068855_100230823 3300005563 Bacteria 2072
38 Ga0068855_100347123 3300005563 Unclassified 1635
39 Ga0068857_100002127 3300005577 Bacteria 16097
40 Ga0068857_100018462 3300005577 Bacteria 6118
41 Ga0068856_100029913 3300005614 Bacteria 5323
42 Ga0068856_100031327 3300005614 Bacteria 5202
43 Ga0068856_100120355 3300005614 Bacteria 2626
44 Ga0068856_100450565 3300005614 Bacteria 1308
45 Ga0068852_100104354 3300005616 Bacteria 2565
46 Ga0068852_100245677 3300005616 Bacteria 1712
47 Ga0068864_100015677 3300005618 Bacteria 6303
48 Ga0068863_100262555 3300005841 Bacteria 1670
49 Ga0068858_100023383 3300005842 Bacteria 5757
50 Ga0068858_100064947 3300005842 Bacteria 3378
51 Ga0068860_100301642 3300005843 Bacteria 1569
52 Ga0068860_100602675 3300005843 Unclassified 1104
53 Ga0097621_100151636 3300006237 Bacteria 1988
54 Ga0075428_100231662 3300006844 Bacteria 1993
55 Ga0075431_100006301 3300006847 Bacteria 11785
56 Ga0105240_10000362 3300009093 Bacteria 85169
57 Ga0105240_10010126 3300009093 Bacteria 13270
58 Ga0105240_10012927 3300009093 Bacteria 11499
59 Ga0105240_10023798 3300009093 Bacteria 8091
60 Ga0105240_10098747 3300009093 Bacteria 3555
61 Ga0105240_10174510 3300009093 Bacteria 2542
62 Ga0105240_10249864 3300009093 Unclassified 2052
63 Ga0105245_10003786 3300009098 Bacteria 13456
64 Ga0105245_10005739 3300009098 Bacteria 10894
65 Ga0105245_10013265 3300009098 Bacteria 7180
66 Ga0105245_10433798 3300009098 Bacteria 1319
67 Ga0114129_11195731 3300009147 Unclassified 947
68 Ga0105241_10008308 3300009174 Bacteria 7642
69 Ga0105241_10021993 3300009174 Bacteria 4721
70 Ga0105241_10332513 3300009174 Bacteria 1314
71 Ga0105241_10455037 3300009174 Unclassified 1133
72 Ga0105242_10027365 3300009176 Bacteria 4527
73 Ga0105242_10222164 3300009176 Bacteria 1689
74 Ga0105248_10004268 3300009177 Bacteria 15815
75 Ga0105248_10191299 3300009177 Bacteria 2306
76 Ga0105237_10001120 3300009545 Bacteria 35914
77 Ga0105237_10044700 3300009545 Bacteria 4459
78 Ga0105237_10045801 3300009545 Bacteria 4401
79 Ga0105237_10553323 3300009545 Bacteria 1157
80 Ga0105237_10866301 3300009545 Bacteria 910
81 Ga0105238_10044842 3300009551 Bacteria 4469
82 Ga0105238_10111355 3300009551 Bacteria 2718
83 Ga0105238_10118568 3300009551 Bacteria 2627
84 Ga0105249_10259792 3300009553 Bacteria 1725
85 Ga0105239_10007249 3300010375 Bacteria 12737
86 Ga0105239_10011650 3300010375 Bacteria 9815
87 Ga0105239_10030690 3300010375 Bacteria 5912
88 Ga0105239_10118829 3300010375 Bacteria 2934
89 Ga0105239_10140403 3300010375 Bacteria 2692
90 Ga0105239_10184347 3300010375 Bacteria 2335
91 Ga0105246_10007580 3300011119 Bacteria 6658
92 Ga0157371_10031696 3300013102 Bacteria 3808
93 Ga0157370_10001461 3300013104 Bacteria 29211
94 Ga0157370_10003216 3300013104 Bacteria 19290
95 Ga0157370_10005315 3300013104 Bacteria 14468
96 Ga0157370_10038663 3300013104 Bacteria 4615
97 Ga0157370_10347510 3300013104 Bacteria 1367
98 Ga0157369_10002486 3300013105 Bacteria 22081
99 Ga0157369_10018538 3300013105 Bacteria 7802
100 Ga0157369_10025546 3300013105 Bacteria 6557
101 Ga0157369_10132285 3300013105 Unclassified 2643
102 Ga0157374_10033181 3300013296 Bacteria 4709
