F336366

General Info

Members Datasets Scaffolds Average Seq Length
224 144 448 266

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100061741|Ga0070668_1000617413
Length 284
Sequence LDRSDKRRLSVSLIDLSEGHETEFDTISTHFQALLLRKEYGRAELFRDEGSPLRFYSIRYWASASAAEQCHRDAEVQMLTARLYQISRVTHVVNGVRRQDAVRRLLDERRARIEADRRTGFDRRVVNLGRPEGDRRKNXXXLGPRRVRDSAGEVDLVAAARRAREHADAAFSQFRVGAALETGDGTIITGCNIENATYGLTICAERVAMFKALSEGHRVFMRLAIVADTEAPTPPCGACRQVLWEFGGNLEIQLANLQEEKGTHQLKDLLPLPFDARLLERRTL

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.34
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100061741 3300005347 Bacteria 2904
2 Ga0070676_10056175 3300005328 Bacteria 2325
3 Ga0070676_10292680 3300005328 Unclassified 1101
4 Ga0068869_100230983 3300005334 Bacteria 1470
5 Ga0068868_100114768 3300005338 Bacteria 2192
6 Ga0070660_100018033 3300005339 Bacteria 5150
7 Ga0070691_10006403 3300005341 Bacteria 5382
8 Ga0070668_100325242 3300005347 Bacteria 1295
9 Ga0070669_100036119 3300005353 Bacteria 3579
10 Ga0070671_100171235 3300005355 Bacteria 1836
11 Ga0070674_100079803 3300005356 Bacteria 2335
12 Ga0070674_100159427 3300005356 Bacteria 1710
13 Ga0070673_100023425 3300005364 Bacteria 4511
14 Ga0070673_100161204 3300005364 Bacteria 1908
15 Ga0070673_100517457 3300005364 Bacteria 1081
16 Ga0070667_100011404 3300005367 Bacteria 7351
17 Ga0070709_10039589 3300005434 Bacteria 2893
18 Ga0070714_100033508 3300005435 Bacteria 4294
19 Ga0070701_10020515 3300005438 Bacteria 3140
20 Ga0070701_10292383 3300005438 Bacteria 999
21 Ga0070711_100134203 3300005439 Bacteria 1848
22 Ga0070700_100001552 3300005441 Bacteria 11445
23 Ga0070694_100546509 3300005444 Bacteria 927
24 Ga0070681_10358209 3300005458 Bacteria 1369
25 Ga0068867_100079985 3300005459 Bacteria 2460
26 Ga0070707_100194734 3300005468 Bacteria 1976
27 Ga0070699_100038072 3300005518 Bacteria 4164
28 Ga0070699_100133264 3300005518 Bacteria 2191
29 Ga0070697_100024964 3300005536 Bacteria 4763
30 Ga0070672_100068930 3300005543 Bacteria 2806
31 Ga0070695_100008553 3300005545 Bacteria 6079
32 Ga0070696_100159234 3300005546 Bacteria 1662
33 Ga0070665_100005814 3300005548 Bacteria 12650
34 Ga0068859_100089666 3300005617 Bacteria 3126
35 Ga0068859_100288451 3300005617 Unclassified 1734
36 Ga0068864_100088621 3300005618 Bacteria 2726
37 Ga0068866_10047040 3300005718 Bacteria 2173
38 Ga0068861_100064159 3300005719 Bacteria 2825
39 Ga0068863_100010930 3300005841 Bacteria 8802
40 Ga0068863_100689922 3300005841 Bacteria 1015
41 Ga0068858_100081943 3300005842 Bacteria 2999
42 Ga0068858_100139879 3300005842 Bacteria 2272
43 Ga0068860_100071145 3300005843 Bacteria 3306
44 Ga0068862_100013462 3300005844 Bacteria 6771
45 Ga0068862_100093138 3300005844 Bacteria 2627
46 Ga0081455_10116063 3300005937 Bacteria 2118
