F336255

General Info

Members Datasets Scaffolds Average Seq Length
224 171 224 121

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10002650|JGI25404J52841_100026502
Length 132
Sequence MATGVGIDLLEIERMERALERHPRIXXXVFTAGEREYAAAKARPGRHLAARFAAKEAVVKALGLRGGFGLREIEVVAGEPPTVRLSGRAAEAAEGRTVEISLTHSRDNAAAVAIVSSVDTGLRSASAGGDPR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
112 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 5.8
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10002650 3300003659 Bacteria 3416
2 Ga0070658_10027408 3300005327 Bacteria 4572
3 Ga0070683_100034921 3300005329 Bacteria 4596
4 Ga0070683_100070488 3300005329 Bacteria 3260
5 Ga0070677_10000028 3300005333 Bacteria 43011
6 Ga0070680_100063372 3300005336 Bacteria 3028
7 Ga0070682_100000389 3300005337 Bacteria 29231
8 Ga0068868_100000351 3300005338 Bacteria 31294
9 Ga0068868_100004841 3300005338 Bacteria 9451
10 Ga0070660_100001576 3300005339 Bacteria 15678
11 Ga0070689_100242672 3300005340 Bacteria 1484
12 Ga0070691_10213622 3300005341 Bacteria 1019
13 Ga0070661_100044018 3300005344 Bacteria 3261
14 Ga0070692_10001321 3300005345 Bacteria 8917
15 Ga0070692_10645033 3300005345 Bacteria 706
16 Ga0070668_100006626 3300005347 Bacteria 8582
17 Ga0070668_100079782 3300005347 Bacteria 2563
18 Ga0070675_100018927 3300005354 Bacteria 5485
19 Ga0070674_100008850 3300005356 Bacteria 6010
20 Ga0070673_100000987 3300005364 Bacteria 16156
21 Ga0070659_100003244 3300005366 Bacteria 11575
22 Ga0070667_100001110 3300005367 Bacteria 24556
23 Ga0070667_100227769 3300005367 Bacteria 1661
24 Ga0070700_100006209 3300005441 Bacteria 6368
25 Ga0070678_100374068 3300005456 Bacteria 1231
26 Ga0070662_100018250 3300005457 Bacteria 4744
27 Ga0068867_100038633 3300005459 Bacteria 3475
28 Ga0070685_10353059 3300005466 Bacteria 1006
29 Ga0070679_100110512 3300005530 Bacteria 2735
30 Ga0070684_100056461 3300005535 Bacteria 3427
31 Ga0070684_100226954 3300005535 Bacteria 1704
32 Ga0068853_100005538 3300005539 Bacteria 9905
33 Ga0070672_100008427 3300005543 Bacteria 7048
34 Ga0070686_100056131 3300005544 Bacteria 2525
35 Ga0070693_100000422 3300005547 Bacteria 19196
36 Ga0070693_100120229 3300005547 Bacteria 1628
37 Ga0070665_100167296 3300005548 Bacteria 2201
38 Ga0070665_100183023 3300005548 Bacteria 2096
39 Ga0070704_100141354 3300005549 Unclassified 1880
40 Ga0068855_100353202 3300005563 Bacteria 1619
41 Ga0070664_100354444 3300005564 Bacteria 1335
42 Ga0068857_100025757 3300005577 Bacteria 5179
43 Ga0068854_100016040 3300005578 Bacteria 4984
44 Ga0068854_100159191 3300005578 Bacteria 1747
45 Ga0068856_100147951 3300005614 Bacteria 2356
46 Ga0070702_100090805 3300005615 Bacteria 1852
47 Ga0068852_100015794 3300005616 Bacteria 5870
48 Ga0068861_100044491 3300005719 Bacteria 3339
49 Ga0068851_10036047 3300005834 Bacteria 2476
50 Ga0068858_100017985 3300005842 Bacteria 6620
51 Ga0068858_100121685 3300005842 Bacteria 2441
52 Ga0068860_100075328 3300005843 Bacteria 3210
53 Ga0068860_101028484 3300005843 Bacteria 842
54 Ga0068862_100002784 3300005844 Bacteria 15326
55 Ga0068862_100072221 3300005844 Bacteria 2981
56 Ga0081455_10006161 3300005937 Bacteria 12937
57 Ga0081455_10299738 3300005937 Unclassified 1154
58 Ga0081455_10625414 3300005937 Bacteria 698
59 Ga0081540_1000868 3300005983 Bacteria 27372
