F337186

General Info

Members Datasets Scaffolds Average Seq Length
224 125 224 158

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0036018|Ga0501047_0036018_2854_3405
Length 183
Sequence LAAPDGSNLYAGQAQWQKEIVMDQTSKPVSVDVEEIKKLLPHRAPFLFLERLTDIVPNESAVGHKAVSINEPHFQGHFPEFAVMPGVLIVEAMAQTAGALVVYSLGRASLSRKVYFMTIDKARFRRPVKPGDMLRFPVKAIRHRGPVWRFSGEAFVGDDLAAEAEFSAMIFDGEDENPSNGNR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 0
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10802594 3300005327 Bacteria 818
2 Ga0070683_100401366 3300005329 Bacteria 1307
3 Ga0070680_100000678 3300005336 Bacteria 23649
4 Ga0070691_10068029 3300005341 Bacteria 1724
5 Ga0070661_100000150 3300005344 Bacteria 57095
6 Ga0070674_101913605 3300005356 Bacteria 539
7 Ga0070659_100453277 3300005366 Bacteria 1088
8 Ga0070681_10000001 3300005458 Bacteria 946857
9 Ga0070679_100002973 3300005530 Bacteria 15467
10 Ga0070679_100210344 3300005530 Bacteria 1909
11 Ga0070684_101353719 3300005535 Bacteria 670
12 Ga0068853_100002664 3300005539 Bacteria 13457
13 Ga0068853_100787229 3300005539 Bacteria 910
14 Ga0070696_100062360 3300005546 Bacteria 2609
15 Ga0068855_100067359 3300005563 Bacteria 4171
16 Ga0068855_101311691 3300005563 Bacteria 749
17 Ga0068857_100020640 3300005577 Bacteria 5797
18 Ga0068856_101200593 3300005614 Bacteria 775
19 Ga0068852_100129142 3300005616 Bacteria 2325
20 Ga0068852_100182884 3300005616 Bacteria 1972
21 Ga0068852_101208611 3300005616 Bacteria 777
22 Ga0070712_100045788 3300006175 Bacteria 3022
23 Ga0070712_100090186 3300006175 Bacteria 2244
24 Ga0070712_101203506 3300006175 Unclassified 659
25 Ga0097621_100515950 3300006237 Bacteria 1084
26 Ga0068871_100210861 3300006358 Bacteria 1680
27 Ga0105240_10000122 3300009093 Bacteria 162728
28 Ga0105240_10200640 3300009093 Bacteria 2338
29 Ga0105240_10337341 3300009093 Bacteria 1713
30 Ga0105247_10012247 3300009101 Bacteria 5153
31 Ga0105241_10391852 3300009174 Bacteria 1216
32 Ga0105248_10000005 3300009177 Bacteria 673111
33 Ga0105238_10044118 3300009551 Bacteria 4510
34 Ga0105239_10001682 3300010375 Bacteria 29165
35 Ga0105239_10020204 3300010375 Bacteria 7347
36 Ga0105239_10040279 3300010375 Bacteria 5119
37 Ga0157370_10085929 3300013104 Bacteria 2956
38 Ga0157369_10003771 3300013105 Bacteria 18015
39 Ga0157369_10106843 3300013105 Bacteria 2978
40 Ga0157378_10717148 3300013297 Bacteria 1021
41 Ga0163162_11513114 3300013306 Unclassified 765
42 Ga0163162_11992341 3300013306 Bacteria 665
43 Ga0157372_10024220 3300013307 Bacteria 6589
44 Ga0157372_10024401 3300013307 Bacteria 6568
45 Ga0157372_10031283 3300013307 Bacteria 5827
46 Ga0157372_10392315 3300013307 Bacteria 1617
47 Ga0157375_11685370 3300013308 Bacteria 750
48 Ga0157379_10149808 3300014968 Bacteria 2104
49 Ga0157376_10440145 3300014969 Bacteria 1269
50 Ga0157376_10481599 3300014969 Bacteria 1216
51 Ga0213874_10009758 3300021377 Bacteria 2385
52 Ga0213874_10082429 3300021377 Bacteria 1044
53 Ga0213876_10000148 3300021384 Bacteria 75586
54 Ga0213876_10031297 3300021384 Bacteria 2808
55 Ga0207692_10498446 3300025898 Bacteria 772
56 Ga0207710_10029834 3300025900 Bacteria 2376
57 Ga0207705_10440040 3300025909 Bacteria 1010
58 Ga0207654_10075193 3300025911 Bacteria 2018
59 Ga0207707_10000048 3300025912 Bacteria 117799