47 Ga0097621_100033234 3300006237 Bacteria 4106
48 Ga0068871_100016537 3300006358 Bacteria 5561
49 Ga0068871_100446470 3300006358 Bacteria 1158
50 Ga0075433_10088492 3300006852 Bacteria 2736
51 Ga0075433_10151314 3300006852 Bacteria 2064
52 Ga0075434_100208057 3300006871 Bacteria 1977
53 Ga0068865_100011211 3300006881 Bacteria 5603
54 Ga0075436_100036552 3300006914 Bacteria 3389
55 Ga0075436_100124085 3300006914 Bacteria 1808
56 Ga0075436_100169234 3300006914 Unclassified 1543
57 Ga0075436_100430022 3300006914 Bacteria 959
58 Ga0097620_100089666 3300006931 Bacteria 3126
59 Ga0097620_100288411 3300006931 Unclassified 1734
60 Ga0075435_100019938 3300007076 Bacteria 5126
61 Ga0075435_100051172 3300007076 Bacteria 3327
62 Ga0075435_100121002 3300007076 Bacteria 2184
63 Ga0105240_10030800 3300009093 Bacteria 6970
64 Ga0105240_10067169 3300009093 Bacteria 4445
65 Ga0105240_10716201 3300009093 Bacteria 1091
66 Ga0111539_10002905 3300009094 Bacteria 22739
67 Ga0105245_10007675 3300009098 Bacteria 9449
68 Ga0105247_10066397 3300009101 Bacteria 2246
69 Ga0105247_10186137 3300009101 Unclassified 1388
70 Ga0114129_10000735 3300009147 Bacteria 41688
71 Ga0114129_10001613 3300009147 Bacteria 30618
72 Ga0114129_10002451 3300009147 Bacteria 25770
73 Ga0114129_10004433 3300009147 Bacteria 19821
74 Ga0114129_10330613 3300009147 Bacteria 2024
75 Ga0114129_10559245 3300009147 Bacteria 1486
76 Ga0105243_10114310 3300009148 Bacteria 2265
77 Ga0105242_10023500 3300009176 Bacteria 4857
78 Ga0105242_10048584 3300009176 Bacteria 3449
79 Ga0105242_10275885 3300009176 Bacteria 1525
80 Ga0105248_10015908 3300009177 Bacteria 8285
81 Ga0105248_10079873 3300009177 Bacteria 3676
82 Ga0105248_10373910 3300009177 Bacteria 1604
83 Ga0105249_10068720 3300009553 Bacteria 3268
84 Ga0105249_10402788 3300009553 Bacteria 1399
85 Ga0157374_10016104 3300013296 Bacteria 6569
86 Ga0163162_10041237 3300013306 Bacteria 4618
87 Ga0163162_10233993 3300013306 Bacteria 1968
88 Ga0157372_10185388 3300013307 Bacteria 2410
89 Ga0157372_10795039 3300013307 Unclassified 1099
90 Ga0157375_10280081 3300013308 Bacteria 1831
91 Ga0157375_10700429 3300013308 Bacteria 1166
92 Ga0163163_10804184 3300014325 Bacteria 1004
93 Ga0157380_10159609 3300014326 Bacteria 1958
94 Ga0157380_10516096 3300014326 Bacteria 1164
95 Ga0157379_10003571 3300014968 Bacteria 13177
96 Ga0157379_10035801 3300014968 Bacteria 4426
97 Ga0157379_10050428 3300014968 Bacteria 3715
98 Ga0157379_10071901 3300014968 Bacteria 3094
99 Ga0157376_10037157 3300014969 Bacteria 3950
100 Ga0157376_10062604 3300014969 Bacteria 3131
101 Ga0157376_10340957 3300014969 Bacteria 1431
102 Ga0163161_10346017 3300017792 Bacteria 1180
103 Ga0213876_10061768 3300021384 Bacteria 1977
104 Ga0207642_10046113 3300025899 Bacteria 1940