60 Ga0081540_1002322 3300005983 Bacteria 15589
61 Ga0075365_10140837 3300006038 Bacteria 1674
62 Ga0075363_100004498 3300006048 Bacteria 6112
63 Ga0075367_10303218 3300006178 Bacteria 1005
64 Ga0097621_100836805 3300006237 Bacteria 854
65 Ga0068871_101379557 3300006358 Bacteria 664
66 Ga0068865_100009667 3300006881 Bacteria 5982
67 Ga0111539_11858055 3300009094 Bacteria 698
68 Ga0105245_10000040 3300009098 Bacteria 144005
69 Ga0105245_10084453 3300009098 Bacteria 2909
70 Ga0105245_10086419 3300009098 Bacteria 2876
71 Ga0105243_10003860 3300009148 Bacteria 11970
72 Ga0105243_11716403 3300009148 Unclassified 657
73 Ga0105242_10000063 3300009176 Bacteria 74721
74 Ga0105242_10075804 3300009176 Bacteria 2801
75 Ga0105238_10000033 3300009551 Bacteria 172981
76 Ga0105238_10227718 3300009551 Bacteria 1841
77 Ga0105249_10000218 3300009553 Bacteria 65480
78 Ga0105249_10002088 3300009553 Bacteria 17318
79 Ga0105249_10021757 3300009553 Bacteria 5742
80 Ga0105239_10074998 3300010375 Bacteria 3719
81 Ga0157371_10208979 3300013102 Bacteria 1400
82 Ga0157372_10134485 3300013307 Bacteria 2847
83 Ga0157375_10071155 3300013308 Bacteria 3490
84 Ga0157380_10021985 3300014326 Bacteria 4792
85 Ga0157377_10004561 3300014745 Bacteria 6398
86 Ga0157379_10011282 3300014968 Bacteria 7788
87 Ga0157379_10026678 3300014968 Bacteria 5142
88 Ga0163161_10000064 3300017792 Bacteria 108508
89 Ga0207682_10000041 3300025893 Bacteria 52338
90 Ga0207642_10567653 3300025899 Bacteria 703
91 Ga0207705_10059362 3300025909 Bacteria 2761
92 Ga0207657_10003551 3300025919 Bacteria 16649
93 Ga0207649_10146298 3300025920 Bacteria 1622
94 Ga0207652_10167948 3300025921 Bacteria 1968
95 Ga0207694_10000012 3300025924 Bacteria 411218
96 Ga0207694_10335871 3300025924 Bacteria 1249
97 Ga0207659_10053199 3300025926 Bacteria 2887
98 Ga0207687_10000128 3300025927 Bacteria 50603
99 Ga0207687_10019939 3300025927 Bacteria 4447
100 Ga0207690_10003342 3300025932 Bacteria 9588
101 Ga0207706_10002862 3300025933 Bacteria 16746
102 Ga0207686_10000230 3300025934 Bacteria 42566
103 Ga0207709_10003188 3300025935 Bacteria 9853
104 Ga0207670_10013087 3300025936 Bacteria 4881
105 Ga0207704_10156626 3300025938 Bacteria 1615
106 Ga0207691_10005911 3300025940 Bacteria 11817
107 Ga0207661_10018028 3300025944 Bacteria 5241
108 Ga0207661_10092107 3300025944 Bacteria 2526
109 Ga0207712_10000027 3300025961 Bacteria 263739
110 Ga0207712_10002074 3300025961 Bacteria 13155
111 Ga0207668_10007058 3300025972 Bacteria 6663
112 Ga0207668_10019301 3300025972 Bacteria 4307
113 Ga0207668_10469644 3300025972 Unclassified 1077
114 Ga0207640_10011451 3300025981 Bacteria 5025
115 Ga0207658_10055741 3300025986 Bacteria 2930
116 Ga0207658_10316234 3300025986 Bacteria 1350
117 Ga0207677_10000304 3300026023 Bacteria 36147
118 Ga0207677_10052304 3300026023 Bacteria 2774
119 Ga0207703_10011408 3300026035 Bacteria 6910
120 Ga0207703_10859065 3300026035 Bacteria 868
121 Ga0207639_10017169 3300026041 Bacteria 5129
122 Ga0207678_10008086 3300026067 Bacteria 9274
123 Ga0207708_10001275 3300026075 Bacteria 18940
124 Ga0207702_10010263 3300026078 Bacteria 7846
125 Ga0207702_10451133 3300026078 Bacteria 1248
126 Ga0207641_10000062 3300026088 Bacteria 159982
127 Ga0207648_10211642 3300026089 Bacteria 1721
128 Ga0207674_10117797 3300026116 Bacteria 2626
129 Ga0207675_100009627 3300026118 Bacteria 9043
