F336867

General Info

Members Datasets Scaffolds Average Seq Length
224 157 448 265

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10181548|Ga0265340_101815482
Length 266
Sequence MLKVGSIEGTTVMITGGGTGLGRGFALRFAEAGATVALVARNSERLEAVAAEVRGQGGVAFVYQADIRDASAVQKVVDAIVADTGRLDVLVNNAAGNFVARAEDVTPNGWNAVVGIVLNGSFYCARAAGRQMLKQGSGKILSVVASYAWVGGPGTVHSAAAKAGVIAMTKTLAVEWGPRNLQVNCLCPGFVDTEQSRQVLWPTEAARAKLVSRIPAGRFGSIEEVVEAGFYLCSPAADYINGEVLTIDGGEWLNKGAFVLPEADAR

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 2.23
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10181548 3300031247 Bacteria 951
2 Ga0065712_10099859 3300005290 Bacteria 2076
3 Ga0065715_10041363 3300005293 Bacteria 1144
4 Ga0065715_10239478 3300005293 Bacteria 1186
5 Ga0065715_10279674 3300005293 Bacteria 1089
6 Ga0070683_100021775 3300005329 Bacteria 5722
7 Ga0070690_100147241 3300005330 Bacteria 1603
8 Ga0070670_100001808 3300005331 Bacteria 17439
9 Ga0070670_100020773 3300005331 Bacteria 5645
10 Ga0068869_100017989 3300005334 Bacteria 4803
11 Ga0070666_10149396 3300005335 Bacteria 1630
12 Ga0068868_100285282 3300005338 Bacteria 1398
13 Ga0070689_100056779 3300005340 Bacteria 3037
14 Ga0070689_100198035 3300005340 Bacteria 1639
15 Ga0070687_100055539 3300005343 Bacteria 2068
16 Ga0070661_100471384 3300005344 Bacteria 1001
17 Ga0070668_100122126 3300005347 Bacteria 2083
18 Ga0070669_100042817 3300005353 Bacteria 3296
19 Ga0070669_100286668 3300005353 Bacteria 1321
20 Ga0070675_100098574 3300005354 Bacteria 2459
21 Ga0070675_100195102 3300005354 Bacteria 1756
22 Ga0070675_100359966 3300005354 Bacteria 1292
23 Ga0070674_100032654 3300005356 Bacteria 3457
24 Ga0070674_100084761 3300005356 Bacteria 2273
25 Ga0070688_100127608 3300005365 Bacteria 1711
26 Ga0070688_100221343 3300005365 Bacteria 1334
27 Ga0070659_100039807 3300005366 Bacteria 3671
28 Ga0070667_100058097 3300005367 Bacteria 3270
29 Ga0070713_100031330 3300005436 Bacteria 4235
30 Ga0070701_10080865 3300005438 Bacteria 1758
31 Ga0070700_100322726 3300005441 Bacteria 1135
32 Ga0070662_100374991 3300005457 Bacteria 1170
33 Ga0068867_100007269 3300005459 Bacteria 7833
34 Ga0070699_100058332 3300005518 Bacteria 3344
35 Ga0070672_100343764 3300005543 Bacteria 1271
36 Ga0070686_100116229 3300005544 Bacteria 1830
37 Ga0070696_100273229 3300005546 Bacteria 1286
38 Ga0070704_100059724 3300005549 Bacteria 2721
39 Ga0070664_100165748 3300005564 Bacteria 1958
40 Ga0070664_100454065 3300005564 Bacteria 1177
41 Ga0068857_100000620 3300005577 Bacteria 26143
42 Ga0070702_100015240 3300005615 Bacteria 3920
43 Ga0068859_100088068 3300005617 Bacteria 3154
44 Ga0068866_10098529 3300005718 Bacteria 1608
45 Ga0068861_100309673 3300005719 Bacteria 1371
46 Ga0068861_100335468 3300005719 Bacteria 1322
47 Ga0068863_100527078 3300005841 Bacteria 1165
48 Ga0068860_100250583 3300005843 Bacteria 1724
49 Ga0068862_100404393 3300005844 Bacteria 1278
50 Ga0070717_10345065 3300006028 Bacteria 1330
51 Ga0070717_10372519 3300006028 Bacteria 1279
52 Ga0075364_10006468 3300006051 Bacteria 6884
53 Ga0075364_10042809 3300006051 Bacteria 2943
54 Ga0070715_10108068 3300006163 Bacteria 1308
55 Ga0075362_10000275 3300006177 Bacteria 14383
56 Ga0075367_10005727 3300006178 Bacteria 6208
57 Ga0075367_10016219 3300006178 Bacteria 4067
58 Ga0075366_10044104 3300006195 Bacteria 2643