105 Ga0207680_10318986 3300025903 Bacteria 1086
106 Ga0207645_10049587 3300025907 Bacteria 2681
107 Ga0207684_10138052 3300025910 Bacteria 2094
108 Ga0207684_10139146 3300025910 Bacteria 2086
109 Ga0207707_10138400 3300025912 Bacteria 2129
110 Ga0207695_10051043 3300025913 Bacteria 4346
111 Ga0207695_10053681 3300025913 Bacteria 4213
112 Ga0207657_10008271 3300025919 Bacteria 10590
113 Ga0207652_10194570 3300025921 Bacteria 1824
114 Ga0207646_10113492 3300025922 Bacteria 2433
115 Ga0207681_10168648 3300025923 Bacteria 1657
116 Ga0207644_10022849 3300025931 Bacteria 4276
117 Ga0207706_10198412 3300025933 Bacteria 1760
118 Ga0207686_10006970 3300025934 Bacteria 6084
119 Ga0207686_10052702 3300025934 Bacteria 2541
120 Ga0207709_10047083 3300025935 Bacteria 2620
121 Ga0207669_10035790 3300025937 Bacteria 2829
122 Ga0207704_10013287 3300025938 Bacteria 4115
123 Ga0207691_10009414 3300025940 Bacteria 9383
124 Ga0207691_10103542 3300025940 Bacteria 2538
125 Ga0207711_10015349 3300025941 Bacteria 6357
126 Ga0207711_10204626 3300025941 Bacteria 1802
127 Ga0207711_10341612 3300025941 Bacteria 1386
128 Ga0207679_10413537 3300025945 Unclassified 1189
129 Ga0207667_10373885 3300025949 Bacteria 1452
130 Ga0207651_10019234 3300025960 Bacteria 4086
131 Ga0207651_10389384 3300025960 Bacteria 1183
132 Ga0207712_10095265 3300025961 Bacteria 2201
133 Ga0207668_10021088 3300025972 Bacteria 4152
134 Ga0207668_10087934 3300025972 Bacteria 2274
135 Ga0207640_10404671 3300025981 Bacteria 1112
136 Ga0207658_10012493 3300025986 Bacteria 5801
137 Ga0207677_10067555 3300026023 Bacteria 2505
138 Ga0207677_10139831 3300026023 Bacteria 1852
139 Ga0207677_10220341 3300026023 Bacteria 1521
140 Ga0207703_10042456 3300026035 Bacteria 3648
141 Ga0207703_10622314 3300026035 Bacteria 1022
142 Ga0207708_10030567 3300026075 Bacteria 4084
143 Ga0207708_10254241 3300026075 Bacteria 1417
144 Ga0207641_10001002 3300026088 Bacteria 28866
145 Ga0207648_10039024 3300026089 Bacteria 4177
146 Ga0207676_10091602 3300026095 Bacteria 2498
147 Ga0207675_100005220 3300026118 Bacteria 12502
148 Ga0207675_100218787 3300026118 Bacteria 1834
149 Ga0207675_100419476 3300026118 Bacteria 1321
150 Ga0207683_10083477 3300026121 Bacteria 2839
151 Ga0207428_10002266 3300027907 Bacteria 19315
152 Ga0207428_10037229 3300027907 Bacteria 3960
153 Ga0268266_10051373 3300028379 Bacteria 3538
154 Ga0268266_10225141 3300028379 Bacteria 1725
155 Ga0268265_10022920 3300028380 Bacteria 4394
156 Ga0268265_10164538 3300028380 Bacteria 1889
157 Ga0268265_10414889 3300028380 Bacteria 1248
158 Ga0268264_10055565 3300028381 Bacteria 3309
159 Ga0268264_10138670 3300028381 Bacteria 2166
160 Ga0265332_10070447 3300031238 Bacteria 1490
161 Ga0265314_10038196 3300031711 Bacteria 3472
162 Ga0265314_10068499 3300031711 Bacteria 2385
