F336255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 224 | 171 | 224 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10002650|JGI25404J52841_100026502 |
| Length | 132 |
| Sequence | MATGVGIDLLEIERMERALERHPRIXXXVFTAGEREYAAAKARPGRHLAARFAAKEAVVKALGLRGGFGLREIEVVAGEPPTVRLSGRAAEAAEGRTVEISLTHSRDNAAAVAIVSSVDTGLRSASAGGDPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 104 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 112 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 154 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 161 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 169 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 170 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.46 |
| Nodule | 0 |
| Rhizoplane | 5.8 |
| Rhizosphere | 88.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10002650 | 3300003659 | Bacteria | 3416 |
| 2 | Ga0070658_10027408 | 3300005327 | Bacteria | 4572 |
| 3 | Ga0070683_100034921 | 3300005329 | Bacteria | 4596 |
| 4 | Ga0070683_100070488 | 3300005329 | Bacteria | 3260 |
| 5 | Ga0070677_10000028 | 3300005333 | Bacteria | 43011 |
| 6 | Ga0070680_100063372 | 3300005336 | Bacteria | 3028 |
| 7 | Ga0070682_100000389 | 3300005337 | Bacteria | 29231 |
| 8 | Ga0068868_100000351 | 3300005338 | Bacteria | 31294 |
| 9 | Ga0068868_100004841 | 3300005338 | Bacteria | 9451 |
| 10 | Ga0070660_100001576 | 3300005339 | Bacteria | 15678 |
| 11 | Ga0070689_100242672 | 3300005340 | Bacteria | 1484 |
| 12 | Ga0070691_10213622 | 3300005341 | Bacteria | 1019 |
| 13 | Ga0070661_100044018 | 3300005344 | Bacteria | 3261 |
| 14 | Ga0070692_10001321 | 3300005345 | Bacteria | 8917 |
| 15 | Ga0070692_10645033 | 3300005345 | Bacteria | 706 |
| 16 | Ga0070668_100006626 | 3300005347 | Bacteria | 8582 |
| 17 | Ga0070668_100079782 | 3300005347 | Bacteria | 2563 |
| 18 | Ga0070675_100018927 | 3300005354 | Bacteria | 5485 |
| 19 | Ga0070674_100008850 | 3300005356 | Bacteria | 6010 |
| 20 | Ga0070673_100000987 | 3300005364 | Bacteria | 16156 |
| 21 | Ga0070659_100003244 | 3300005366 | Bacteria | 11575 |
| 22 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 23 | Ga0070667_100227769 | 3300005367 | Bacteria | 1661 |
| 24 | Ga0070700_100006209 | 3300005441 | Bacteria | 6368 |
| 25 | Ga0070678_100374068 | 3300005456 | Bacteria | 1231 |
| 26 | Ga0070662_100018250 | 3300005457 | Bacteria | 4744 |
| 27 | Ga0068867_100038633 | 3300005459 | Bacteria | 3475 |
| 28 | Ga0070685_10353059 | 3300005466 | Bacteria | 1006 |
| 29 | Ga0070679_100110512 | 3300005530 | Bacteria | 2735 |
| 30 | Ga0070684_100056461 | 3300005535 | Bacteria | 3427 |
| 31 | Ga0070684_100226954 | 3300005535 | Bacteria | 1704 |
| 32 | Ga0068853_100005538 | 3300005539 | Bacteria | 9905 |
| 33 | Ga0070672_100008427 | 3300005543 | Bacteria | 7048 |
| 34 | Ga0070686_100056131 | 3300005544 | Bacteria | 2525 |
| 35 | Ga0070693_100000422 | 3300005547 | Bacteria | 19196 |
| 36 | Ga0070693_100120229 | 3300005547 | Bacteria | 1628 |
| 37 | Ga0070665_100167296 | 3300005548 | Bacteria | 2201 |
| 38 | Ga0070665_100183023 | 3300005548 | Bacteria | 2096 |
| 39 | Ga0070704_100141354 | 3300005549 | Unclassified | 1880 |
| 40 | Ga0068855_100353202 | 3300005563 | Bacteria | 1619 |
| 41 | Ga0070664_100354444 | 3300005564 | Bacteria | 1335 |
| 42 | Ga0068857_100025757 | 3300005577 | Bacteria | 5179 |
| 43 | Ga0068854_100016040 | 3300005578 | Bacteria | 4984 |
| 44 | Ga0068854_100159191 | 3300005578 | Bacteria | 1747 |
| 45 | Ga0068856_100147951 | 3300005614 | Bacteria | 2356 |
| 46 | Ga0070702_100090805 | 3300005615 | Bacteria | 1852 |
| 47 | Ga0068852_100015794 | 3300005616 | Bacteria | 5870 |
| 48 | Ga0068861_100044491 | 3300005719 | Bacteria | 3339 |
| 49 | Ga0068851_10036047 | 3300005834 | Bacteria | 2476 |
| 50 | Ga0068858_100017985 | 3300005842 | Bacteria | 6620 |
| 51 | Ga0068858_100121685 | 3300005842 | Bacteria | 2441 |
| 52 | Ga0068860_100075328 | 3300005843 | Bacteria | 3210 |
| 53 | Ga0068860_101028484 | 3300005843 | Bacteria | 842 |
| 54 | Ga0068862_100002784 | 3300005844 | Bacteria | 15326 |