59 Ga0075366_10325489 3300006195 Bacteria 942
60 Ga0075428_100027086 3300006844 Bacteria 6346
61 Ga0075428_100141799 3300006844 Bacteria 2613
62 Ga0075428_100356129 3300006844 Bacteria 1570
63 Ga0075431_100030496 3300006847 Bacteria 5554
64 Ga0075431_100213400 3300006847 Bacteria 1971
65 Ga0075434_100523329 3300006871 Bacteria 1206
66 Ga0075429_100038898 3300006880 Bacteria 4141
67 Ga0068865_100101228 3300006881 Bacteria 2110
68 Ga0097620_100088069 3300006931 Bacteria 3154
69 Ga0075435_100002471 3300007076 Bacteria 12289
70 Ga0105240_10348558 3300009093 Bacteria 1680
71 Ga0111539_10059341 3300009094 Bacteria 4537
72 Ga0111539_10282167 3300009094 Unclassified 1933
73 Ga0111539_10630331 3300009094 Bacteria 1248
74 Ga0105245_10822690 3300009098 Bacteria 968
75 Ga0114129_10000138 3300009147 Bacteria 75755
76 Ga0114129_10009181 3300009147 Bacteria 14099
77 Ga0114129_10927946 3300009147 Bacteria 1101
78 Ga0105243_10055899 3300009148 Bacteria 3137
79 Ga0105241_10160886 3300009174 Bacteria 1845
80 Ga0105242_10079710 3300009176 Bacteria 2735
81 Ga0105248_10063507 3300009177 Bacteria 4145
82 Ga0105248_10158872 3300009177 Bacteria 2550
83 Ga0105248_10348062 3300009177 Bacteria 1668
84 Ga0105248_10556273 3300009177 Bacteria 1294
85 Ga0105249_10027723 3300009553 Bacteria 5111
86 Ga0105249_10078485 3300009553 Bacteria 3064
87 Ga0105239_10432393 3300010375 Bacteria 1492
88 Ga0163162_10028856 3300013306 Bacteria 5492
89 Ga0163163_10092993 3300014325 Bacteria 3032
90 Ga0163163_10340962 3300014325 Bacteria 1554
91 Ga0157380_10051524 3300014326 Bacteria 3256
92 Ga0157376_10053383 3300014969 Bacteria 3365
93 Ga0207697_10078759 3300025315 Bacteria 1387
94 Ga0207642_10012433 3300025899 Bacteria 3072
95 Ga0207685_10090660 3300025905 Bacteria 1286
96 Ga0207645_10014108 3300025907 Bacteria 5354
97 Ga0207654_10070611 3300025911 Bacteria 2074
98 Ga0207695_10249202 3300025913 Bacteria 1676
99 Ga0207662_10003112 3300025918 Bacteria 8469
100 Ga0207681_10057371 3300025923 Bacteria 2661
101 Ga0207681_10138474 3300025923 Bacteria 1810
102 Ga0207681_10183035 3300025923 Bacteria 1597
103 Ga0207650_10031121 3300025925 Bacteria 3850
104 Ga0207650_10034386 3300025925 Bacteria 3675
105 Ga0207659_10052354 3300025926 Bacteria 2908
106 Ga0207659_10575937 3300025926 Bacteria 958
107 Ga0207687_10049208 3300025927 Bacteria 2930
108 Ga0207700_10105648 3300025928 Bacteria 2255
109 Ga0207644_10352370 3300025931 Bacteria 1195
110 Ga0207706_10194132 3300025933 Bacteria 1781
111 Ga0207670_10045784 3300025936 Bacteria 2902
112 Ga0207670_10205843 3300025936 Bacteria 1497
113 Ga0207691_10052248 3300025940 Bacteria 3733
114 Ga0207711_10007673 3300025941 Bacteria 9019
115 Ga0207711_10103664 3300025941 Bacteria 2519
116 Ga0207689_10053488 3300025942 Bacteria 3326
117 Ga0207661_10024186 3300025944 Bacteria 4600
118 Ga0207679_10246699 3300025945 Bacteria 1516
119 Ga0207679_10331200 3300025945 Bacteria 1321
120 Ga0207651_10004342 3300025960 Bacteria 7127
121 Ga0207712_10015113 3300025961 Bacteria 4974
122 Ga0207658_10201952 3300025986 Bacteria 1660
123 Ga0207677_10060768 3300026023 Bacteria 2614
124 Ga0207703_10821142 3300026035 Bacteria 888
125 Ga0207708_10169169 3300026075 Bacteria 1730
126 Ga0207641_10094354 3300026088 Bacteria 2624
127 Ga0207641_10159978 3300026088 Bacteria 2047
128 Ga0207641_10479824 3300026088 Bacteria 1205