60 Ga0207695_10000173 3300025913 Bacteria 189050
61 Ga0207695_10252785 3300025913 Bacteria 1661
62 Ga0207671_10311359 3300025914 Bacteria 1245
63 Ga0207693_10084643 3300025915 Bacteria 2485
64 Ga0207693_10149522 3300025915 Bacteria 1837
65 Ga0207660_10000072 3300025917 Bacteria 52074
66 Ga0207649_10000162 3300025920 Bacteria 54357
67 Ga0207649_10363949 3300025920 Bacteria 1074
68 Ga0207652_10000509 3300025921 Bacteria 39514
69 Ga0207694_10000005 3300025924 Bacteria 823704
70 Ga0207690_10396103 3300025932 Bacteria 1100
71 Ga0207686_10039234 3300025934 Bacteria 2873
72 Ga0207711_10000002 3300025941 Bacteria 1228676
73 Ga0207667_10000011 3300025949 Bacteria 447785
74 Ga0207639_10003988 3300026041 Bacteria 9964
75 Ga0207683_10703962 3300026121 Bacteria 936
76 Ga0207698_10001097 3300026142 Bacteria 15766
77 Ga0207698_11612939 3300026142 Bacteria 664
78 Ga0265337_1019924 3300028556 Bacteria 2109
79 Ga0265318_10000015 3300028577 Bacteria 187234
80 Ga0265338_10000005 3300028800 Bacteria 571137
81 Ga0265338_10022733 3300028800 Bacteria 6476
82 Ga0265338_10271721 3300028800 Bacteria 1242
83 Ga0265324_10175681 3300029957 Bacteria 727
84 Ga0265330_10005233 3300031235 Bacteria 6480
85 Ga0265330_10255174 3300031235 Bacteria 739
86 Ga0265332_10254315 3300031238 Bacteria 726
87 Ga0265328_10023539 3300031239 Bacteria 2337
88 Ga0265325_10000005 3300031241 Bacteria 321343
89 Ga0265325_10030485 3300031241 Bacteria 2891
90 Ga0265325_10068789 3300031241 Bacteria 1782
91 Ga0265329_10050018 3300031242 Bacteria 1331
92 Ga0265340_10000182 3300031247 Bacteria 31971
93 Ga0265340_10005143 3300031247 Bacteria 7272
94 Ga0265340_10125170 3300031247 Bacteria 1181
95 Ga0265339_10000502 3300031249 Bacteria 30556
96 Ga0265339_10022162 3300031249 Bacteria 3683
97 Ga0265339_10052265 3300031249 Bacteria 2226
98 Ga0265331_10000003 3300031250 Bacteria 499358
99 Ga0265331_10003172 3300031250 Bacteria 10736
100 Ga0265331_10004852 3300031250 Bacteria 8279
101 Ga0265331_10040245 3300031250 Bacteria 2275
102 Ga0265331_10094956 3300031250 Bacteria 1376
103 Ga0265327_10000453 3300031251 Bacteria 73806
104 Ga0265316_10073786 3300031344 Bacteria 2627
105 Ga0265316_10365298 3300031344 Bacteria 1043
106 Ga0265316_10552878 3300031344 Bacteria 819
107 Ga0265316_10759197 3300031344 Bacteria 681
108 Ga0265313_10004669 3300031595 Bacteria 10353
109 Ga0265313_10036321 3300031595 Bacteria 2474
110 Ga0265313_10036660 3300031595 Bacteria 2460
111 Ga0265313_10078119 3300031595 Bacteria 1510
112 Ga0265313_10259298 3300031595 Bacteria 707
113 Ga0265314_10001066 3300031711 Bacteria 31856
114 Ga0265314_10010159 3300031711 Bacteria 7888
115 Ga0265314_10014519 3300031711 Bacteria 6296
116 Ga0265314_10027232 3300031711 Bacteria 4283
117 Ga0265314_10046627 3300031711 Bacteria 3056
118 Ga0265314_10068570 3300031711 Bacteria 2384
119 Ga0265314_10071262 3300031711 Bacteria 2326
120 Ga0265314_10192567 3300031711 Bacteria 1212
121 Ga0265342_10019403 3300031712 Bacteria 4383
122 Ga0265342_10051946 3300031712 Bacteria 2444
123 Ga0265342_10065356 3300031712 Bacteria 2132
124 Ga0307516_10028379 3300031730 Bacteria 5663
125 Ga0373926_0198543 3300035083 Bacteria 772
126 Ga0373945_0003086 3300035116 Bacteria 5234
127 Ga0373943_0001631 3300035170 Bacteria 10178
128 Ga0373946_0039800 3300035171 Bacteria 1920