| 55 | Ga0068862_100072221 | 3300005844 | Bacteria | 2981 |
| 56 | Ga0081455_10006161 | 3300005937 | Bacteria | 12937 |
| 57 | Ga0081455_10299738 | 3300005937 | Unclassified | 1154 |
| 58 | Ga0081455_10625414 | 3300005937 | Bacteria | 698 |
| 59 | Ga0081540_1000868 | 3300005983 | Bacteria | 27372 |
| 60 | Ga0081540_1002322 | 3300005983 | Bacteria | 15589 |
| 61 | Ga0075365_10140837 | 3300006038 | Bacteria | 1674 |
| 62 | Ga0075363_100004498 | 3300006048 | Bacteria | 6112 |
| 63 | Ga0075367_10303218 | 3300006178 | Bacteria | 1005 |
| 64 | Ga0097621_100836805 | 3300006237 | Bacteria | 854 |
| 65 | Ga0068871_101379557 | 3300006358 | Bacteria | 664 |
| 66 | Ga0068865_100009667 | 3300006881 | Bacteria | 5982 |
| 67 | Ga0111539_11858055 | 3300009094 | Bacteria | 698 |
| 68 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 69 | Ga0105245_10084453 | 3300009098 | Bacteria | 2909 |
| 70 | Ga0105245_10086419 | 3300009098 | Bacteria | 2876 |
| 71 | Ga0105243_10003860 | 3300009148 | Bacteria | 11970 |
| 72 | Ga0105243_11716403 | 3300009148 | Unclassified | 657 |
| 73 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 74 | Ga0105242_10075804 | 3300009176 | Bacteria | 2801 |
| 75 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 76 | Ga0105238_10227718 | 3300009551 | Bacteria | 1841 |
| 77 | Ga0105249_10000218 | 3300009553 | Bacteria | 65480 |
| 78 | Ga0105249_10002088 | 3300009553 | Bacteria | 17318 |
| 79 | Ga0105249_10021757 | 3300009553 | Bacteria | 5742 |
| 80 | Ga0105239_10074998 | 3300010375 | Bacteria | 3719 |
| 81 | Ga0157371_10208979 | 3300013102 | Bacteria | 1400 |
| 82 | Ga0157372_10134485 | 3300013307 | Bacteria | 2847 |
| 83 | Ga0157375_10071155 | 3300013308 | Bacteria | 3490 |
| 84 | Ga0157380_10021985 | 3300014326 | Bacteria | 4792 |
| 85 | Ga0157377_10004561 | 3300014745 | Bacteria | 6398 |
| 86 | Ga0157379_10011282 | 3300014968 | Bacteria | 7788 |
| 87 | Ga0157379_10026678 | 3300014968 | Bacteria | 5142 |
| 88 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 89 | Ga0207682_10000041 | 3300025893 | Bacteria | 52338 |
| 90 | Ga0207642_10567653 | 3300025899 | Bacteria | 703 |
| 91 | Ga0207705_10059362 | 3300025909 | Bacteria | 2761 |
| 92 | Ga0207657_10003551 | 3300025919 | Bacteria | 16649 |
| 93 | Ga0207649_10146298 | 3300025920 | Bacteria | 1622 |
| 94 | Ga0207652_10167948 | 3300025921 | Bacteria | 1968 |
| 95 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 96 | Ga0207694_10335871 | 3300025924 | Bacteria | 1249 |
| 97 | Ga0207659_10053199 | 3300025926 | Bacteria | 2887 |
| 98 | Ga0207687_10000128 | 3300025927 | Bacteria | 50603 |
| 99 | Ga0207687_10019939 | 3300025927 | Bacteria | 4447 |
| 100 | Ga0207690_10003342 | 3300025932 | Bacteria | 9588 |
| 101 | Ga0207706_10002862 | 3300025933 | Bacteria | 16746 |
| 102 | Ga0207686_10000230 | 3300025934 | Bacteria | 42566 |
| 103 | Ga0207709_10003188 | 3300025935 | Bacteria | 9853 |
| 104 | Ga0207670_10013087 | 3300025936 | Bacteria | 4881 |
| 105 | Ga0207704_10156626 | 3300025938 | Bacteria | 1615 |
| 106 | Ga0207691_10005911 | 3300025940 | Bacteria | 11817 |
| 107 | Ga0207661_10018028 | 3300025944 | Bacteria | 5241 |
| 108 | Ga0207661_10092107 | 3300025944 | Bacteria | 2526 |
| 109 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 110 | Ga0207712_10002074 | 3300025961 | Bacteria | 13155 |
| 111 | Ga0207668_10007058 | 3300025972 | Bacteria | 6663 |
| 112 | Ga0207668_10019301 | 3300025972 | Bacteria | 4307 |
| 113 | Ga0207668_10469644 | 3300025972 | Unclassified | 1077 |
| 114 | Ga0207640_10011451 | 3300025981 | Bacteria | 5025 |
| 115 | Ga0207658_10055741 | 3300025986 | Bacteria | 2930 |
| 116 | Ga0207658_10316234 | 3300025986 | Bacteria | 1350 |
| 117 | Ga0207677_10000304 | 3300026023 | Bacteria | 36147 |
| 118 | Ga0207677_10052304 | 3300026023 | Bacteria | 2774 |
| 119 | Ga0207703_10011408 | 3300026035 | Bacteria | 6910 |
| 120 | Ga0207703_10859065 | 3300026035 | Bacteria | 868 |
| 121 | Ga0207639_10017169 | 3300026041 | Bacteria | 5129 |
| 122 | Ga0207678_10008086 | 3300026067 | Bacteria | 9274 |