163 Ga0307405_10324838 3300031731 Bacteria 1177
164 Ga0373932_0034881 3300035112 Bacteria 1420
165 Ga0373936_0150560 3300035113 Unclassified 1009
166 Ga0373941_0014468 3300035115 Bacteria 2109
167 Ga0373945_0044247 3300035116 Bacteria 1618
168 Ga0373945_0067081 3300035116 Bacteria 1350
169 Ga0373956_0057680 3300035119 Bacteria 1755
170 Ga0373943_0005343 3300035170 Bacteria 5777
171 Ga0373946_0001665 3300035171 Bacteria 7736
172 Ga0373955_0032522 3300035172 Bacteria 2739
173 Ga0373962_0030051 3300035242 Bacteria 1485
174 Ga0373924_0013864 3300035410 Bacteria 3035
175 Ga0373935_0025935 3300035692 Bacteria 3613
176 Ga0373935_0343364 3300035692 Bacteria 1063
177 Ga0373947_0003573 3300035725 Bacteria 9174
178 Ga0373937_0133282 3300036401 Bacteria 2322
179 Ga0373937_0176766 3300036401 Bacteria 2004
180 Ga0373937_0214613 3300036401 Bacteria 1811
181 Ga0373925_0004883 3300037068 Bacteria 10089
182 Ga0373925_0127578 3300037068 Bacteria 1981
183 Ga0436365_0514081 3300039437 Bacteria 4144
184 Ga0436365_0704160 3300039437 Bacteria 1173
185 Ga0451576_0071860 3300045051 Bacteria 3601
186 Ga0451576_0097595 3300045051 Bacteria 3056
187 Ga0495664_0048705 3300046477 Bacteria 2516
188 Ga0495630_0017576 3300046517 Bacteria 5241
189 Ga0495640_0276267 3300046533 Bacteria 1047
190 Ga0495586_0029920 3300046535 Bacteria 2915
191 Ga0495587_0110421 3300046536 Bacteria 1580
192 Ga0495645_0000776 3300046543 Bacteria 21886
193 Ga0495656_0156465 3300046615 Bacteria 1105
194 Ga0495635_0063030 3300046663 Bacteria 2546
195 Ga0495647_0052946 3300046681 Bacteria 1582
196 Ga0495669_0056700 3300046684 Bacteria 1766
197 Ga0495613_0004322 3300046689 Bacteria 10638
198 Ga0495613_0035545 3300046689 Bacteria 3697
199 Ga0495581_0094261 3300047315 Bacteria 1738
200 Ga0495604_0026655 3300047317 Bacteria 4600
201 Ga0495674_0189396 3300047319 Unclassified 1710
202 Ga0495684_0000131 3300047471 Bacteria 54636
203 Ga0496102_0297909 3300048905 Bacteria 1520
204 Ga0496113_0088306 3300048916 Bacteria 2385
205 Ga0496115_0045993 3300048918 Bacteria 3486
206 nmdc:mga05p37_129633_c1 3300050507 Bacteria 3095
207 nmdc:mga05p37_259446_c1 3300050507 Bacteria 2081
208 nmdc:mga05p37_26681_c1 3300050507 Bacteria 7025
209 nmdc:mga05p37_3007_c1 3300050507 Bacteria 19562
210 nmdc:mga05p37_322195_c1 3300050507 Bacteria 1829
211 nmdc:mga05p37_41401_c1 3300050507 Bacteria 5656
212 nmdc:mga09592_144831_c1 3300050508 Bacteria 2048
213 nmdc:mga08y16_11374_c1 3300050511 Bacteria 9351
214 nmdc:mga08y16_3957_c1 3300050511 Bacteria 15430
215 nmdc:mga0n895_105930_c1 3300050512 Bacteria 2825
216 nmdc:mga0n895_220937_c1 3300050512 Bacteria 1923
217 nmdc:mga0n895_744089_c1 3300050512 Bacteria 974
218 nmdc:mga0rr50_68559_c1 3300050513 Bacteria 2698
219 nmdc:mga08x19_151992_c1 3300050514 Unclassified 1568