129 Ga0373955_0119517 3300035172 Bacteria 1531
130 Ga0373935_0359157 3300035692 Bacteria 1040
131 Ga0373927_0073369 3300035695 Bacteria 2216
132 Ga0373933_0985937 3300035724 Unclassified 555
133 Ga0373947_0012891 3300035725 Bacteria 4792
134 Ga0373947_0063236 3300035725 Bacteria 2254
135 Ga0373937_0304043 3300036401 Bacteria 1508
136 Ga0373937_0362368 3300036401 Unclassified 1374
137 Ga0373925_0003618 3300037068 Bacteria 11903
138 Ga0373925_0481338 3300037068 Bacteria 1018
139 Ga0436365_0040755 3300039437 Bacteria 3579
140 Ga0436365_1201434 3300039437 Bacteria 113887
141 Ga0436363_0671455 3300039450 Bacteria 2050
142 Ga0436363_1537794 3300039450 Bacteria 5547
143 Ga0495592_0414510 3300046454 Bacteria 851
144 Ga0495651_0206644 3300046462 Bacteria 1370
145 Ga0495580_0010986 3300046472 Bacteria 7018
146 Ga0495580_0182490 3300046472 Bacteria 1449
147 Ga0495664_0221356 3300046477 Bacteria 1146
148 Ga0495606_0281484 3300046507 Bacteria 909
149 Ga0495608_0709991 3300046511 Unclassified 598
150 Ga0495652_0014997 3300046529 Bacteria 6942
151 Ga0495645_0084120 3300046543 Bacteria 2278
152 Ga0495599_0280796 3300046678 Bacteria 1009
153 Ga0495658_0001457 3300046683 Bacteria 12459
154 Ga0495613_0261955 3300046689 Bacteria 1204
155 Ga0495674_0067845 3300047319 Bacteria 3089
156 Ga0495684_0267742 3300047471 Bacteria 1237
157 Ga0495682_0017653 3300049460 Bacteria 2690
158 Ga0501031_0145431 3300049568 Bacteria 1549
159 Ga0501031_0606990 3300049568 Bacteria 704
160 Ga0501032_0023989 3300049569 Bacteria 4214
161 Ga0501033_0005941 3300049570 Bacteria 9582
162 Ga0501033_0011542 3300049570 Bacteria 6759
163 Ga0501034_0008345 3300049571 Bacteria 10959
164 Ga0501034_0128084 3300049571 Bacteria 2523
165 Ga0501036_0003392 3300049572 Bacteria 12727
166 Ga0501036_0191212 3300049572 Bacteria 1722
167 Ga0501037_0095241 3300049573 Bacteria 2152
168 Ga0501037_0492482 3300049573 Bacteria 832
169 Ga0501038_0033902 3300049574 Bacteria 4492
170 Ga0501038_0498065 3300049574 Bacteria 932
171 Ga0501038_0538145 3300049574 Bacteria 889
172 Ga0501039_0102394 3300049575 Bacteria 2235
173 Ga0501043_0178126 3300049579 Bacteria 1657
174 Ga0501043_0390808 3300049579 Bacteria 1052
175 Ga0501046_0008185 3300049580 Bacteria 9134
176 Ga0501046_0084392 3300049580 Bacteria 2450
177 Ga0501046_0183242 3300049580 Bacteria 1565
178 Ga0501047_0010315 3300049581 Bacteria 8835
179 Ga0501047_0036018 3300049581 Bacteria 4782
180 Ga0501047_0037428 3300049581 Bacteria 4691
181 Ga0501047_0037683 3300049581 Bacteria 4676
182 Ga0501047_0093477 3300049581 Bacteria 2886
183 Ga0501047_0199001 3300049581 Bacteria 1865
184 Ga0501047_0265594 3300049581 Bacteria 1563
185 Ga0501047_0931307 3300049581 Unclassified 682
186 Ga0501067_0027301 3300049583 Bacteria 3163
187 Ga0501067_0407460 3300049583 Bacteria 758
188 Ga0501068_0032307 3300049584 Bacteria 3113
189 Ga0501069_0007161 3300049585 Bacteria 5846
190 Ga0501069_0069537 3300049585 Bacteria 1971
191 Ga0501070_0018697 3300049586 Bacteria 5813
192 Ga0501070_0023113 3300049586 Bacteria 5207
193 Ga0501070_0027976 3300049586 Bacteria 4729
194 Ga0501070_0133375 3300049586 Bacteria 2051
195 Ga0501073_0045384 3300049589 Bacteria 3094
196 Ga0501073_0311760 3300049589 Bacteria 1085
197 Ga0501074_0062472 3300049590 Bacteria 2682