130 Ga0207683_10131609 3300026121 Bacteria 2250
131 Ga0268266_10018782 3300028379 Bacteria 5891
132 Ga0268266_10064575 3300028379 Bacteria 3163
133 Ga0268265_10161645 3300028380 Bacteria 1903
134 Ga0268265_10768488 3300028380 Bacteria 936
135 Ga0268264_10605351 3300028381 Bacteria 1080
136 Ga0268264_10993319 3300028381 Bacteria 846
137 Ga0316578_10318216 3300031728 Bacteria 929
138 Ga0307405_11027756 3300031731 Bacteria 705
139 Ga0316582_0346790 3300036647 Bacteria 1021
140 Ga0316584_0187068 3300036712 Bacteria 1532
141 Ga0395899_0745498 3300037312 Bacteria 610
142 Ga0395900_0112546 3300037418 Bacteria 2795
143 Ga0395900_0879710 3300037418 Bacteria 820
144 Ga0395900_1029247 3300037418 Unclassified 743
145 Ga0395898_0815092 3300037466 Bacteria 873
146 Ga0395898_1178608 3300037466 Bacteria 698
147 Ga0395905_0135035 3300037471 Bacteria 2321
148 Ga0395905_1866407 3300037471 Bacteria 507
149 Ga0395901_0080164 3300038443 Bacteria 3408
150 Ga0395901_0098829 3300038443 Bacteria 3060
151 Ga0451853_0991325 3300041512 Bacteria 705
152 Ga0450916_048938 3300042530 Bacteria 662
153 Ga0439440_0060416 3300042993 Bacteria 967
154 Ga0466963_0000141 3300044694 Bacteria 28151
155 Ga0466967_0999453 3300045976 Bacteria 833
156 Ga0495592_0000423 3300046454 Bacteria 32094
157 Ga0495592_0372049 3300046454 Bacteria 911
158 Ga0495603_0000343 3300046455 Bacteria 24991
159 Ga0495641_0000004 3300046461 Bacteria 210501
160 Ga0495641_0018661 3300046461 Bacteria 3574
161 Ga0495651_0247813 3300046462 Unclassified 1218
162 Ga0495653_0257369 3300046463 Bacteria 1156
163 Ga0495662_0000069 3300046476 Bacteria 36219
164 Ga0495664_0742428 3300046477 Bacteria 579
165 Ga0495607_0228697 3300046501 Bacteria 906
166 Ga0495608_0000754 3300046511 Bacteria 22642
167 Ga0495618_0132809 3300046514 Bacteria 1593
168 Ga0495618_0170134 3300046514 Bacteria 1387
169 Ga0495620_0000041 3300046515 Bacteria 112605
170 Ga0495628_0004134 3300046516 Bacteria 12910
171 Ga0495628_0006059 3300046516 Bacteria 10569
172 Ga0495628_0446023 3300046516 Bacteria 940
173 Ga0495628_0672523 3300046516 Bacteria 733
174 Ga0495630_0082874 3300046517 Unclassified 2421
175 Ga0495631_0423613 3300046518 Bacteria 567
176 Ga0495652_0005154 3300046529 Bacteria 12351
177 Ga0495587_0029139 3300046536 Bacteria 3353
178 Ga0495621_0120671 3300046539 Bacteria 1013
179 Ga0495645_0018934 3300046543 Bacteria 4952
180 Ga0495645_0060196 3300046543 Bacteria 2753
181 Ga0495599_0889079 3300046678 Bacteria 505
182 Ga0495647_0014446 3300046681 Bacteria 2751
183 Ga0495669_0000307 3300046684 Bacteria 26997
184 Ga0495613_0001225 3300046689 Bacteria 19608
185 Ga0495670_0676175 3300046691 Bacteria 563
186 Ga0495581_0047092 3300047315 Bacteria 2492
187 Ga0495676_0005983 3300047321 Bacteria 11177
188 Ga0495680_0011422 3300047322 Bacteria 7862
189 Ga0495680_0136086 3300047322 Bacteria 1801
190 Ga0495684_0618493 3300047471 Unclassified 729
191 Ga0495602_0004130 3300048088 Bacteria 15127
192 Ga0496100_0000024 3300048903 Bacteria 116138
193 Ga0496101_0000072 3300048904 Bacteria 116138
194 Ga0496104_0000008 3300048907 Bacteria 516976
195 Ga0496105_0000003 3300048908 Bacteria 713251
196 Ga0496106_0000040 3300048909 Bacteria 108754
197 Ga0496107_0000025 3300048910 Bacteria 116138
198 Ga0496108_0000004 3300048911 Bacteria 545055
199 Ga0496108_0066954 3300048911 Bacteria 3029