103 Ga0157378_10039176 3300013297 Bacteria 4203
104 Ga0157372_10004949 3300013307 Bacteria 14151
105 Ga0157372_10017880 3300013307 Bacteria 7617
106 Ga0157372_10176655 3300013307 Bacteria 2472
107 Ga0157372_10286072 3300013307 Bacteria 1917
108 Ga0163163_10004090 3300014325 Bacteria 12443
109 Ga0213875_10000006 3300021388 Bacteria 579005
110 Ga0213875_10003505 3300021388 Bacteria 8926
111 Ga0213875_10195064 3300021388 Unclassified 952
112 Ga0213871_10002057 3300021441 Bacteria 3605
113 Ga0207699_10490806 3300025906 Bacteria 885
114 Ga0207707_10019641 3300025912 Bacteria 5897
115 Ga0207707_10174912 3300025912 Unclassified 1875
116 Ga0207707_10293591 3300025912 Bacteria 1406
117 Ga0207695_10001584 3300025913 Bacteria 37018
118 Ga0207695_10004083 3300025913 Bacteria 20062
119 Ga0207695_10021380 3300025913 Bacteria 7382
120 Ga0207695_10035649 3300025913 Bacteria 5391
121 Ga0207695_10091734 3300025913 Bacteria 3051
122 Ga0207671_10007349 3300025914 Bacteria 9566
123 Ga0207671_10017857 3300025914 Bacteria 5458
124 Ga0207671_10034388 3300025914 Bacteria 3765
125 Ga0207663_10053874 3300025916 Bacteria 2516
126 Ga0207663_10135528 3300025916 Bacteria 1708
127 Ga0207663_10277300 3300025916 Bacteria 1244
128 Ga0207660_10100572 3300025917 Unclassified 2159
129 Ga0207660_10161067 3300025917 Bacteria 1731
130 Ga0207649_10041781 3300025920 Bacteria 2793
131 Ga0207649_10069351 3300025920 Bacteria 2245
132 Ga0207652_10030084 3300025921 Bacteria 4545
133 Ga0207694_10005114 3300025924 Bacteria 10125
134 Ga0207694_10080105 3300025924 Bacteria 2563
135 Ga0207687_10005707 3300025927 Bacteria 8233
136 Ga0207687_10027191 3300025927 Bacteria 3837
137 Ga0207687_10037528 3300025927 Bacteria 3306
138 Ga0207687_10100121 3300025927 Unclassified 2131
139 Ga0207670_10306186 3300025936 Bacteria 1246
140 Ga0207711_10006644 3300025941 Bacteria 9745
141 Ga0207661_10076863 3300025944 Bacteria 2743
142 Ga0207661_10200129 3300025944 Unclassified 1756
143 Ga0207667_10000305 3300025949 Bacteria 67996
144 Ga0207667_10020889 3300025949 Bacteria 7265
145 Ga0207667_10029778 3300025949 Bacteria 5914
146 Ga0207667_10132442 3300025949 Bacteria 2568
147 Ga0207651_10020517 3300025960 Bacteria 3991
148 Ga0207712_10110577 3300025961 Bacteria 2060
149 Ga0207658_10339776 3300025986 Bacteria 1305
150 Ga0207658_10408553 3300025986 Unclassified 1195
151 Ga0207703_10031183 3300026035 Bacteria 4214
152 Ga0207678_10055613 3300026067 Bacteria 3409
153 Ga0207702_10014268 3300026078 Bacteria 6598
154 Ga0207702_10015233 3300026078 Bacteria 6374
155 Ga0207702_10016217 3300026078 Bacteria 6166
156 Ga0207702_10132583 3300026078 Bacteria 2244
157 Ga0207641_10018481 3300026088 Bacteria 5716
158 Ga0207641_10242705 3300026088 Bacteria 1679
159 Ga0207648_10162892 3300026089 Bacteria 1970
160 Ga0207674_10001325 3300026116 Bacteria 32148
161 Ga0207674_10003411 3300026116 Bacteria 19473
162 Ga0268266_10027410 3300028379 Bacteria 4845
163 Ga0268266_10304234 3300028379 Unclassified 1488
164 Ga0265338_10086555 3300028800 Bacteria 2607
165 Ga0265332_10022202 3300031238 Bacteria 2801
166 Ga0265320_10012344 3300031240 Bacteria 4979