198 Ga0501074_0276948 3300049590 Bacteria 1193
199 Ga0501074_0358426 3300049590 Bacteria 1035
200 Ga0501079_0004550 3300049741 Bacteria 10280
201 Ga0501080_0009629 3300049742 Bacteria 8821
202 Ga0501080_0126877 3300049742 Bacteria 2363
203 Ga0501080_0180241 3300049742 Bacteria 1944
204 Ga0501080_0293429 3300049742 Bacteria 1476
205 Ga0501080_0627873 3300049742 Bacteria 952
206 Ga0501083_0048503 3300049744 Bacteria 2866
207 Ga0501083_0315182 3300049744 Bacteria 1017
208 Ga0501035_0028867 3300049822 Bacteria 5061
209 Ga0501035_0054492 3300049822 Bacteria 3573
210 Ga0501035_0093556 3300049822 Bacteria 2644
211 Ga0501035_0114583 3300049822 Bacteria 2360
212 Ga0501035_0186648 3300049822 Bacteria 1784
213 Ga0501035_0219940 3300049822 Bacteria 1622
214 Ga0501035_0276278 3300049822 Bacteria 1421
215 Ga0501044_0005208 3300049823 Bacteria 14476
216 Ga0501044_0016703 3300049823 Bacteria 7879
217 Ga0501044_0023502 3300049823 Bacteria 6557
218 Ga0501044_0231232 3300049823 Bacteria 1796
219 Ga0501044_0532399 3300049823 Bacteria 1073
220 Ga0500573_0000008 3300053140 Bacteria 237795
221 Ga0500619_023906 3300053154 Bacteria 1791
222 Ga0501084_0000017 3300054114 Bacteria 148659
223 Ga0501084_0043454 3300054114 Bacteria 3759
224 Ga0501082_0113783 3300060353 Bacteria 2343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_101203506 Ga0070712_1012035061 130
2 3300013306 Ga0163162_11513114 Ga0163162_115131142 132
3 3300005344 Ga0070661_100000150 Ga0070661_10000015037 134
4 3300009093 Ga0105240_10200640 Ga0105240_102006402 134
5 3300025920 Ga0207649_10000162 Ga0207649_1000016219 134
6 3300031711 Ga0265314_10071262 Ga0265314_100712622 134
7 3300046507 Ga0495606_0281484 Ga0495606_0281484_273_740 134
8 3300049568 Ga0501031_0145431 Ga0501031_0145431_117_611 134
9 3300049570 Ga0501033_0005941 Ga0501033_0005941_8454_8948 134
10 3300049571 Ga0501034_0128084 Ga0501034_0128084_1323_1817 134
11 3300049573 Ga0501037_0492482 Ga0501037_0492482_281_775 134
12 3300049574 Ga0501038_0033902 Ga0501038_0033902_3835_4329 134
13 3300049575 Ga0501039_0102394 Ga0501039_0102394_1314_1808 134
14 3300049580 Ga0501046_0008185 Ga0501046_0008185_6613_7107 134
15 3300049580 Ga0501046_0084392 Ga0501046_0084392_1495_1989 134
16 3300049581 Ga0501047_0093477 Ga0501047_0093477_619_1113 134
17 3300049583 Ga0501067_0407460 Ga0501067_0407460_223_717 134
18 3300049584 Ga0501068_0032307 Ga0501068_0032307_1065_1559 134
19 3300049585 Ga0501069_0069537 Ga0501069_0069537_45_539 134
20 3300049586 Ga0501070_0023113 Ga0501070_0023113_1089_1583 134
21 3300049589 Ga0501073_0311760 Ga0501073_0311760_460_954 134
22 3300049590 Ga0501074_0276948 Ga0501074_0276948_345_839 134
23 3300049742 Ga0501080_0126877 Ga0501080_0126877_816_1310 134
24 3300049744 Ga0501083_0048503 Ga0501083_0048503_1592_2086 134
25 3300049822 Ga0501035_0114583 Ga0501035_0114583_979_1473 134
26 3300049823 Ga0501044_0016703 Ga0501044_0016703_455_949 134
27 3300060353 Ga0501082_0113783 Ga0501082_0113783_541_1035 134
28 3300031250 Ga0265331_10004852 Ga0265331_100048526 137
29 3300031251 Ga0265327_10000453 Ga0265327_1000045315 137
30 3300049572 Ga0501036_0003392 Ga0501036_0003392_12187_12681 137
31 3300031344 Ga0265316_10552878 Ga0265316_105528782 138
32 3300031712 Ga0265342_10065356 Ga0265342_100653562 138