200 Ga0496109_0000013 3300048912 Bacteria 227469
201 Ga0496109_0011164 3300048912 Bacteria 7706
202 Ga0496109_0168821 3300048912 Bacteria 2052
203 Ga0496110_0584273 3300048913 Bacteria 1014
204 Ga0496114_0611352 3300048917 Bacteria 961
205 Ga0496124_0852906 3300048927 Bacteria 558
206 Ga0496125_0077856 3300048928 Bacteria 2553
207 Ga0501038_0992126 3300049574 Bacteria 617
208 Ga0501067_0866892 3300049583 Bacteria 509
209 Ga0501070_0045729 3300049586 Bacteria 3640
210 Ga0501072_0492200 3300049588 Bacteria 970
211 Ga0501081_0456403 3300049743 Bacteria 950
212 nmdc:mga03n38_2423_c1 3300050490 Bacteria 5759
213 nmdc:mga00v17_401045_c1 3300050491 Bacteria 891
214 nmdc:mga0yw44_167179_c1 3300050492 Bacteria 1443
215 nmdc:mga0yw44_956648_c1 3300050492 Bacteria 580
216 nmdc:mga06z11_321496_c1 3300050494 Bacteria 923
217 nmdc:mga08y16_583388_c1 3300050511 Bacteria 1128
218 nmdc:mga0n895_267520_c1 3300050512 Bacteria 1734
219 Ga0495601_0037630 3300053077 Bacteria 3025
220 Ga0495595_0001963 3300053084 Bacteria 7989
221 Ga0500554_066286 3300053102 Bacteria 1167
222 Ga0500614_000156 3300053123 Bacteria 17306
223 Ga0501084_0991008 3300054114 Bacteria 706
224 Ga0501082_1239887 3300060353 Bacteria 652

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_0991325 Ga0451853_0991325_403_693 96
2 3300031731 Ga0307405_11027756 Ga0307405_110277561 105
3 3300050492 nmdc:mga0yw44_956648_c1 nmdc:mga0yw44_956648_c1_68_451 105
4 3300053077 Ga0495601_0037630 Ga0495601_0037630_2417_2776 107
5 3300037418 Ga0395900_1029247 Ga0395900_1029247_153_491 112
6 3300009098 Ga0105245_10086419 Ga0105245_100864192 113
7 3300037312 Ga0395899_0745498 Ga0395899_0745498_58_399 113
8 3300037418 Ga0395900_0112546 Ga0395900_0112546_1926_2267 113
9 3300037466 Ga0395898_0815092 Ga0395898_0815092_267_608 113
10 3300037471 Ga0395905_0135035 Ga0395905_0135035_47_388 113
11 3300037471 Ga0395905_1866407 Ga0395905_1866407_68_409 113
12 3300038443 Ga0395901_0080164 Ga0395901_0080164_1420_1761 113
13 3300005937 Ga0081455_10006161 Ga0081455_100061619 114
14 3300005937 Ga0081455_10299738 Ga0081455_102997382 114
15 3300005937 Ga0081455_10625414 Ga0081455_106254142 114
16 3300005983 Ga0081540_1002322 Ga0081540_10023223 114
17 3300009148 Ga0105243_11716403 Ga0105243_117164032 114
18 3300037418 Ga0395900_0879710 Ga0395900_0879710_216_560 114
19 3300037466 Ga0395898_1178608 Ga0395898_1178608_30_374 114
20 3300038443 Ga0395901_0098829 Ga0395901_0098829_2648_2992 114
21 3300042993 Ga0439440_0060416 Ga0439440_0060416_233_577 114
22 3300046501 Ga0495607_0228697 Ga0495607_0228697_272_616 114
23 3300046518 Ga0495631_0423613 Ga0495631_0423613_121_465 114
24 3300046539 Ga0495621_0120671 Ga0495621_0120671_637_981 114
25 3300046691 Ga0495670_0676175 Ga0495670_0676175_178_522 114
26 3300009176 Ga0105242_10000063 Ga0105242_1000006325 115
27 3300025934 Ga0207686_10000230 Ga0207686_1000023025 115
28 3300046461 Ga0495641_0018661 Ga0495641_0018661_3135_3482 115
29 3300047321 Ga0495676_0005983 Ga0495676_0005983_2349_2696 115
30 3300048912 Ga0496109_0168821 Ga0496109_0168821_1063_1410 115
31 3300005347 Ga0070668_100006626 Ga0070668_10000662610 116
32 3300005367 Ga0070667_100001110 Ga0070667_1000011103 116
33 3300005548 Ga0070665_100167296 Ga0070665_1001672962 116
34 3300005549 Ga0070704_100141354 Ga0070704_1001413541 116