129 Ga0207648_10003828 3300026089 Bacteria 15712
130 Ga0207676_10144575 3300026095 Bacteria 2041
131 Ga0207674_10001555 3300026116 Bacteria 29583
132 Ga0207675_100019151 3300026118 Bacteria 6388
133 Ga0207675_100038438 3300026118 Bacteria 4466
134 Ga0207428_10007471 3300027907 Bacteria 9964
135 Ga0207428_10019052 3300027907 Bacteria 5853
136 Ga0207428_10066116 3300027907 Bacteria 2849
137 Ga0207428_10189409 3300027907 Unclassified 1551
138 Ga0268265_10533403 3300028380 Bacteria 1111
139 Ga0268264_10096159 3300028381 Bacteria 2564
140 Ga0265339_10006816 3300031249 Bacteria 7449
141 Ga0307408_100161063 3300031548 Bacteria 1782
142 Ga0307406_10283870 3300031901 Bacteria 1264
143 Ga0307412_10109791 3300031911 Bacteria 1967
144 Ga0307416_100142388 3300032002 Bacteria 2182
145 Ga0307416_100342106 3300032002 Bacteria 1509
146 Ga0307411_10191057 3300032005 Bacteria 1564
147 Ga0307411_10212935 3300032005 Bacteria 1493
148 Ga0307415_100131405 3300032126 Bacteria 1896
149 Ga0373952_0053945 3300035092 Bacteria 966
150 Ga0373957_0072928 3300035120 Bacteria 1345
151 Ga0373943_0013540 3300035170 Bacteria 3684
152 Ga0373955_0215277 3300035172 Bacteria 1146
153 Ga0373942_0030532 3300035207 Bacteria 1420
154 Ga0373931_0181378 3300035691 Bacteria 1247
155 Ga0373933_0009114 3300035724 Bacteria 5417
156 Ga0373933_0083933 3300035724 Bacteria 1957
157 Ga0373947_0048035 3300035725 Bacteria 2560
158 Ga0373925_0021778 3300037068 Bacteria 4672
159 Ga0373925_0349898 3300037068 Bacteria 1200
160 Ga0439439_0008698 3300041406 Bacteria 2403
161 Ga0439439_0034950 3300041406 Bacteria 1290
162 Ga0439439_0063511 3300041406 Bacteria 983
163 Ga0439431_0003599 3300041997 Bacteria 3418
164 Ga0439431_0044010 3300041997 Bacteria 1144
165 Ga0439433_0024215 3300041999 Bacteria 1367
166 Ga0439445_0070028 3300042004 Bacteria 969
167 Ga0495592_0086054 3300046454 Bacteria 2265
168 Ga0495582_0202624 3300046473 Bacteria 1133
169 Ga0495587_0175049 3300046536 Bacteria 1218
170 Ga0495645_0186190 3300046543 Bacteria 1418
171 Ga0495599_0027900 3300046678 Bacteria 3537
172 Ga0495658_0093891 3300046683 Bacteria 1781
173 Ga0495680_0403070 3300047322 Bacteria 944
174 Ga0495684_0141182 3300047471 Bacteria 1806
175 Ga0495684_0185822 3300047471 Bacteria 1539
176 Ga0495684_0230473 3300047471 Bacteria 1355
177 Ga0496106_0079175 3300048909 Bacteria 2523
178 Ga0496107_0413650 3300048910 Bacteria 1003
179 Ga0496109_0089573 3300048912 Bacteria 2845
180 Ga0496109_0551821 3300048912 Bacteria 1087
181 Ga0496112_0060005 3300048915 Bacteria 3748
182 Ga0501040_0174127 3300049576 Bacteria 1524
183 Ga0501041_0118070 3300049577 Bacteria 1647
184 Ga0501046_0088563 3300049580 Bacteria 2384
185 Ga0501048_0224767 3300049582 Bacteria 1332
186 Ga0501067_0069260 3300049583 Bacteria 1953
187 Ga0501067_0116155 3300049583 Unclassified 1488
188 Ga0501070_0172804 3300049586 Bacteria 1780
189 Ga0501072_0102628 3300049588 Bacteria 2273
190 Ga0501075_0020784 3300049591 Bacteria 4778
191 Ga0501075_0326151 3300049591 Bacteria 1170
192 Ga0501079_0049251 3300049741 Bacteria 3252
193 Ga0501045_0020469 3300049824 Bacteria 4725
194 Ga0501045_0543558 3300049824 Bacteria 862
195 nmdc:mga03683_1850_c1 3300050489 Bacteria 6429
196 nmdc:mga00v17_4706_c1 3300050491 Bacteria 7130
197 nmdc:mga0yw44_13571_c1 3300050492 Bacteria 4294
198 nmdc:mga0k408_32801_c1 3300050493 Bacteria 2967