33 3300036401 Ga0373937_0304043 Ga0373937_0304043_973_1455 142
34 3300046454 Ga0495592_0414510 Ga0495592_0414510_136_618 142
35 3300046529 Ga0495652_0014997 Ga0495652_0014997_6053_6535 142
36 3300046543 Ga0495645_0084120 Ga0495645_0084120_644_1126 142
37 3300046678 Ga0495599_0280796 Ga0495599_0280796_120_602 142
38 3300031239 Ga0265328_10023539 Ga0265328_100235392 143
39 3300031241 Ga0265325_10030485 Ga0265325_100304854 143
40 3300031249 Ga0265339_10052265 Ga0265339_100522652 143
41 3300031711 Ga0265314_10001066 Ga0265314_1000106610 143
42 3300031712 Ga0265342_10019403 Ga0265342_100194035 143
43 3300005535 Ga0070684_101353719 Ga0070684_1013537191 144
44 3300005539 Ga0068853_100787229 Ga0068853_1007872291 144
45 3300005563 Ga0068855_101311691 Ga0068855_1013116912 144
46 3300005614 Ga0068856_101200593 Ga0068856_1012005932 144
47 3300005616 Ga0068852_100182884 Ga0068852_1001828842 144
48 3300010375 Ga0105239_10001682 Ga0105239_100016826 144
49 3300025911 Ga0207654_10075193 Ga0207654_100751932 144
50 3300025914 Ga0207671_10311359 Ga0207671_103113592 144
51 3300026142 Ga0207698_11612939 Ga0207698_116129392 144
52 3300021377 Ga0213874_10082429 Ga0213874_100824292 145
53 3300039450 Ga0436363_1537794 Ga0436363_1537794_75_563 145
54 3300013297 Ga0157378_10717148 Ga0157378_107171481 146
55 3300053140 Ga0500573_0000008 Ga0500573_0000008_159838_160293 146
56 3300005356 Ga0070674_101913605 Ga0070674_1019136051 147
57 3300021377 Ga0213874_10009758 Ga0213874_100097581 147
58 3300026121 Ga0207683_10703962 Ga0207683_107039621 147
59 3300031711 Ga0265314_10068570 Ga0265314_100685702 147
60 3300039437 Ga0436365_0040755 Ga0436365_0040755_375_830 147
61 3300039450 Ga0436363_0671455 Ga0436363_0671455_1541_1996 147
62 3300031238 Ga0265332_10254315 Ga0265332_102543152 148
63 3300031344 Ga0265316_10365298 Ga0265316_103652982 148
64 3300049568 Ga0501031_0606990 Ga0501031_0606990_27_494 148
65 3300049570 Ga0501033_0011542 Ga0501033_0011542_4010_4474 148
66 3300049572 Ga0501036_0191212 Ga0501036_0191212_495_947 148
67 3300049573 Ga0501037_0095241 Ga0501037_0095241_167_619 148
68 3300049574 Ga0501038_0538145 Ga0501038_0538145_321_773 148
69 3300049579 Ga0501043_0390808 Ga0501043_0390808_28_492 148
70 3300049581 Ga0501047_0010315 Ga0501047_0010315_5782_6246 148
71 3300049581 Ga0501047_0265594 Ga0501047_0265594_788_1240 148
72 3300049742 Ga0501080_0627873 Ga0501080_0627873_373_825 148
73 3300049822 Ga0501035_0028867 Ga0501035_0028867_1864_2328 148
74 3300049822 Ga0501035_0093556 Ga0501035_0093556_1828_2280 148
75 3300049823 Ga0501044_0023502 Ga0501044_0023502_1575_2039 148
76 3300049823 Ga0501044_0532399 Ga0501044_0532399_414_866 148
77 3300013307 Ga0157372_10392315 Ga0157372_103923152 149
78 3300035172 Ga0373955_0119517 Ga0373955_0119517_903_1367 149
79 3300035724 Ga0373933_0985937 Ga0373933_0985937_25_489 149
80 3300046462 Ga0495651_0206644 Ga0495651_0206644_123_587 149
81 3300046511 Ga0495608_0709991 Ga0495608_0709991_37_501 149
82 3300049579 Ga0501043_0178126 Ga0501043_0178126_63_524 149
83 3300049580 Ga0501046_0183242 Ga0501046_0183242_822_1292 149
84 3300049581 Ga0501047_0931307 Ga0501047_0931307_162_623 149
85 3300049822 Ga0501035_0186648 Ga0501035_0186648_1207_1677 149
86 3300005329 Ga0070683_100401366 Ga0070683_1004013662 150
87 3300021384 Ga0213876_10031297 Ga0213876_100312974 150