220 nmdc:mga08x19_4640_c1 3300050514 Bacteria 8154
221 nmdc:mga0a205_122177_c1 3300050515 Bacteria 2504
222 nmdc:mga0a205_391880_c1 3300050515 Bacteria 1253
223 Ga0495601_0024761 3300053077 Bacteria 3696
224 Ga0495601_0046988 3300053077 Bacteria 2717
225 Ga0070668_100061741
226 Ga0070676_10056175
227 Ga0070676_10292680
228 Ga0068869_100230983
229 Ga0068868_100114768
230 Ga0070660_100018033
231 Ga0070691_10006403
232 Ga0070668_100325242
233 Ga0070669_100036119
234 Ga0070671_100171235
235 Ga0070674_100079803
236 Ga0070674_100159427
237 Ga0070673_100023425
238 Ga0070673_100161204
239 Ga0070673_100517457
240 Ga0070667_100011404
241 Ga0070709_10039589
242 Ga0070714_100033508
243 Ga0070701_10020515
244 Ga0070701_10292383
245 Ga0070711_100134203
246 Ga0070700_100001552
247 Ga0070694_100546509
248 Ga0070681_10358209
249 Ga0068867_100079985
250 Ga0070707_100194734
251 Ga0070699_100038072
252 Ga0070699_100133264
253 Ga0070697_100024964
254 Ga0070672_100068930
255 Ga0070695_100008553
256 Ga0070696_100159234
257 Ga0070665_100005814
258 Ga0068859_100089666
259 Ga0068859_100288451
260 Ga0068864_100088621
261 Ga0068866_10047040
262 Ga0068861_100064159
263 Ga0068863_100010930
264 Ga0068863_100689922
265 Ga0068858_100081943
266 Ga0068858_100139879
267 Ga0068860_100071145
268 Ga0068862_100013462
269 Ga0068862_100093138
270 Ga0081455_10116063
271 Ga0097621_100033234
272 Ga0068871_100016537
273 Ga0068871_100446470
274 Ga0075433_10088492
275 Ga0075433_10151314
276 Ga0075434_100208057
277 Ga0068865_100011211
278 Ga0075436_100036552
279 Ga0075436_100124085
280 Ga0075436_100169234
281 Ga0075436_100430022
282 Ga0097620_100089666
283 Ga0097620_100288411
284 Ga0075435_100019938
285 Ga0075435_100051172
286 Ga0075435_100121002
287 Ga0105240_10030800
288 Ga0105240_10067169
289 Ga0105240_10716201
290 Ga0111539_10002905
291 Ga0105245_10007675
292 Ga0105247_10066397
293 Ga0105247_10186137
294 Ga0114129_10000735
295 Ga0114129_10001613
296 Ga0114129_10002451
297 Ga0114129_10004433
298 Ga0114129_10330613
299 Ga0114129_10559245
300 Ga0105243_10114310
301 Ga0105242_10023500
302 Ga0105242_10048584
303 Ga0105242_10275885
304 Ga0105248_10015908
305 Ga0105248_10079873
306 Ga0105248_10373910
307 Ga0105249_10068720
308 Ga0105249_10402788
309 Ga0157374_10016104
310 Ga0163162_10041237
311 Ga0163162_10233993
312 Ga0157372_10185388
313 Ga0157372_10795039
314 Ga0157375_10280081
315 Ga0157375_10700429
316 Ga0163163_10804184
317 Ga0157380_10159609
318 Ga0157380_10516096
319 Ga0157379_10003571
320 Ga0157379_10035801
321 Ga0157379_10050428
322 Ga0157379_10071901
323 Ga0157376_10037157
324 Ga0157376_10062604
325 Ga0157376_10340957
326 Ga0163161_10346017
327 Ga0213876_10061768
328 Ga0207642_10046113
329 Ga0207680_10318986
330 Ga0207645_10049587
331 Ga0207684_10138052
332 Ga0207684_10139146