167 Ga0265340_10037647 3300031247 Bacteria 2396
168 Ga0265331_10014962 3300031250 Bacteria 4114
169 Ga0265316_10049640 3300031344 Bacteria 3304
170 Ga0265316_10123448 3300031344 Bacteria 1955
171 Ga0265316_10236002 3300031344 Bacteria 1345
172 Ga0265313_10003468 3300031595 Bacteria 12731
173 Ga0265314_10001898 3300031711 Bacteria 22374
174 Ga0265314_10029900 3300031711 Bacteria 4041
175 Ga0373934_0001160 3300035086 Bacteria 9604
176 Ga0373953_0111037 3300035117 Unclassified 1159
177 Ga0373956_0044544 3300035119 Bacteria 1978
178 Ga0373956_0224991 3300035119 Bacteria 891
179 Ga0373946_0050863 3300035171 Bacteria 1732
180 Ga0373927_0001251 3300035695 Bacteria 19281
181 Ga0373933_0033557 3300035724 Bacteria 2986
182 Ga0373947_0001833 3300035725 Bacteria 12997
183 Ga0373947_0531477 3300035725 Unclassified 800
184 Ga0373937_0229552 3300036401 Bacteria 1748
185 Ga0373937_0298860 3300036401 Bacteria 1521
186 Ga0373925_0000315 3300037068 Bacteria 50558
187 Ga0373925_0319928 3300037068 Bacteria 1255
188 Ga0395899_0171882 3300037312 Bacteria 1526
189 Ga0395900_0311703 3300037418 Bacteria 1557
190 Ga0395900_0853278 3300037418 Unclassified 836
191 Ga0436364_0771783 3300037853 Bacteria 3248
192 Ga0436365_0730842 3300039437 Bacteria 2618
193 Ga0436360_0405535 3300039438 Bacteria 20711
194 Ga0436362_1243376 3300039453 Bacteria 6822
195 Ga0466966_0187388 3300044684 Bacteria 1254
196 Ga0466963_0276135 3300044694 Bacteria 1181
197 Ga0453684_0737178 3300044712 Bacteria 1068
198 Ga0451576_0046132 3300045051 Bacteria 4589
199 Ga0451576_0162638 3300045051 Bacteria 2330
200 Ga0451576_0297948 3300045051 Bacteria 1686
201 Ga0466967_0385186 3300045976 Bacteria 1362
202 Ga0495651_0035611 3300046462 Bacteria 3875
203 Ga0495580_0061094 3300046472 Bacteria 2647
204 Ga0495587_0016412 3300046536 Bacteria 4607
205 Ga0495587_0114977 3300046536 Unclassified 1544
206 Ga0495684_0005229 3300047471 Bacteria 10112
207 Ga0495602_0028718 3300048088 Bacteria 5316
208 Ga0496104_0490409 3300048907 Bacteria 1140
209 Ga0496126_0047041 3300048929 Bacteria 3952
210 Ga0501034_0247499 3300049571 Bacteria 1727
211 Ga0501037_0020479 3300049573 Bacteria 4884
212 Ga0501038_0076266 3300049574 Bacteria 2832
213 Ga0501046_0177442 3300049580 Bacteria 1595
214 Ga0501047_0007367 3300049581 Bacteria 10346
215 Ga0501047_0079187 3300049581 Unclassified 3160
216 Ga0501070_0026980 3300049586 Bacteria 4817
217 Ga0501035_0019568 3300049822 Bacteria 6220
218 Ga0501044_0005263 3300049823 Bacteria 14391
219 Ga0501044_0006823 3300049823 Bacteria 12581
220 Ga0501044_0048615 3300049823 Bacteria 4380
221 nmdc:mga05p37_160257_c1 3300050507 Bacteria 2748
222 nmdc:mga05p37_990163_c1 3300050507 Bacteria 894
223 nmdc:mga06r32_116207_c1 3300050510 Bacteria 2636
224 Ga0495595_0144108 3300053084 Bacteria 1170
225 Ga0495619_0080255 3300053085 Bacteria 2196
226 Ga0070683_100055748
227 Ga0070658_10294121
228 Ga0070683_100026531
229 Ga0070683_100113832
230 Ga0070683_100189725
231 Ga0068869_100510297
232 Ga0070680_100023209
233 Ga0070680_100054971
234 Ga0070689_100377456
235 Ga0070691_10003121
236 Ga0070661_100062234
237 Ga0070661_100083447
238 Ga0070692_10282348