88 3300028800 Ga0265338_10271721 Ga0265338_102717212 150
89 3300031250 Ga0265331_10040245 Ga0265331_100402453 150
90 3300031344 Ga0265316_10073786 Ga0265316_100737864 150
91 3300031595 Ga0265313_10036321 Ga0265313_100363212 150
92 3300031595 Ga0265313_10078119 Ga0265313_100781192 150
93 3300031711 Ga0265314_10014519 Ga0265314_100145195 150
94 3300049822 Ga0501035_0219940 Ga0501035_0219940_261_764 150
95 3300005546 Ga0070696_100062360 Ga0070696_1000623602 152
96 3300005341 Ga0070691_10068029 Ga0070691_100680292 153
97 3300005366 Ga0070659_100453277 Ga0070659_1004532772 153
98 3300005530 Ga0070679_100210344 Ga0070679_1002103442 153
99 3300005563 Ga0068855_100067359 Ga0068855_1000673594 153
100 3300005577 Ga0068857_100020640 Ga0068857_1000206402 153
101 3300009093 Ga0105240_10337341 Ga0105240_103373412 153
102 3300013104 Ga0157370_10085929 Ga0157370_100859294 153
103 3300014968 Ga0157379_10149808 Ga0157379_101498082 153
104 3300025932 Ga0207690_10396103 Ga0207690_103961032 153
105 3300028800 Ga0265338_10022733 Ga0265338_100227334 153
106 3300006358 Ga0068871_100210861 Ga0068871_1002108612 154
107 3300013307 Ga0157372_10031283 Ga0157372_100312834 154
108 3300014969 Ga0157376_10440145 Ga0157376_104401452 154
109 3300014969 Ga0157376_10481599 Ga0157376_104815992 154
110 3300021384 Ga0213876_10000148 Ga0213876_1000014869 154
111 3300031250 Ga0265331_10000003 Ga0265331_1000000358 154
112 3300031711 Ga0265314_10010159 Ga0265314_100101596 154
113 3300039437 Ga0436365_1201434 Ga0436365_1201434_90064_90558 154
114 3300049581 Ga0501047_0037683 Ga0501047_0037683_3330_3818 154
115 3300049586 Ga0501070_0133375 Ga0501070_0133375_133_621 154
116 3300049590 Ga0501074_0358426 Ga0501074_0358426_371_859 154
117 3300049742 Ga0501080_0293429 Ga0501080_0293429_730_1218 154
118 3300049823 Ga0501044_0231232 Ga0501044_0231232_37_525 154
119 3300005336 Ga0070680_100000678 Ga0070680_1000006786 155
120 3300005458 Ga0070681_10000001 Ga0070681_10000001300 155
121 3300005530 Ga0070679_100002973 Ga0070679_10000297312 155
122 3300006175 Ga0070712_100090186 Ga0070712_1000901863 155
123 3300010375 Ga0105239_10020204 Ga0105239_100202044 155
124 3300013105 Ga0157369_10106843 Ga0157369_101068433 155
125 3300025912 Ga0207707_10000048 Ga0207707_1000004815 155
126 3300025915 Ga0207693_10084643 Ga0207693_100846433 155
127 3300025917 Ga0207660_10000072 Ga0207660_1000007216 155
128 3300025921 Ga0207652_10000509 Ga0207652_1000050915 155
129 3300025934 Ga0207686_10039234 Ga0207686_100392343 155
130 3300049574 Ga0501038_0498065 Ga0501038_0498065_291_776 155
131 3300049581 Ga0501047_0199001 Ga0501047_0199001_1002_1487 155
132 3300049742 Ga0501080_0009629 Ga0501080_0009629_820_1305 155
133 3300054114 Ga0501084_0000017 Ga0501084_0000017_6870_7355 155
134 3300005327 Ga0070658_10802594 Ga0070658_108025941 156
135 3300005539 Ga0068853_100002664 Ga0068853_1000026647 156
136 3300005616 Ga0068852_100129142 Ga0068852_1001291422 156
137 3300005616 Ga0068852_101208611 Ga0068852_1012086112 156
138 3300006175 Ga0070712_100045788 Ga0070712_1000457884 156
139 3300006237 Ga0097621_100515950 Ga0097621_1005159502 156
140 3300009093 Ga0105240_10000122 Ga0105240_1000012246 156
141 3300009101 Ga0105247_10012247 Ga0105247_100122473 156