199 nmdc:mga0k408_74271_c1 3300050493 Bacteria 1986
200 nmdc:mga0k408_8825_c1 3300050493 Bacteria 4877
201 nmdc:mga06z11_14095_c1 3300050494 Bacteria 3531
202 nmdc:mga04h51_57763_c1 3300050495 Bacteria 1321
203 nmdc:mga05p37_21_c1 3300050507 Bacteria 122678
204 nmdc:mga05p37_458962_c1 3300050507 Bacteria 1473
205 nmdc:mga09592_125787_c2 3300050508 Unclassified 1147
206 nmdc:mga09592_23432_c1 3300050508 Bacteria 5099
207 nmdc:mga0qj67_7032_c1 3300050509 Bacteria 8297
208 nmdc:mga06r32_219350_c1 3300050510 Bacteria 1890
209 nmdc:mga06r32_27405_c1 3300050510 Bacteria 5322
210 nmdc:mga06r32_51819_c1 3300050510 Bacteria 3929
211 nmdc:mga08y16_102488_c1 3300050511 Bacteria 2980
212 nmdc:mga08y16_1942_c1 3300050511 Bacteria 21101
213 nmdc:mga08y16_314896_c1 3300050511 Bacteria 1611
214 nmdc:mga08y16_323374_c1 3300050511 Bacteria 1588
215 nmdc:mga08y16_443595_c1 3300050511 Bacteria 1324
216 nmdc:mga08y16_44509_c1 3300050511 Bacteria 4650
217 nmdc:mga08y16_63157_c1 3300050511 Bacteria 3867
218 nmdc:mga0n895_163583_c1 3300050512 Bacteria 2257
219 nmdc:mga0n895_37890_c1 3300050512 Bacteria 4668
220 nmdc:mga0rr50_164394_c1 3300050513 Bacteria 1803
221 nmdc:mga0rr50_46092_c1 3300050513 Bacteria 3209
222 nmdc:mga0a205_84005_c1 3300050515 Unclassified 3075
223 Ga0495601_0044334 3300053077 Bacteria 2796
224 Ga0501084_0161244 3300054114 Bacteria 1892
225 Ga0265340_10181548
226 Ga0065712_10099859
227 Ga0065715_10041363
228 Ga0065715_10239478
229 Ga0065715_10279674
230 Ga0070683_100021775
231 Ga0070690_100147241
232 Ga0070670_100001808
233 Ga0070670_100020773
234 Ga0068869_100017989
235 Ga0070666_10149396
236 Ga0068868_100285282
237 Ga0070689_100056779
238 Ga0070689_100198035
239 Ga0070687_100055539
240 Ga0070661_100471384
241 Ga0070668_100122126
242 Ga0070669_100042817
243 Ga0070669_100286668
244 Ga0070675_100098574
245 Ga0070675_100195102
246 Ga0070675_100359966
247 Ga0070674_100032654
248 Ga0070674_100084761
249 Ga0070688_100127608
250 Ga0070688_100221343
251 Ga0070659_100039807
252 Ga0070667_100058097
253 Ga0070713_100031330
254 Ga0070701_10080865
255 Ga0070700_100322726
256 Ga0070662_100374991
257 Ga0068867_100007269
258 Ga0070699_100058332
259 Ga0070672_100343764
260 Ga0070686_100116229
261 Ga0070696_100273229
262 Ga0070704_100059724
263 Ga0070664_100165748
264 Ga0070664_100454065
265 Ga0068857_100000620
266 Ga0070702_100015240
267 Ga0068859_100088068
268 Ga0068866_10098529
269 Ga0068861_100309673
270 Ga0068861_100335468
271 Ga0068863_100527078
272 Ga0068860_100250583
273 Ga0068862_100404393
274 Ga0070717_10345065
275 Ga0070717_10372519
276 Ga0075364_10006468
277 Ga0075364_10042809
278 Ga0070715_10108068
279 Ga0075362_10000275
280 Ga0075367_10005727
281 Ga0075367_10016219
282 Ga0075366_10044104
283 Ga0075366_10325489
284 Ga0075428_100027086
285 Ga0075428_100141799
286 Ga0075428_100356129
287 Ga0075431_100030496
288 Ga0075431_100213400
289 Ga0075434_100523329
290 Ga0075429_100038898
291 Ga0068865_100101228
292 Ga0097620_100088069
293 Ga0075435_100002471
294 Ga0105240_10348558
295 Ga0111539_10059341
296 Ga0111539_10282167
297 Ga0111539_10630331
298 Ga0105245_10822690
299 Ga0114129_10000138
300 Ga0114129_10009181
301 Ga0114129_10927946
302 Ga0105243_10055899
303 Ga0105241_10160886
304 Ga0105242_10079710
305 Ga0105248_10063507
306 Ga0105248_10158872
307 Ga0105248_10348062
308 Ga0105248_10556273