239 Ga0070713_100025822
240 Ga0070713_100053550
241 Ga0070711_100132688
242 Ga0070705_100251627
243 Ga0070663_100372578
244 Ga0070681_10052127
245 Ga0070681_10099302
246 Ga0070681_10142933
247 Ga0070699_100241819
248 Ga0070679_100010338
249 Ga0070679_100047991
250 Ga0070679_100169657
251 Ga0070679_100241882
252 Ga0070684_100020785
253 Ga0070684_100428217
254 Ga0068853_100115218
255 Ga0070695_100267865
256 Ga0070696_100075793
257 Ga0070665_100168770
258 Ga0070665_100268620
259 Ga0070665_100275333
260 Ga0068855_100012177
261 Ga0068855_100149711
262 Ga0068855_100230823
263 Ga0068855_100347123
264 Ga0068857_100002127
265 Ga0068857_100018462
266 Ga0068856_100029913
267 Ga0068856_100031327
268 Ga0068856_100120355
269 Ga0068856_100450565
270 Ga0068852_100104354
271 Ga0068852_100245677
272 Ga0068864_100015677
273 Ga0068863_100262555
274 Ga0068858_100023383
275 Ga0068858_100064947
276 Ga0068860_100301642
277 Ga0068860_100602675
278 Ga0097621_100151636
279 Ga0075428_100231662
280 Ga0075431_100006301
281 Ga0105240_10000362
282 Ga0105240_10010126
283 Ga0105240_10012927
284 Ga0105240_10023798
285 Ga0105240_10098747
286 Ga0105240_10174510
287 Ga0105240_10249864
288 Ga0105245_10003786
289 Ga0105245_10005739
290 Ga0105245_10013265
291 Ga0105245_10433798
292 Ga0114129_11195731
293 Ga0105241_10008308
294 Ga0105241_10021993
295 Ga0105241_10332513
296 Ga0105241_10455037
297 Ga0105242_10027365
298 Ga0105242_10222164
299 Ga0105248_10004268
300 Ga0105248_10191299
301 Ga0105237_10001120
302 Ga0105237_10044700
303 Ga0105237_10045801
304 Ga0105237_10553323
305 Ga0105237_10866301
306 Ga0105238_10044842
307 Ga0105238_10111355
308 Ga0105238_10118568
309 Ga0105249_10259792
310 Ga0105239_10007249
311 Ga0105239_10011650
312 Ga0105239_10030690
313 Ga0105239_10118829
314 Ga0105239_10140403
315 Ga0105239_10184347
316 Ga0105246_10007580
317 Ga0157371_10031696
318 Ga0157370_10001461
319 Ga0157370_10003216
320 Ga0157370_10005315
321 Ga0157370_10038663
322 Ga0157370_10347510
323 Ga0157369_10002486
324 Ga0157369_10018538
325 Ga0157369_10025546
326 Ga0157369_10132285
327 Ga0157374_10033181
328 Ga0157378_10039176
329 Ga0157372_10004949
330 Ga0157372_10017880
331 Ga0157372_10176655
332 Ga0157372_10286072
333 Ga0163163_10004090
334 Ga0213875_10000006
335 Ga0213875_10003505
336 Ga0213875_10195064
337 Ga0213871_10002057
338 Ga0207699_10490806
339 Ga0207707_10019641
340 Ga0207707_10174912
341 Ga0207707_10293591
342 Ga0207695_10001584
343 Ga0207695_10004083
344 Ga0207695_10021380
345 Ga0207695_10035649
346 Ga0207695_10091734
347 Ga0207671_10007349
348 Ga0207671_10017857
349 Ga0207671_10034388
350 Ga0207663_10053874
351 Ga0207663_10135528
352 Ga0207663_10277300
353 Ga0207660_10100572
354 Ga0207660_10161067
355 Ga0207649_10041781
356 Ga0207649_10069351
357 Ga0207652_10030084
358 Ga0207694_10005114
359 Ga0207694_10080105
360 Ga0207687_10005707
361 Ga0207687_10027191
362 Ga0207687_10037528
363 Ga0207687_10100121
364 Ga0207670_10306186
365 Ga0207711_10006644
366 Ga0207661_10076863
367 Ga0207661_10200129
368 Ga0207667_10000305
369 Ga0207667_10020889
370 Ga0207667_10029778
371 Ga0207667_10132442
372 Ga0207651_10020517
373 Ga0207712_10110577