142 3300009174 Ga0105241_10391852 Ga0105241_103918522 156
143 3300009177 Ga0105248_10000005 Ga0105248_10000005447 156
144 3300009551 Ga0105238_10044118 Ga0105238_100441182 156
145 3300010375 Ga0105239_10040279 Ga0105239_100402795 156
146 3300013105 Ga0157369_10003771 Ga0157369_1000377114 156
147 3300013306 Ga0163162_11992341 Ga0163162_119923412 156
148 3300013307 Ga0157372_10024220 Ga0157372_100242207 156
149 3300013307 Ga0157372_10024401 Ga0157372_100244014 156
150 3300013308 Ga0157375_11685370 Ga0157375_116853701 156
151 3300025898 Ga0207692_10498446 Ga0207692_104984462 156
152 3300025900 Ga0207710_10029834 Ga0207710_100298343 156
153 3300025909 Ga0207705_10440040 Ga0207705_104400402 156
154 3300025913 Ga0207695_10000173 Ga0207695_1000017346 156
155 3300025913 Ga0207695_10252785 Ga0207695_102527853 156
156 3300025915 Ga0207693_10149522 Ga0207693_101495222 156
157 3300025920 Ga0207649_10363949 Ga0207649_103639492 156
158 3300025924 Ga0207694_10000005 Ga0207694_10000005304 156
159 3300025941 Ga0207711_10000002 Ga0207711_10000002445 156
160 3300025949 Ga0207667_10000011 Ga0207667_10000011282 156
161 3300026041 Ga0207639_10003988 Ga0207639_100039884 156
162 3300026142 Ga0207698_10001097 Ga0207698_1000109712 156
163 3300028556 Ga0265337_1019924 Ga0265337_10199242 156
164 3300028577 Ga0265318_10000015 Ga0265318_1000001595 156
165 3300028800 Ga0265338_10000005 Ga0265338_10000005465 156
166 3300029957 Ga0265324_10175681 Ga0265324_101756812 156
167 3300031235 Ga0265330_10005233 Ga0265330_100052333 156
168 3300031235 Ga0265330_10255174 Ga0265330_102551742 156
169 3300031241 Ga0265325_10000005 Ga0265325_1000000552 156
170 3300031241 Ga0265325_10068789 Ga0265325_100687892 156
171 3300031242 Ga0265329_10050018 Ga0265329_100500182 156
172 3300031247 Ga0265340_10000182 Ga0265340_100001825 156
173 3300031247 Ga0265340_10005143 Ga0265340_100051437 156
174 3300031247 Ga0265340_10125170 Ga0265340_101251702 156
175 3300031249 Ga0265339_10000502 Ga0265339_1000050212 156
176 3300031249 Ga0265339_10022162 Ga0265339_100221622 156
177 3300031250 Ga0265331_10003172 Ga0265331_100031723 156
178 3300031250 Ga0265331_10094956 Ga0265331_100949562 156
179 3300031344 Ga0265316_10759197 Ga0265316_107591971 156
180 3300031595 Ga0265313_10004669 Ga0265313_100046697 156
181 3300031595 Ga0265313_10036660 Ga0265313_100366602 156
182 3300031595 Ga0265313_10259298 Ga0265313_102592982 156
183 3300031711 Ga0265314_10027232 Ga0265314_100272323 156
184 3300031711 Ga0265314_10046627 Ga0265314_100466272 156
185 3300031711 Ga0265314_10192567 Ga0265314_101925672 156
186 3300031712 Ga0265342_10051946 Ga0265342_100519464 156
187 3300031730 Ga0307516_10028379 Ga0307516_100283794 156
188 3300035083 Ga0373926_0198543 Ga0373926_0198543_151_657 156
189 3300035116 Ga0373945_0003086 Ga0373945_0003086_2162_2668 156
190 3300035170 Ga0373943_0001631 Ga0373943_0001631_4827_5333 156
191 3300035171 Ga0373946_0039800 Ga0373946_0039800_1272_1778 156
192 3300035692 Ga0373935_0359157 Ga0373935_0359157_470_976 156
193 3300035695 Ga0373927_0073369 Ga0373927_0073369_792_1298 156
194 3300035725 Ga0373947_0012891 Ga0373947_0012891_1631_2137 156
195 3300035725 Ga0373947_0063236 Ga0373947_0063236_1401_1934 156
196 3300036401 Ga0373937_0362368 Ga0373937_0362368_191_697 156
197 3300037068 Ga0373925_0003618 Ga0373925_0003618_1155_1661 156