35 3300005842 Ga0068858_100121685 Ga0068858_1001216852 116
36 3300005843 Ga0068860_100075328 Ga0068860_1000753282 116
37 3300005844 Ga0068862_100002784 Ga0068862_1000027843 116
38 3300009553 Ga0105249_10002088 Ga0105249_1000208810 116
39 3300014968 Ga0157379_10026678 Ga0157379_100266784 116
40 3300025961 Ga0207712_10002074 Ga0207712_100020742 116
41 3300025972 Ga0207668_10007058 Ga0207668_100070583 116
42 3300025986 Ga0207658_10055741 Ga0207658_100557412 116
43 3300026035 Ga0207703_10859065 Ga0207703_108590652 116
44 3300026088 Ga0207641_10000062 Ga0207641_10000062162 116
45 3300028379 Ga0268266_10064575 Ga0268266_100645752 116
46 3300028380 Ga0268265_10768488 Ga0268265_107684881 116
47 3300028381 Ga0268264_10605351 Ga0268264_106053512 116
48 3300046454 Ga0495592_0372049 Ga0495592_0372049_504_854 116
49 3300046514 Ga0495618_0170134 Ga0495618_0170134_742_1092 116
50 3300046516 Ga0495628_0004134 Ga0495628_0004134_1999_2349 116
51 3300046516 Ga0495628_0446023 Ga0495628_0446023_434_784 116
52 3300046529 Ga0495652_0005154 Ga0495652_0005154_11872_12222 116
53 3300046536 Ga0495587_0029139 Ga0495587_0029139_1602_1952 116
54 3300046543 Ga0495645_0018934 Ga0495645_0018934_439_789 116
55 3300047322 Ga0495680_0136086 Ga0495680_0136086_427_777 116
56 3300048088 Ga0495602_0004130 Ga0495602_0004130_7654_8004 116
57 3300048913 Ga0496110_0584273 Ga0496110_0584273_390_740 116
58 3300005364 Ga0070673_100000987 Ga0070673_1000009877 117
59 3300009551 Ga0105238_10000033 Ga0105238_10000033154 117
60 3300025924 Ga0207694_10000012 Ga0207694_10000012155 117
61 3300036647 Ga0316582_0346790 Ga0316582_0346790_244_597 117
62 3300046455 Ga0495603_0000343 Ga0495603_0000343_21751_22104 117
63 3300046681 Ga0495647_0014446 Ga0495647_0014446_424_777 117
64 3300048927 Ga0496124_0852906 Ga0496124_0852906_16_372 117
65 3300049574 Ga0501038_0992126 Ga0501038_0992126_198_551 117
66 3300005329 Ga0070683_100034921 Ga0070683_1000349212 118
67 3300005333 Ga0070677_10000028 Ga0070677_1000002830 118
68 3300005338 Ga0068868_100000351 Ga0068868_10000035114 118
69 3300005345 Ga0070692_10645033 Ga0070692_106450332 118
70 3300005535 Ga0070684_100056461 Ga0070684_1000564613 118
71 3300005578 Ga0068854_100016040 Ga0068854_1000160402 118
72 3300005614 Ga0068856_100147951 Ga0068856_1001479512 118
73 3300006178 Ga0075367_10303218 Ga0075367_103032182 118
74 3300006237 Ga0097621_100836805 Ga0097621_1008368052 118
75 3300006358 Ga0068871_101379557 Ga0068871_1013795572 118
76 3300009098 Ga0105245_10000040 Ga0105245_1000004010 118
77 3300009176 Ga0105242_10075804 Ga0105242_100758042 118
78 3300009553 Ga0105249_10000218 Ga0105249_1000021866 118
79 3300014968 Ga0157379_10011282 Ga0157379_100112823 118
80 3300017792 Ga0163161_10000064 Ga0163161_1000006494 118
81 3300025893 Ga0207682_10000041 Ga0207682_1000004141 118
82 3300025899 Ga0207642_10567653 Ga0207642_105676532 118
83 3300025927 Ga0207687_10000128 Ga0207687_1000012830 118
84 3300025944 Ga0207661_10018028 Ga0207661_100180284 118
85 3300025961 Ga0207712_10000027 Ga0207712_10000027259 118
86 3300025972 Ga0207668_10469644 Ga0207668_104696442 118
87 3300025981 Ga0207640_10011451 Ga0207640_100114514 118
88 3300026023 Ga0207677_10000304 Ga0207677_1000030420 118
89 3300026078 Ga0207702_10010263 Ga0207702_100102632 118
90 3300026078 Ga0207702_10451133 Ga0207702_104511332 118