| 123 | Ga0207708_10001275 | 3300026075 | Bacteria | 18940 |
| 124 | Ga0207702_10010263 | 3300026078 | Bacteria | 7846 |
| 125 | Ga0207702_10451133 | 3300026078 | Bacteria | 1248 |
| 126 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 127 | Ga0207648_10211642 | 3300026089 | Bacteria | 1721 |
| 128 | Ga0207674_10117797 | 3300026116 | Bacteria | 2626 |
| 129 | Ga0207675_100009627 | 3300026118 | Bacteria | 9043 |
| 130 | Ga0207683_10131609 | 3300026121 | Bacteria | 2250 |
| 131 | Ga0268266_10018782 | 3300028379 | Bacteria | 5891 |
| 132 | Ga0268266_10064575 | 3300028379 | Bacteria | 3163 |
| 133 | Ga0268265_10161645 | 3300028380 | Bacteria | 1903 |
| 134 | Ga0268265_10768488 | 3300028380 | Bacteria | 936 |
| 135 | Ga0268264_10605351 | 3300028381 | Bacteria | 1080 |
| 136 | Ga0268264_10993319 | 3300028381 | Bacteria | 846 |
| 137 | Ga0316578_10318216 | 3300031728 | Bacteria | 929 |
| 138 | Ga0307405_11027756 | 3300031731 | Bacteria | 705 |
| 139 | Ga0316582_0346790 | 3300036647 | Bacteria | 1021 |
| 140 | Ga0316584_0187068 | 3300036712 | Bacteria | 1532 |
| 141 | Ga0395899_0745498 | 3300037312 | Bacteria | 610 |
| 142 | Ga0395900_0112546 | 3300037418 | Bacteria | 2795 |
| 143 | Ga0395900_0879710 | 3300037418 | Bacteria | 820 |
| 144 | Ga0395900_1029247 | 3300037418 | Unclassified | 743 |
| 145 | Ga0395898_0815092 | 3300037466 | Bacteria | 873 |
| 146 | Ga0395898_1178608 | 3300037466 | Bacteria | 698 |
| 147 | Ga0395905_0135035 | 3300037471 | Bacteria | 2321 |
| 148 | Ga0395905_1866407 | 3300037471 | Bacteria | 507 |
| 149 | Ga0395901_0080164 | 3300038443 | Bacteria | 3408 |
| 150 | Ga0395901_0098829 | 3300038443 | Bacteria | 3060 |
| 151 | Ga0451853_0991325 | 3300041512 | Bacteria | 705 |
| 152 | Ga0450916_048938 | 3300042530 | Bacteria | 662 |
| 153 | Ga0439440_0060416 | 3300042993 | Bacteria | 967 |
| 154 | Ga0466963_0000141 | 3300044694 | Bacteria | 28151 |
| 155 | Ga0466967_0999453 | 3300045976 | Bacteria | 833 |
| 156 | Ga0495592_0000423 | 3300046454 | Bacteria | 32094 |
| 157 | Ga0495592_0372049 | 3300046454 | Bacteria | 911 |
| 158 | Ga0495603_0000343 | 3300046455 | Bacteria | 24991 |
| 159 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 160 | Ga0495641_0018661 | 3300046461 | Bacteria | 3574 |
| 161 | Ga0495651_0247813 | 3300046462 | Unclassified | 1218 |
| 162 | Ga0495653_0257369 | 3300046463 | Bacteria | 1156 |
| 163 | Ga0495662_0000069 | 3300046476 | Bacteria | 36219 |
| 164 | Ga0495664_0742428 | 3300046477 | Bacteria | 579 |
| 165 | Ga0495607_0228697 | 3300046501 | Bacteria | 906 |
| 166 | Ga0495608_0000754 | 3300046511 | Bacteria | 22642 |
| 167 | Ga0495618_0132809 | 3300046514 | Bacteria | 1593 |
| 168 | Ga0495618_0170134 | 3300046514 | Bacteria | 1387 |
| 169 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 170 | Ga0495628_0004134 | 3300046516 | Bacteria | 12910 |
| 171 | Ga0495628_0006059 | 3300046516 | Bacteria | 10569 |
| 172 | Ga0495628_0446023 | 3300046516 | Bacteria | 940 |
| 173 | Ga0495628_0672523 | 3300046516 | Bacteria | 733 |
| 174 | Ga0495630_0082874 | 3300046517 | Unclassified | 2421 |
| 175 | Ga0495631_0423613 | 3300046518 | Bacteria | 567 |
| 176 | Ga0495652_0005154 | 3300046529 | Bacteria | 12351 |
| 177 | Ga0495587_0029139 | 3300046536 | Bacteria | 3353 |
| 178 | Ga0495621_0120671 | 3300046539 | Bacteria | 1013 |
| 179 | Ga0495645_0018934 | 3300046543 | Bacteria | 4952 |
| 180 | Ga0495645_0060196 | 3300046543 | Bacteria | 2753 |
| 181 | Ga0495599_0889079 | 3300046678 | Bacteria | 505 |
| 182 | Ga0495647_0014446 | 3300046681 | Bacteria | 2751 |
| 183 | Ga0495669_0000307 | 3300046684 | Bacteria | 26997 |
| 184 | Ga0495613_0001225 | 3300046689 | Bacteria | 19608 |
| 185 | Ga0495670_0676175 | 3300046691 | Bacteria | 563 |
| 186 | Ga0495581_0047092 | 3300047315 | Bacteria | 2492 |
| 187 | Ga0495676_0005983 | 3300047321 | Bacteria | 11177 |
| 188 | Ga0495680_0011422 | 3300047322 | Bacteria | 7862 |
| 189 | Ga0495680_0136086 | 3300047322 | Bacteria | 1801 |
| 190 | Ga0495684_0618493 | 3300047471 | Unclassified | 729 |