374 Ga0207658_10339776
375 Ga0207658_10408553
376 Ga0207703_10031183
377 Ga0207678_10055613
378 Ga0207702_10014268
379 Ga0207702_10015233
380 Ga0207702_10016217
381 Ga0207702_10132583
382 Ga0207641_10018481
383 Ga0207641_10242705
384 Ga0207648_10162892
385 Ga0207674_10001325
386 Ga0207674_10003411
387 Ga0268266_10027410
388 Ga0268266_10304234
389 Ga0265338_10086555
390 Ga0265332_10022202
391 Ga0265320_10012344
392 Ga0265340_10037647
393 Ga0265331_10014962
394 Ga0265316_10049640
395 Ga0265316_10123448
396 Ga0265316_10236002
397 Ga0265313_10003468
398 Ga0265314_10001898
399 Ga0265314_10029900
400 Ga0373934_0001160
401 Ga0373953_0111037
402 Ga0373956_0044544
403 Ga0373956_0224991
404 Ga0373946_0050863
405 Ga0373927_0001251
406 Ga0373933_0033557
407 Ga0373947_0001833
408 Ga0373947_0531477
409 Ga0373937_0229552
410 Ga0373937_0298860
411 Ga0373925_0000315
412 Ga0373925_0319928
413 Ga0395899_0171882
414 Ga0395900_0311703
415 Ga0395900_0853278
416 Ga0436364_0771783
417 Ga0436365_0730842
418 Ga0436360_0405535
419 Ga0436362_1243376
420 Ga0466966_0187388
421 Ga0466963_0276135
422 Ga0453684_0737178
423 Ga0451576_0046132
424 Ga0451576_0162638
425 Ga0451576_0297948
426 Ga0466967_0385186
427 Ga0495651_0035611
428 Ga0495580_0061094
429 Ga0495587_0016412
430 Ga0495587_0114977
431 Ga0495684_0005229
432 Ga0495602_0028718
433 Ga0496104_0490409
434 Ga0496126_0047041
435 Ga0501034_0247499
436 Ga0501037_0020479
437 Ga0501038_0076266
438 Ga0501046_0177442
439 Ga0501047_0007367
440 Ga0501047_0079187
441 Ga0501070_0026980
442 Ga0501035_0019568
443 Ga0501044_0005263
444 Ga0501044_0006823
445 Ga0501044_0048615
446 nmdc:mga05p37_160257_c1
447 nmdc:mga05p37_990163_c1
448 nmdc:mga06r32_116207_c1
449 Ga0495595_0144108
450 Ga0495619_0080255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rbe-assembly1.cif.gz_A human dna polymerase beta crosslinked binary complex - a 0.7382 23 89
4m9h-assembly1.cif.gz_A dna polymerase beta e295k soaked with dttp 0.7357 23 89
4m9g-assembly1.cif.gz_A dna polymerase beta e295k binary complex 0.7356 23 89
5u8h-assembly1.cif.gz_A dna polymerase beta g231d crystallized in peg 400 0.7343 23 89
6btf-assembly1.cif.gz_A dna polymerase beta i260q ternary complex 0.7221 23 89
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7767 23 73 3.30.460.10
af_P27249_72_168_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7643 30 126 3.30.460.10
af_Q54TZ1_588_696_1.10.1410.10 Mainly Alpha;Orthogonal Bundle;Poly(a)-polymerase, middle domain; 0.7642 28 88 1.10.1410.10
af_P27249_72_168_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7513 30 126 3.30.460.10
af_Q58701_1_124_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7392 22 133 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7C4G4L6-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9534 26 259 GO:0016740
AF-A0A2V8XKH6-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9521 29 159 GO:0016779
AF-A0A2G4FSL4-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9407 29 129
AF-A0A2V9RHH4-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9389 23 261
AF-A0A257VNY9-F1-model_v4 Uncharacterized protein 0.9381 86 259

Map