333 Ga0207707_10138400
334 Ga0207695_10051043
335 Ga0207695_10053681
336 Ga0207657_10008271
337 Ga0207652_10194570
338 Ga0207646_10113492
339 Ga0207681_10168648
340 Ga0207644_10022849
341 Ga0207706_10198412
342 Ga0207686_10006970
343 Ga0207686_10052702
344 Ga0207709_10047083
345 Ga0207669_10035790
346 Ga0207704_10013287
347 Ga0207691_10009414
348 Ga0207691_10103542
349 Ga0207711_10015349
350 Ga0207711_10204626
351 Ga0207711_10341612
352 Ga0207679_10413537
353 Ga0207667_10373885
354 Ga0207651_10019234
355 Ga0207651_10389384
356 Ga0207712_10095265
357 Ga0207668_10021088
358 Ga0207668_10087934
359 Ga0207640_10404671
360 Ga0207658_10012493
361 Ga0207677_10067555
362 Ga0207677_10139831
363 Ga0207677_10220341
364 Ga0207703_10042456
365 Ga0207703_10622314
366 Ga0207708_10030567
367 Ga0207708_10254241
368 Ga0207641_10001002
369 Ga0207648_10039024
370 Ga0207676_10091602
371 Ga0207675_100005220
372 Ga0207675_100218787
373 Ga0207675_100419476
374 Ga0207683_10083477
375 Ga0207428_10002266
376 Ga0207428_10037229
377 Ga0268266_10051373
378 Ga0268266_10225141
379 Ga0268265_10022920
380 Ga0268265_10164538
381 Ga0268265_10414889
382 Ga0268264_10055565
383 Ga0268264_10138670
384 Ga0265332_10070447
385 Ga0265314_10038196
386 Ga0265314_10068499
387 Ga0307405_10324838
388 Ga0373932_0034881
389 Ga0373936_0150560
390 Ga0373941_0014468
391 Ga0373945_0044247
392 Ga0373945_0067081
393 Ga0373956_0057680
394 Ga0373943_0005343
395 Ga0373946_0001665
396 Ga0373955_0032522
397 Ga0373962_0030051
398 Ga0373924_0013864
399 Ga0373935_0025935
400 Ga0373935_0343364
401 Ga0373947_0003573
402 Ga0373937_0133282
403 Ga0373937_0176766
404 Ga0373937_0214613
405 Ga0373925_0004883
406 Ga0373925_0127578
407 Ga0436365_0514081
408 Ga0436365_0704160
409 Ga0451576_0071860
410 Ga0451576_0097595
411 Ga0495664_0048705
412 Ga0495630_0017576
413 Ga0495640_0276267
414 Ga0495586_0029920
415 Ga0495587_0110421
416 Ga0495645_0000776
417 Ga0495656_0156465
418 Ga0495635_0063030
419 Ga0495647_0052946
420 Ga0495669_0056700
421 Ga0495613_0004322
422 Ga0495613_0035545
423 Ga0495581_0094261
424 Ga0495604_0026655
425 Ga0495674_0189396
426 Ga0495684_0000131
427 Ga0496102_0297909
428 Ga0496113_0088306
429 Ga0496115_0045993
430 nmdc:mga05p37_129633_c1
431 nmdc:mga05p37_259446_c1
432 nmdc:mga05p37_26681_c1
433 nmdc:mga05p37_3007_c1
434 nmdc:mga05p37_322195_c1
435 nmdc:mga05p37_41401_c1
436 nmdc:mga09592_144831_c1
437 nmdc:mga08y16_11374_c1
438 nmdc:mga08y16_3957_c1
439 nmdc:mga0n895_105930_c1
440 nmdc:mga0n895_220937_c1
441 nmdc:mga0n895_744089_c1
442 nmdc:mga0rr50_68559_c1
443 nmdc:mga08x19_151992_c1
444 nmdc:mga08x19_4640_c1
445 nmdc:mga0a205_122177_c1
446 nmdc:mga0a205_391880_c1
447 Ga0495601_0024761
448 Ga0495601_0046988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

153

252

0.84

Map