| 191 | Ga0495602_0004130 | 3300048088 | Bacteria | 15127 |
| 192 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 193 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 194 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 195 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 196 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 197 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 198 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 199 | Ga0496108_0066954 | 3300048911 | Bacteria | 3029 |
| 200 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 201 | Ga0496109_0011164 | 3300048912 | Bacteria | 7706 |
| 202 | Ga0496109_0168821 | 3300048912 | Bacteria | 2052 |
| 203 | Ga0496110_0584273 | 3300048913 | Bacteria | 1014 |
| 204 | Ga0496114_0611352 | 3300048917 | Bacteria | 961 |
| 205 | Ga0496124_0852906 | 3300048927 | Bacteria | 558 |
| 206 | Ga0496125_0077856 | 3300048928 | Bacteria | 2553 |
| 207 | Ga0501038_0992126 | 3300049574 | Bacteria | 617 |
| 208 | Ga0501067_0866892 | 3300049583 | Bacteria | 509 |
| 209 | Ga0501070_0045729 | 3300049586 | Bacteria | 3640 |
| 210 | Ga0501072_0492200 | 3300049588 | Bacteria | 970 |
| 211 | Ga0501081_0456403 | 3300049743 | Bacteria | 950 |
| 212 | nmdc:mga03n38_2423_c1 | 3300050490 | Bacteria | 5759 |
| 213 | nmdc:mga00v17_401045_c1 | 3300050491 | Bacteria | 891 |
| 214 | nmdc:mga0yw44_167179_c1 | 3300050492 | Bacteria | 1443 |
| 215 | nmdc:mga0yw44_956648_c1 | 3300050492 | Bacteria | 580 |
| 216 | nmdc:mga06z11_321496_c1 | 3300050494 | Bacteria | 923 |
| 217 | nmdc:mga08y16_583388_c1 | 3300050511 | Bacteria | 1128 |
| 218 | nmdc:mga0n895_267520_c1 | 3300050512 | Bacteria | 1734 |
| 219 | Ga0495601_0037630 | 3300053077 | Bacteria | 3025 |
| 220 | Ga0495595_0001963 | 3300053084 | Bacteria | 7989 |
| 221 | Ga0500554_066286 | 3300053102 | Bacteria | 1167 |
| 222 | Ga0500614_000156 | 3300053123 | Bacteria | 17306 |
| 223 | Ga0501084_0991008 | 3300054114 | Bacteria | 706 |
| 224 | Ga0501082_1239887 | 3300060353 | Bacteria | 652 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_0991325 | Ga0451853_0991325_403_693 | 96 |
| 2 | 3300031731 | Ga0307405_11027756 | Ga0307405_110277561 | 105 |
| 3 | 3300050492 | nmdc:mga0yw44_956648_c1 | nmdc:mga0yw44_956648_c1_68_451 | 105 |
| 4 | 3300053077 | Ga0495601_0037630 | Ga0495601_0037630_2417_2776 | 107 |
| 5 | 3300037418 | Ga0395900_1029247 | Ga0395900_1029247_153_491 | 112 |
| 6 | 3300009098 | Ga0105245_10086419 | Ga0105245_100864192 | 113 |
| 7 | 3300037312 | Ga0395899_0745498 | Ga0395899_0745498_58_399 | 113 |
| 8 | 3300037418 | Ga0395900_0112546 | Ga0395900_0112546_1926_2267 | 113 |
| 9 | 3300037466 | Ga0395898_0815092 | Ga0395898_0815092_267_608 | 113 |
| 10 | 3300037471 | Ga0395905_0135035 | Ga0395905_0135035_47_388 | 113 |
| 11 | 3300037471 | Ga0395905_1866407 | Ga0395905_1866407_68_409 | 113 |
| 12 | 3300038443 | Ga0395901_0080164 | Ga0395901_0080164_1420_1761 | 113 |
| 13 | 3300005937 | Ga0081455_10006161 | Ga0081455_100061619 | 114 |
| 14 | 3300005937 | Ga0081455_10299738 | Ga0081455_102997382 | 114 |
| 15 | 3300005937 | Ga0081455_10625414 | Ga0081455_106254142 | 114 |
| 16 | 3300005983 | Ga0081540_1002322 | Ga0081540_10023223 | 114 |
| 17 | 3300009148 | Ga0105243_11716403 | Ga0105243_117164032 | 114 |
| 18 | 3300037418 | Ga0395900_0879710 | Ga0395900_0879710_216_560 | 114 |
| 19 | 3300037466 | Ga0395898_1178608 | Ga0395898_1178608_30_374 | 114 |
| 20 | 3300038443 | Ga0395901_0098829 | Ga0395901_0098829_2648_2992 | 114 |
| 21 | 3300042993 | Ga0439440_0060416 | Ga0439440_0060416_233_577 | 114 |
| 22 | 3300046501 | Ga0495607_0228697 | Ga0495607_0228697_272_616 | 114 |
| 23 | 3300046518 | Ga0495631_0423613 | Ga0495631_0423613_121_465 | 114 |
| 24 | 3300046539 | Ga0495621_0120671 | Ga0495621_0120671_637_981 | 114 |
| 25 | 3300046691 | Ga0495670_0676175 | Ga0495670_0676175_178_522 | 114 |
| 26 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006325 | 115 |
| 27 | 3300025934 | Ga0207686_10000230 | Ga0207686_1000023025 | 115 |