91 3300044694 Ga0466963_0000141 Ga0466963_0000141_11050_11406 118
92 3300045976 Ga0466967_0999453 Ga0466967_0999453_237_593 118
93 3300046461 Ga0495641_0000004 Ga0495641_0000004_100435_100791 118
94 3300046476 Ga0495662_0000069 Ga0495662_0000069_14530_14892 118
95 3300046477 Ga0495664_0742428 Ga0495664_0742428_131_493 118
96 3300046511 Ga0495608_0000754 Ga0495608_0000754_14700_15062 118
97 3300046514 Ga0495618_0132809 Ga0495618_0132809_577_933 118
98 3300046515 Ga0495620_0000041 Ga0495620_0000041_17226_17582 118
99 3300046516 Ga0495628_0006059 Ga0495628_0006059_1364_1726 118
100 3300046516 Ga0495628_0672523 Ga0495628_0672523_184_540 118
101 3300046517 Ga0495630_0082874 Ga0495630_0082874_416_772 118
102 3300046543 Ga0495645_0060196 Ga0495645_0060196_1305_1661 118
103 3300046684 Ga0495669_0000307 Ga0495669_0000307_25476_25832 118
104 3300047315 Ga0495581_0047092 Ga0495581_0047092_311_673 118
105 3300048903 Ga0496100_0000024 Ga0496100_0000024_104423_104779 118
106 3300048904 Ga0496101_0000072 Ga0496101_0000072_11360_11716 118
107 3300048907 Ga0496104_0000008 Ga0496104_0000008_150766_151122 118
108 3300048908 Ga0496105_0000003 Ga0496105_0000003_150766_151122 118
109 3300048909 Ga0496106_0000040 Ga0496106_0000040_97039_97395 118
110 3300048910 Ga0496107_0000025 Ga0496107_0000025_104423_104779 118
111 3300048911 Ga0496108_0000004 Ga0496108_0000004_444318_444674 118
112 3300048912 Ga0496109_0000013 Ga0496109_0000013_126759_127115 118
113 3300048928 Ga0496125_0077856 Ga0496125_0077856_1382_1738 118
114 3300049588 Ga0501072_0492200 Ga0501072_0492200_390_788 118
115 3300049743 Ga0501081_0456403 Ga0501081_0456403_426_782 118
116 3300050494 nmdc:mga06z11_321496_c1 nmdc:mga06z11_321496_c1_119_499 118
117 3300050512 nmdc:mga0n895_267520_c1 nmdc:mga0n895_267520_c1_35_397 118
118 3300053102 Ga0500554_066286 Ga0500554_066286_534_893 118
119 3300053123 Ga0500614_000156 Ga0500614_000156_9472_9828 118
120 3300054114 Ga0501084_0991008 Ga0501084_0991008_337_693 118
121 3300060353 Ga0501082_1239887 Ga0501082_1239887_153_509 118
122 3300005547 Ga0070693_100000422 Ga0070693_10000042211 119
123 3300046454 Ga0495592_0000423 Ga0495592_0000423_31682_32047 119
124 3300046462 Ga0495651_0247813 Ga0495651_0247813_76_441 119
125 3300046463 Ga0495653_0257369 Ga0495653_0257369_70_435 119
126 3300046678 Ga0495599_0889079 Ga0495599_0889079_99_464 119
127 3300046689 Ga0495613_0001225 Ga0495613_0001225_94_459 119
128 3300047322 Ga0495680_0011422 Ga0495680_0011422_53_418 119
129 3300047471 Ga0495684_0618493 Ga0495684_0618493_305_670 119
130 3300049583 Ga0501067_0866892 Ga0501067_0866892_26_391 119
131 3300053084 Ga0495595_0001963 Ga0495595_0001963_7608_7973 119
132 3300005327 Ga0070658_10027408 Ga0070658_100274083 120
133 3300005329 Ga0070683_100070488 Ga0070683_1000704882 120
134 3300005336 Ga0070680_100063372 Ga0070680_1000633722 120
135 3300005337 Ga0070682_100000389 Ga0070682_10000038923 120
136 3300005338 Ga0068868_100004841 Ga0068868_1000048413 120
137 3300005339 Ga0070660_100001576 Ga0070660_1000015769 120
138 3300005340 Ga0070689_100242672 Ga0070689_1002426722 120
139 3300005341 Ga0070691_10213622 Ga0070691_102136222 120
140 3300005344 Ga0070661_100044018 Ga0070661_1000440183 120
141 3300005345 Ga0070692_10001321 Ga0070692_100013212 120
142 3300005347 Ga0070668_100079782 Ga0070668_1000797822 120