309 Ga0105249_10027723
310 Ga0105249_10078485
311 Ga0105239_10432393
312 Ga0163162_10028856
313 Ga0163163_10092993
314 Ga0163163_10340962
315 Ga0157380_10051524
316 Ga0157376_10053383
317 Ga0207697_10078759
318 Ga0207642_10012433
319 Ga0207685_10090660
320 Ga0207645_10014108
321 Ga0207654_10070611
322 Ga0207695_10249202
323 Ga0207662_10003112
324 Ga0207681_10057371
325 Ga0207681_10138474
326 Ga0207681_10183035
327 Ga0207650_10031121
328 Ga0207650_10034386
329 Ga0207659_10052354
330 Ga0207659_10575937
331 Ga0207687_10049208
332 Ga0207700_10105648
333 Ga0207644_10352370
334 Ga0207706_10194132
335 Ga0207670_10045784
336 Ga0207670_10205843
337 Ga0207691_10052248
338 Ga0207711_10007673
339 Ga0207711_10103664
340 Ga0207689_10053488
341 Ga0207661_10024186
342 Ga0207679_10246699
343 Ga0207679_10331200
344 Ga0207651_10004342
345 Ga0207712_10015113
346 Ga0207658_10201952
347 Ga0207677_10060768
348 Ga0207703_10821142
349 Ga0207708_10169169
350 Ga0207641_10094354
351 Ga0207641_10159978
352 Ga0207641_10479824
353 Ga0207648_10003828
354 Ga0207676_10144575
355 Ga0207674_10001555
356 Ga0207675_100019151
357 Ga0207675_100038438
358 Ga0207428_10007471
359 Ga0207428_10019052
360 Ga0207428_10066116
361 Ga0207428_10189409
362 Ga0268265_10533403
363 Ga0268264_10096159
364 Ga0265339_10006816
365 Ga0307408_100161063
366 Ga0307406_10283870
367 Ga0307412_10109791
368 Ga0307416_100142388
369 Ga0307416_100342106
370 Ga0307411_10191057
371 Ga0307411_10212935
372 Ga0307415_100131405
373 Ga0373952_0053945
374 Ga0373957_0072928
375 Ga0373943_0013540
376 Ga0373955_0215277
377 Ga0373942_0030532
378 Ga0373931_0181378
379 Ga0373933_0009114
380 Ga0373933_0083933
381 Ga0373947_0048035
382 Ga0373925_0021778
383 Ga0373925_0349898
384 Ga0439439_0008698
385 Ga0439439_0034950
386 Ga0439439_0063511
387 Ga0439431_0003599
388 Ga0439431_0044010
389 Ga0439433_0024215
390 Ga0439445_0070028
391 Ga0495592_0086054
392 Ga0495582_0202624
393 Ga0495587_0175049
394 Ga0495645_0186190
395 Ga0495599_0027900
396 Ga0495658_0093891
397 Ga0495680_0403070
398 Ga0495684_0141182
399 Ga0495684_0185822
400 Ga0495684_0230473
401 Ga0496106_0079175
402 Ga0496107_0413650
403 Ga0496109_0089573
404 Ga0496109_0551821
405 Ga0496112_0060005
406 Ga0501040_0174127
407 Ga0501041_0118070
408 Ga0501046_0088563
409 Ga0501048_0224767
410 Ga0501067_0069260
411 Ga0501067_0116155
412 Ga0501070_0172804
413 Ga0501072_0102628
414 Ga0501075_0020784
415 Ga0501075_0326151
416 Ga0501079_0049251
417 Ga0501045_0020469
418 Ga0501045_0543558
419 nmdc:mga03683_1850_c1
420 nmdc:mga00v17_4706_c1
421 nmdc:mga0yw44_13571_c1
422 nmdc:mga0k408_32801_c1
423 nmdc:mga0k408_74271_c1
424 nmdc:mga0k408_8825_c1
425 nmdc:mga06z11_14095_c1
426 nmdc:mga04h51_57763_c1
427 nmdc:mga05p37_21_c1
428 nmdc:mga05p37_458962_c1
429 nmdc:mga09592_125787_c2
430 nmdc:mga09592_23432_c1
431 nmdc:mga0qj67_7032_c1
432 nmdc:mga06r32_219350_c1
433 nmdc:mga06r32_27405_c1
434 nmdc:mga06r32_51819_c1
435 nmdc:mga08y16_102488_c1
436 nmdc:mga08y16_1942_c1
437 nmdc:mga08y16_314896_c1
438 nmdc:mga08y16_323374_c1
439 nmdc:mga08y16_443595_c1
440 nmdc:mga08y16_44509_c1
441 nmdc:mga08y16_63157_c1
442 nmdc:mga0n895_163583_c1
443 nmdc:mga0n895_37890_c1
444 nmdc:mga0rr50_164394_c1
445 nmdc:mga0rr50_46092_c1
446 nmdc:mga0a205_84005_c1
447 Ga0495601_0044334
448 Ga0501084_0161244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