| 28 | 3300046461 | Ga0495641_0018661 | Ga0495641_0018661_3135_3482 | 115 |
| 29 | 3300047321 | Ga0495676_0005983 | Ga0495676_0005983_2349_2696 | 115 |
| 30 | 3300048912 | Ga0496109_0168821 | Ga0496109_0168821_1063_1410 | 115 |
| 31 | 3300005347 | Ga0070668_100006626 | Ga0070668_10000662610 | 116 |
| 32 | 3300005367 | Ga0070667_100001110 | Ga0070667_1000011103 | 116 |
| 33 | 3300005548 | Ga0070665_100167296 | Ga0070665_1001672962 | 116 |
| 34 | 3300005549 | Ga0070704_100141354 | Ga0070704_1001413541 | 116 |
| 35 | 3300005842 | Ga0068858_100121685 | Ga0068858_1001216852 | 116 |
| 36 | 3300005843 | Ga0068860_100075328 | Ga0068860_1000753282 | 116 |
| 37 | 3300005844 | Ga0068862_100002784 | Ga0068862_1000027843 | 116 |
| 38 | 3300009553 | Ga0105249_10002088 | Ga0105249_1000208810 | 116 |
| 39 | 3300014968 | Ga0157379_10026678 | Ga0157379_100266784 | 116 |
| 40 | 3300025961 | Ga0207712_10002074 | Ga0207712_100020742 | 116 |
| 41 | 3300025972 | Ga0207668_10007058 | Ga0207668_100070583 | 116 |
| 42 | 3300025986 | Ga0207658_10055741 | Ga0207658_100557412 | 116 |
| 43 | 3300026035 | Ga0207703_10859065 | Ga0207703_108590652 | 116 |
| 44 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062162 | 116 |
| 45 | 3300028379 | Ga0268266_10064575 | Ga0268266_100645752 | 116 |
| 46 | 3300028380 | Ga0268265_10768488 | Ga0268265_107684881 | 116 |
| 47 | 3300028381 | Ga0268264_10605351 | Ga0268264_106053512 | 116 |
| 48 | 3300046454 | Ga0495592_0372049 | Ga0495592_0372049_504_854 | 116 |
| 49 | 3300046514 | Ga0495618_0170134 | Ga0495618_0170134_742_1092 | 116 |
| 50 | 3300046516 | Ga0495628_0004134 | Ga0495628_0004134_1999_2349 | 116 |
| 51 | 3300046516 | Ga0495628_0446023 | Ga0495628_0446023_434_784 | 116 |
| 52 | 3300046529 | Ga0495652_0005154 | Ga0495652_0005154_11872_12222 | 116 |
| 53 | 3300046536 | Ga0495587_0029139 | Ga0495587_0029139_1602_1952 | 116 |
| 54 | 3300046543 | Ga0495645_0018934 | Ga0495645_0018934_439_789 | 116 |
| 55 | 3300047322 | Ga0495680_0136086 | Ga0495680_0136086_427_777 | 116 |
| 56 | 3300048088 | Ga0495602_0004130 | Ga0495602_0004130_7654_8004 | 116 |
| 57 | 3300048913 | Ga0496110_0584273 | Ga0496110_0584273_390_740 | 116 |
| 58 | 3300005364 | Ga0070673_100000987 | Ga0070673_1000009877 | 117 |
| 59 | 3300009551 | Ga0105238_10000033 | Ga0105238_10000033154 | 117 |
| 60 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012155 | 117 |
| 61 | 3300036647 | Ga0316582_0346790 | Ga0316582_0346790_244_597 | 117 |
| 62 | 3300046455 | Ga0495603_0000343 | Ga0495603_0000343_21751_22104 | 117 |
| 63 | 3300046681 | Ga0495647_0014446 | Ga0495647_0014446_424_777 | 117 |
| 64 | 3300048927 | Ga0496124_0852906 | Ga0496124_0852906_16_372 | 117 |
| 65 | 3300049574 | Ga0501038_0992126 | Ga0501038_0992126_198_551 | 117 |
| 66 | 3300005329 | Ga0070683_100034921 | Ga0070683_1000349212 | 118 |
| 67 | 3300005333 | Ga0070677_10000028 | Ga0070677_1000002830 | 118 |
| 68 | 3300005338 | Ga0068868_100000351 | Ga0068868_10000035114 | 118 |
| 69 | 3300005345 | Ga0070692_10645033 | Ga0070692_106450332 | 118 |
| 70 | 3300005535 | Ga0070684_100056461 | Ga0070684_1000564613 | 118 |
| 71 | 3300005578 | Ga0068854_100016040 | Ga0068854_1000160402 | 118 |
| 72 | 3300005614 | Ga0068856_100147951 | Ga0068856_1001479512 | 118 |
| 73 | 3300006178 | Ga0075367_10303218 | Ga0075367_103032182 | 118 |
| 74 | 3300006237 | Ga0097621_100836805 | Ga0097621_1008368052 | 118 |
| 75 | 3300006358 | Ga0068871_101379557 | Ga0068871_1013795572 | 118 |
| 76 | 3300009098 | Ga0105245_10000040 | Ga0105245_1000004010 | 118 |
| 77 | 3300009176 | Ga0105242_10075804 | Ga0105242_100758042 | 118 |
| 78 | 3300009553 | Ga0105249_10000218 | Ga0105249_1000021866 | 118 |
| 79 | 3300014968 | Ga0157379_10011282 | Ga0157379_100112823 | 118 |
| 80 | 3300017792 | Ga0163161_10000064 | Ga0163161_1000006494 | 118 |
| 81 | 3300025893 | Ga0207682_10000041 | Ga0207682_1000004141 | 118 |
| 82 | 3300025899 | Ga0207642_10567653 | Ga0207642_105676532 | 118 |
| 83 | 3300025927 | Ga0207687_10000128 | Ga0207687_1000012830 | 118 |
| 84 | 3300025944 | Ga0207661_10018028 | Ga0207661_100180284 | 118 |