143 3300005354 Ga0070675_100018927 Ga0070675_1000189274 120
144 3300005356 Ga0070674_100008850 Ga0070674_1000088504 120
145 3300005366 Ga0070659_100003244 Ga0070659_1000032446 120
146 3300005367 Ga0070667_100227769 Ga0070667_1002277692 120
147 3300005441 Ga0070700_100006209 Ga0070700_1000062093 120
148 3300005456 Ga0070678_100374068 Ga0070678_1003740682 120
149 3300005457 Ga0070662_100018250 Ga0070662_1000182503 120
150 3300005459 Ga0068867_100038633 Ga0068867_1000386333 120
151 3300005466 Ga0070685_10353059 Ga0070685_103530592 120
152 3300005530 Ga0070679_100110512 Ga0070679_1001105122 120
153 3300005535 Ga0070684_100226954 Ga0070684_1002269542 120
154 3300005539 Ga0068853_100005538 Ga0068853_1000055384 120
155 3300005543 Ga0070672_100008427 Ga0070672_1000084274 120
156 3300005544 Ga0070686_100056131 Ga0070686_1000561312 120
157 3300005547 Ga0070693_100120229 Ga0070693_1001202292 120
158 3300005548 Ga0070665_100183023 Ga0070665_1001830232 120
159 3300005563 Ga0068855_100353202 Ga0068855_1003532022 120
160 3300005564 Ga0070664_100354444 Ga0070664_1003544442 120
161 3300005577 Ga0068857_100025757 Ga0068857_1000257572 120
162 3300005578 Ga0068854_100159191 Ga0068854_1001591912 120
163 3300005615 Ga0070702_100090805 Ga0070702_1000908052 120
164 3300005616 Ga0068852_100015794 Ga0068852_1000157942 120
165 3300005719 Ga0068861_100044491 Ga0068861_1000444912 120
166 3300005834 Ga0068851_10036047 Ga0068851_100360472 120
167 3300005842 Ga0068858_100017985 Ga0068858_1000179854 120
168 3300005843 Ga0068860_101028484 Ga0068860_1010284842 120
169 3300005844 Ga0068862_100072221 Ga0068862_1000722212 120
170 3300006038 Ga0075365_10140837 Ga0075365_101408372 120
171 3300006048 Ga0075363_100004498 Ga0075363_1000044982 120
172 3300006881 Ga0068865_100009667 Ga0068865_1000096674 120
173 3300009094 Ga0111539_11858055 Ga0111539_118580551 120
174 3300009098 Ga0105245_10084453 Ga0105245_100844533 120
175 3300009148 Ga0105243_10003860 Ga0105243_100038608 120
176 3300009551 Ga0105238_10227718 Ga0105238_102277182 120
177 3300009553 Ga0105249_10021757 Ga0105249_100217572 120
178 3300010375 Ga0105239_10074998 Ga0105239_100749983 120
179 3300013102 Ga0157371_10208979 Ga0157371_102089791 120
180 3300013307 Ga0157372_10134485 Ga0157372_101344852 120
181 3300013308 Ga0157375_10071155 Ga0157375_100711552 120
182 3300014326 Ga0157380_10021985 Ga0157380_100219852 120
183 3300014745 Ga0157377_10004561 Ga0157377_100045614 120
184 3300025909 Ga0207705_10059362 Ga0207705_100593622 120
185 3300025919 Ga0207657_10003551 Ga0207657_1000355114 120
186 3300025920 Ga0207649_10146298 Ga0207649_101462982 120
187 3300025921 Ga0207652_10167948 Ga0207652_101679482 120
188 3300025924 Ga0207694_10335871 Ga0207694_103358712 120
189 3300025926 Ga0207659_10053199 Ga0207659_100531992 120
190 3300025927 Ga0207687_10019939 Ga0207687_100199393 120
191 3300025932 Ga0207690_10003342 Ga0207690_100033424 120
192 3300025933 Ga0207706_10002862 Ga0207706_1000286217 120
193 3300025935 Ga0207709_10003188 Ga0207709_100031887 120
194 3300025936 Ga0207670_10013087 Ga0207670_100130872 120
195 3300025938 Ga0207704_10156626 Ga0207704_101566262 120
196 3300025940 Ga0207691_10005911 Ga0207691_100059113 120
197 3300025944 Ga0207661_10092107 Ga0207661_100921072 120
198 3300025972 Ga0207668_10019301 Ga0207668_100193012 120