10

202

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

251

0.95

PF08659

KR

KR domain

10

176

0.8

PF23441

4

254

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9624 8 251
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9602 7 251
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9597 5 251
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9567 8 251
1w8d-assembly1.cif.gz_A binary structure of human decr. 0.9564 1 251
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9698 8 90 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 7 251 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 8 251 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 6 251 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 5 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0N7ZCG0-F1-model_v4 2,4-dienoyl-CoA reductase, mitochondrial 0.9674 1 245 GO:0005739
GO:0006635
GO:0008670
AF-A0A538HI56-F1-model_v4 SDR family oxidoreductase 0.9673 1 251 GO:0005777
GO:0006633
GO:0008670
GO:0009062
AF-R7UPX8-F1-model_v4 Uncharacterized protein 0.9668 1 249 GO:0005739
GO:0006635
GO:0008670
AF-H3ALC9-F1-model_v4 2,4-dienoyl-CoA reductase 1 0.9668 1 248 GO:0005739
GO:0006635
GO:0008670
AF-A0A5F5XJM0-F1-model_v4 2,4-dienoyl-CoA reductase 1 0.9657 1 249 GO:0005654
GO:0005739
GO:0005829
GO:0006635
GO:0008670
GO:0042802
GO:0070402
GO:0120162
GO:1902494

Map