| 85 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027259 | 118 |
| 86 | 3300025972 | Ga0207668_10469644 | Ga0207668_104696442 | 118 |
| 87 | 3300025981 | Ga0207640_10011451 | Ga0207640_100114514 | 118 |
| 88 | 3300026023 | Ga0207677_10000304 | Ga0207677_1000030420 | 118 |
| 89 | 3300026078 | Ga0207702_10010263 | Ga0207702_100102632 | 118 |
| 90 | 3300026078 | Ga0207702_10451133 | Ga0207702_104511332 | 118 |
| 91 | 3300044694 | Ga0466963_0000141 | Ga0466963_0000141_11050_11406 | 118 |
| 92 | 3300045976 | Ga0466967_0999453 | Ga0466967_0999453_237_593 | 118 |
| 93 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_100435_100791 | 118 |
| 94 | 3300046476 | Ga0495662_0000069 | Ga0495662_0000069_14530_14892 | 118 |
| 95 | 3300046477 | Ga0495664_0742428 | Ga0495664_0742428_131_493 | 118 |
| 96 | 3300046511 | Ga0495608_0000754 | Ga0495608_0000754_14700_15062 | 118 |
| 97 | 3300046514 | Ga0495618_0132809 | Ga0495618_0132809_577_933 | 118 |
| 98 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_17226_17582 | 118 |
| 99 | 3300046516 | Ga0495628_0006059 | Ga0495628_0006059_1364_1726 | 118 |
| 100 | 3300046516 | Ga0495628_0672523 | Ga0495628_0672523_184_540 | 118 |
| 101 | 3300046517 | Ga0495630_0082874 | Ga0495630_0082874_416_772 | 118 |
| 102 | 3300046543 | Ga0495645_0060196 | Ga0495645_0060196_1305_1661 | 118 |
| 103 | 3300046684 | Ga0495669_0000307 | Ga0495669_0000307_25476_25832 | 118 |
| 104 | 3300047315 | Ga0495581_0047092 | Ga0495581_0047092_311_673 | 118 |
| 105 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_104423_104779 | 118 |
| 106 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_11360_11716 | 118 |
| 107 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_150766_151122 | 118 |
| 108 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_150766_151122 | 118 |
| 109 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_97039_97395 | 118 |
| 110 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_104423_104779 | 118 |
| 111 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_444318_444674 | 118 |
| 112 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_126759_127115 | 118 |
| 113 | 3300048928 | Ga0496125_0077856 | Ga0496125_0077856_1382_1738 | 118 |
| 114 | 3300049588 | Ga0501072_0492200 | Ga0501072_0492200_390_788 | 118 |
| 115 | 3300049743 | Ga0501081_0456403 | Ga0501081_0456403_426_782 | 118 |
| 116 | 3300050494 | nmdc:mga06z11_321496_c1 | nmdc:mga06z11_321496_c1_119_499 | 118 |
| 117 | 3300050512 | nmdc:mga0n895_267520_c1 | nmdc:mga0n895_267520_c1_35_397 | 118 |
| 118 | 3300053102 | Ga0500554_066286 | Ga0500554_066286_534_893 | 118 |
| 119 | 3300053123 | Ga0500614_000156 | Ga0500614_000156_9472_9828 | 118 |
| 120 | 3300054114 | Ga0501084_0991008 | Ga0501084_0991008_337_693 | 118 |
| 121 | 3300060353 | Ga0501082_1239887 | Ga0501082_1239887_153_509 | 118 |
| 122 | 3300005547 | Ga0070693_100000422 | Ga0070693_10000042211 | 119 |
| 123 | 3300046454 | Ga0495592_0000423 | Ga0495592_0000423_31682_32047 | 119 |
| 124 | 3300046462 | Ga0495651_0247813 | Ga0495651_0247813_76_441 | 119 |
| 125 | 3300046463 | Ga0495653_0257369 | Ga0495653_0257369_70_435 | 119 |
| 126 | 3300046678 | Ga0495599_0889079 | Ga0495599_0889079_99_464 | 119 |
| 127 | 3300046689 | Ga0495613_0001225 | Ga0495613_0001225_94_459 | 119 |
| 128 | 3300047322 | Ga0495680_0011422 | Ga0495680_0011422_53_418 | 119 |
| 129 | 3300047471 | Ga0495684_0618493 | Ga0495684_0618493_305_670 | 119 |
| 130 | 3300049583 | Ga0501067_0866892 | Ga0501067_0866892_26_391 | 119 |
| 131 | 3300053084 | Ga0495595_0001963 | Ga0495595_0001963_7608_7973 | 119 |
| 132 | 3300005327 | Ga0070658_10027408 | Ga0070658_100274083 | 120 |
| 133 | 3300005329 | Ga0070683_100070488 | Ga0070683_1000704882 | 120 |
| 134 | 3300005336 | Ga0070680_100063372 | Ga0070680_1000633722 | 120 |
| 135 | 3300005337 | Ga0070682_100000389 | Ga0070682_10000038923 | 120 |
| 136 | 3300005338 | Ga0068868_100004841 | Ga0068868_1000048413 | 120 |
| 137 | 3300005339 | Ga0070660_100001576 | Ga0070660_1000015769 | 120 |