199 3300025986 Ga0207658_10316234 Ga0207658_103162342 120
200 3300026023 Ga0207677_10052304 Ga0207677_100523042 120
201 3300026035 Ga0207703_10011408 Ga0207703_100114086 120
202 3300026041 Ga0207639_10017169 Ga0207639_100171694 120
203 3300026067 Ga0207678_10008086 Ga0207678_100080862 120
204 3300026075 Ga0207708_10001275 Ga0207708_1000127518 120
205 3300026089 Ga0207648_10211642 Ga0207648_102116422 120
206 3300026116 Ga0207674_10117797 Ga0207674_101177972 120
207 3300026118 Ga0207675_100009627 Ga0207675_1000096278 120
208 3300026121 Ga0207683_10131609 Ga0207683_101316092 120
209 3300028379 Ga0268266_10018782 Ga0268266_100187824 120
210 3300028380 Ga0268265_10161645 Ga0268265_101616452 120
211 3300028381 Ga0268264_10993319 Ga0268264_109933192 120
212 3300031728 Ga0316578_10318216 Ga0316578_103182161 120
213 3300036712 Ga0316584_0187068 Ga0316584_0187068_558_941 120
214 3300042530 Ga0450916_048938 Ga0450916_048938_87_470 120
215 3300048911 Ga0496108_0066954 Ga0496108_0066954_2181_2564 120
216 3300048912 Ga0496109_0011164 Ga0496109_0011164_4633_5016 120
217 3300048917 Ga0496114_0611352 Ga0496114_0611352_467_850 120
218 3300050490 nmdc:mga03n38_2423_c1 nmdc:mga03n38_2423_c1_4710_5093 120
219 3300050491 nmdc:mga00v17_401045_c1 nmdc:mga00v17_401045_c1_327_710 120
220 3300050492 nmdc:mga0yw44_167179_c1 nmdc:mga0yw44_167179_c1_107_490 120
221 3300050511 nmdc:mga08y16_583388_c1 nmdc:mga08y16_583388_c1_66_449 120
222 3300049586 Ga0501070_0045729 Ga0501070_0045729_3010_3387 125
223 3300003659 JGI25404J52841_10002650 JGI25404J52841_100026502 132
224 3300005983 Ga0081540_1000868 Ga0081540_100086817 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

115

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wdy-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a 0.9078 2 113
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.9074 2 113
2jca-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor holo- [acyl-carrier-protein] synthase (acps) at 2 a. 0.9063 1 113
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.8919 1 114
6ql9-assembly1.cif.gz_D structure of fatty acid synthase complex from saccharomyces cerevisiae at 2.9 angstrom 0.8861 4 113
ID Description Score Start End Superfamily
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9078 2 113 3.90.470.20
4jm7A01 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8715 1 114 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.871 1 114 3.90.470.20
5xukA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8582 5 113 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8572 1 119 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A7V9KAA3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9736 4 112 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A399Y3R3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9571 1 113 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A3C1CEV4-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9558 1 114 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7C6NTL9-F1-model_v4 Holo-ACP synthase (EC 2.7.8.7) 0.9555 3 112 GO:0000287
GO:0006633
GO:0008897
AF-A0A538B6I4-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9555 1 114 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Feature Viewer

pLDDT pTM Quality
89.1 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map