198 3300037068 Ga0373925_0481338 Ga0373925_0481338_127_660 156
199 3300046472 Ga0495580_0010986 Ga0495580_0010986_6442_6975 156
200 3300046472 Ga0495580_0182490 Ga0495580_0182490_561_1067 156
201 3300046477 Ga0495664_0221356 Ga0495664_0221356_130_618 156
202 3300046683 Ga0495658_0001457 Ga0495658_0001457_10497_11030 156
203 3300046689 Ga0495613_0261955 Ga0495613_0261955_273_779 156
204 3300047319 Ga0495674_0067845 Ga0495674_0067845_2087_2593 156
205 3300047471 Ga0495684_0267742 Ga0495684_0267742_393_926 156
206 3300049460 Ga0495682_0017653 Ga0495682_0017653_169_660 156
207 3300049569 Ga0501032_0023989 Ga0501032_0023989_2808_3296 156
208 3300049571 Ga0501034_0008345 Ga0501034_0008345_5491_5979 156
209 3300049581 Ga0501047_0036018 Ga0501047_0036018_2854_3405 156
210 3300049581 Ga0501047_0037428 Ga0501047_0037428_2388_2876 156
211 3300049583 Ga0501067_0027301 Ga0501067_0027301_661_1149 156
212 3300049585 Ga0501069_0007161 Ga0501069_0007161_1999_2487 156
213 3300049586 Ga0501070_0018697 Ga0501070_0018697_5092_5580 156
214 3300049586 Ga0501070_0027976 Ga0501070_0027976_2830_3327 156
215 3300049589 Ga0501073_0045384 Ga0501073_0045384_811_1299 156
216 3300049590 Ga0501074_0062472 Ga0501074_0062472_744_1232 156
217 3300049741 Ga0501079_0004550 Ga0501079_0004550_1918_2406 156
218 3300049742 Ga0501080_0180241 Ga0501080_0180241_78_566 156
219 3300049744 Ga0501083_0315182 Ga0501083_0315182_383_871 156
220 3300049822 Ga0501035_0054492 Ga0501035_0054492_3010_3498 156
221 3300049822 Ga0501035_0276278 Ga0501035_0276278_592_1092 156
222 3300049823 Ga0501044_0005208 Ga0501044_0005208_12610_13098 156
223 3300053154 Ga0500619_023906 Ga0500619_023906_774_1262 156
224 3300054114 Ga0501084_0043454 Ga0501084_0043454_1437_1925 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

40

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i83-assembly1.cif.gz_F crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18 0.9529 8 147
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.9478 9 147
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.9472 9 147
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.9465 9 148
3d6x-assembly1.cif.gz_B crystal structure of campylobacter jejuni fabz 0.9447 9 150
ID Description Score Start End Superfamily
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.945 7 147 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9427 7 147 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9343 9 147 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9322 7 151 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9292 7 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A448MTU2-F1-model_v4 (3R)-hydroxymyristoyl-ACP dehydratase (EC 4.2.1.-) 0.9607 32 148 GO:0016829
AF-A0A2E4E2M0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9591 8 150 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2E7FXR6-F1-model_v4 deleted 0.9576 9 148
AF-A0A356GQQ0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9564 37 148 GO:0016829
AF-A0A661TZG4-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase)] 0.9562 10 150 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
GO:0046872
GO:0103117

Feature Viewer

pLDDT pTM Quality
83.26 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map