| 138 | 3300005340 | Ga0070689_100242672 | Ga0070689_1002426722 | 120 |
| 139 | 3300005341 | Ga0070691_10213622 | Ga0070691_102136222 | 120 |
| 140 | 3300005344 | Ga0070661_100044018 | Ga0070661_1000440183 | 120 |
| 141 | 3300005345 | Ga0070692_10001321 | Ga0070692_100013212 | 120 |
| 142 | 3300005347 | Ga0070668_100079782 | Ga0070668_1000797822 | 120 |
| 143 | 3300005354 | Ga0070675_100018927 | Ga0070675_1000189274 | 120 |
| 144 | 3300005356 | Ga0070674_100008850 | Ga0070674_1000088504 | 120 |
| 145 | 3300005366 | Ga0070659_100003244 | Ga0070659_1000032446 | 120 |
| 146 | 3300005367 | Ga0070667_100227769 | Ga0070667_1002277692 | 120 |
| 147 | 3300005441 | Ga0070700_100006209 | Ga0070700_1000062093 | 120 |
| 148 | 3300005456 | Ga0070678_100374068 | Ga0070678_1003740682 | 120 |
| 149 | 3300005457 | Ga0070662_100018250 | Ga0070662_1000182503 | 120 |
| 150 | 3300005459 | Ga0068867_100038633 | Ga0068867_1000386333 | 120 |
| 151 | 3300005466 | Ga0070685_10353059 | Ga0070685_103530592 | 120 |
| 152 | 3300005530 | Ga0070679_100110512 | Ga0070679_1001105122 | 120 |
| 153 | 3300005535 | Ga0070684_100226954 | Ga0070684_1002269542 | 120 |
| 154 | 3300005539 | Ga0068853_100005538 | Ga0068853_1000055384 | 120 |
| 155 | 3300005543 | Ga0070672_100008427 | Ga0070672_1000084274 | 120 |
| 156 | 3300005544 | Ga0070686_100056131 | Ga0070686_1000561312 | 120 |
| 157 | 3300005547 | Ga0070693_100120229 | Ga0070693_1001202292 | 120 |
| 158 | 3300005548 | Ga0070665_100183023 | Ga0070665_1001830232 | 120 |
| 159 | 3300005563 | Ga0068855_100353202 | Ga0068855_1003532022 | 120 |
| 160 | 3300005564 | Ga0070664_100354444 | Ga0070664_1003544442 | 120 |
| 161 | 3300005577 | Ga0068857_100025757 | Ga0068857_1000257572 | 120 |
| 162 | 3300005578 | Ga0068854_100159191 | Ga0068854_1001591912 | 120 |
| 163 | 3300005615 | Ga0070702_100090805 | Ga0070702_1000908052 | 120 |
| 164 | 3300005616 | Ga0068852_100015794 | Ga0068852_1000157942 | 120 |
| 165 | 3300005719 | Ga0068861_100044491 | Ga0068861_1000444912 | 120 |
| 166 | 3300005834 | Ga0068851_10036047 | Ga0068851_100360472 | 120 |
| 167 | 3300005842 | Ga0068858_100017985 | Ga0068858_1000179854 | 120 |
| 168 | 3300005843 | Ga0068860_101028484 | Ga0068860_1010284842 | 120 |
| 169 | 3300005844 | Ga0068862_100072221 | Ga0068862_1000722212 | 120 |
| 170 | 3300006038 | Ga0075365_10140837 | Ga0075365_101408372 | 120 |
| 171 | 3300006048 | Ga0075363_100004498 | Ga0075363_1000044982 | 120 |
| 172 | 3300006881 | Ga0068865_100009667 | Ga0068865_1000096674 | 120 |
| 173 | 3300009094 | Ga0111539_11858055 | Ga0111539_118580551 | 120 |
| 174 | 3300009098 | Ga0105245_10084453 | Ga0105245_100844533 | 120 |
| 175 | 3300009148 | Ga0105243_10003860 | Ga0105243_100038608 | 120 |
| 176 | 3300009551 | Ga0105238_10227718 | Ga0105238_102277182 | 120 |
| 177 | 3300009553 | Ga0105249_10021757 | Ga0105249_100217572 | 120 |
| 178 | 3300010375 | Ga0105239_10074998 | Ga0105239_100749983 | 120 |
| 179 | 3300013102 | Ga0157371_10208979 | Ga0157371_102089791 | 120 |
| 180 | 3300013307 | Ga0157372_10134485 | Ga0157372_101344852 | 120 |
| 181 | 3300013308 | Ga0157375_10071155 | Ga0157375_100711552 | 120 |
| 182 | 3300014326 | Ga0157380_10021985 | Ga0157380_100219852 | 120 |
| 183 | 3300014745 | Ga0157377_10004561 | Ga0157377_100045614 | 120 |
| 184 | 3300025909 | Ga0207705_10059362 | Ga0207705_100593622 | 120 |
| 185 | 3300025919 | Ga0207657_10003551 | Ga0207657_1000355114 | 120 |
| 186 | 3300025920 | Ga0207649_10146298 | Ga0207649_101462982 | 120 |
| 187 | 3300025921 | Ga0207652_10167948 | Ga0207652_101679482 | 120 |
| 188 | 3300025924 | Ga0207694_10335871 | Ga0207694_103358712 | 120 |
| 189 | 3300025926 | Ga0207659_10053199 | Ga0207659_100531992 | 120 |
| 190 | 3300025927 | Ga0207687_10019939 | Ga0207687_100199393 | 120 |
| 191 | 3300025932 | Ga0207690_10003342 | Ga0207690_100033424 | 120 |
| 192 | 3300025933 | Ga0207706_10002862 | Ga0207706_1000286217 | 120 |
| 193 | 3300025935 | Ga0207709_10003188 | Ga0207709_100031887 | 120 |
| 194 | 3300025936 | Ga0207670_10013087 | Ga0207670_100130872 | 120 |
| 195 | 3300025938 | Ga0207704_10156626 | Ga0207704_101566262 | 120 |
| 196 | 3300025940 | Ga0207691_10005911 | Ga0207691_100059113 | 120 |
| 197 | 3300025944 | Ga0207661_10092107 | Ga0207661_100921072 | 120 |
| 198 | 3300025972 | Ga0207668_10019301 | Ga0207668_100193012 | 120 |
| 199 | 3300025986 | Ga0207658_10316234 | Ga0207658_103162342 | 120 |
| 200 | 3300026023 | Ga0207677_10052304 | Ga0207677_100523042 | 120 |
| 201 | 3300026035 | Ga0207703_10011408 | Ga0207703_100114086 | 120 |
| 202 | 3300026041 | Ga0207639_10017169 | Ga0207639_100171694 | 120 |
| 203 | 3300026067 | Ga0207678_10008086 | Ga0207678_100080862 | 120 |
| 204 | 3300026075 | Ga0207708_10001275 | Ga0207708_1000127518 | 120 |
| 205 | 3300026089 | Ga0207648_10211642 | Ga0207648_102116422 | 120 |
| 206 | 3300026116 | Ga0207674_10117797 | Ga0207674_101177972 | 120 |
| 207 | 3300026118 | Ga0207675_100009627 | Ga0207675_1000096278 | 120 |
| 208 | 3300026121 | Ga0207683_10131609 | Ga0207683_101316092 | 120 |
| 209 | 3300028379 | Ga0268266_10018782 | Ga0268266_100187824 | 120 |
| 210 | 3300028380 | Ga0268265_10161645 | Ga0268265_101616452 | 120 |
| 211 | 3300028381 | Ga0268264_10993319 | Ga0268264_109933192 | 120 |
| 212 | 3300031728 | Ga0316578_10318216 | Ga0316578_103182161 | 120 |
| 213 | 3300036712 | Ga0316584_0187068 | Ga0316584_0187068_558_941 | 120 |
| 214 | 3300042530 | Ga0450916_048938 | Ga0450916_048938_87_470 | 120 |
| 215 | 3300048911 | Ga0496108_0066954 | Ga0496108_0066954_2181_2564 | 120 |
| 216 | 3300048912 | Ga0496109_0011164 | Ga0496109_0011164_4633_5016 | 120 |
| 217 | 3300048917 | Ga0496114_0611352 | Ga0496114_0611352_467_850 | 120 |
| 218 | 3300050490 | nmdc:mga03n38_2423_c1 | nmdc:mga03n38_2423_c1_4710_5093 | 120 |
| 219 | 3300050491 | nmdc:mga00v17_401045_c1 | nmdc:mga00v17_401045_c1_327_710 | 120 |
| 220 | 3300050492 | nmdc:mga0yw44_167179_c1 | nmdc:mga0yw44_167179_c1_107_490 | 120 |
| 221 | 3300050511 | nmdc:mga08y16_583388_c1 | nmdc:mga08y16_583388_c1_66_449 | 120 |
| 222 | 3300049586 | Ga0501070_0045729 | Ga0501070_0045729_3010_3387 | 125 |
| 223 | 3300003659 | JGI25404J52841_10002650 | JGI25404J52841_100026502 | 132 |
| 224 | 3300005983 | Ga0081540_1000868 | Ga0081540_100086817 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wdy-assembly1.cif.gz_A | crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a | 0.9078 | 2 | 113 |
| 2wds-assembly1.cif.gz_A | crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a | 0.9074 | 2 | 113 |
| 2jca-assembly1.cif.gz_A | crystal structure of the streptomyces coelicolor holo- [acyl-carrier-protein] synthase (acps) at 2 a. | 0.9063 | 1 | 113 |
| 5xuh-assembly1.cif.gz_C | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa | 0.8919 | 1 | 114 |
| 6ql9-assembly1.cif.gz_D | structure of fatty acid synthase complex from saccharomyces cerevisiae at 2.9 angstrom | 0.8861 | 4 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wdyA00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9078 | 2 | 113 | 3.90.470.20 |
| 4jm7A01 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8715 | 1 | 114 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.871 | 1 | 114 | 3.90.470.20 |
| 5xukA00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8582 | 5 | 113 | 3.90.470.20 |
| af_Q552R4_1_166_3.90.470.20 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8572 | 1 | 119 | 3.90.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9KAA3-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9736 | 4 | 112 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A399Y3R3-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9571 | 1 | 113 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A3C1CEV4-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9558 | 1 | 114 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A7C6NTL9-F1-model_v4 | Holo-ACP synthase (EC 2.7.8.7) | 0.9555 | 3 | 112 |
GO:0000287
GO:0006633 GO:0008897 |
| AF-A0A538B6I4-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9555 | 1 | 114 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar