F335791

General Info

Members Datasets Scaffolds Average Seq Length
223 166 446 225

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0083542|Ga0373953_0083542_384_1166
Length 260
Sequence LLEIGSIGALIFWRSTIFSETVFGFFRIMLKGLGMLRPSGKPGRDCPRCPRLVAFRTTWREKEPDWFNAPVASFGPIDARLLIVGLAPGLRGANRTGRPFTGDYAGDLLYATLKGFGFAQGTYDARPDDGLTLSDCRITNAVRCVPPENKPTPQEITTCRGFLSQTIGEMPKLRAIVALGRVAHETVVRARSARLADHPFAHGGVRAMGEIILFDSYHCSRYNTNTGVLTPQMFRDVFAKVRAHLNAGEHAIVAEKPADA

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
58 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
59 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
60 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
61 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
166 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.45
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 4.93
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0083542 3300035117 Bacteria 1330
2 JGI24744J21845_10025847 3300002077 Bacteria 1142
3 JGI24033J26618_1007083 3300002155 Bacteria 1268
4 JGI24034J26672_10011785 3300002239 Bacteria 1313
5 Ga0068869_100077459 3300005334 Bacteria 2474
6 Ga0070671_100076968 3300005355 Bacteria 2788
7 Ga0070713_100023564 3300005436 Bacteria 4779
8 Ga0070711_100029111 3300005439 Bacteria 3641
9 Ga0070711_100045248 3300005439 Bacteria 2993
10 Ga0070694_100160806 3300005444 Bacteria 1648
11 Ga0070678_100157907 3300005456 Bacteria 1834
12 Ga0070679_100015158 3300005530 Bacteria 7406
13 Ga0070679_100029852 3300005530 Bacteria 5380
14 Ga0070693_100052273 3300005547 Bacteria 2342
15 Ga0070665_100516493 3300005548 Bacteria 1206
16 Ga0068855_100184795 3300005563 Bacteria 2355
17 Ga0068856_100384720 3300005614 Bacteria 1422
18 Ga0070702_100030724 3300005615 Bacteria 2931
19 Ga0068859_100257876 3300005617 Bacteria 1834
20 Ga0068861_100505336 3300005719 Bacteria 1093
21 Ga0068851_10219879 3300005834 Bacteria 1067
22 Ga0068863_100038622 3300005841 Bacteria 4541
23 Ga0068862_100362506 3300005844 Bacteria 1347
24 Ga0070712_100182702 3300006175 Bacteria 1635
25 Ga0070712_100376320 3300006175 Bacteria 1168
26 Ga0075367_10318240 3300006178 Bacteria 980
27 Ga0068865_100346928 3300006881 Bacteria 1201
28 Ga0075436_100238803 3300006914 Bacteria 1292
29 Ga0097620_100257856 3300006931 Bacteria 1834
30 Ga0105248_10019772 3300009177 Bacteria 7457
31 Ga0105237_10203368 3300009545 Bacteria 1981
32 Ga0105238_10132204 3300009551 Bacteria 2474
33 Ga0105030_100573 3300009987 Bacteria 3279
34 Ga0157374_10385229 3300013296 Bacteria 1397
35 Ga0157378_10098522 3300013297 Bacteria 2666
36 Ga0163162_10423637 3300013306 Bacteria 1463
37 Ga0157514_120578 3300013874 Bacteria 1005
38 Ga0157379_10534457 3300014968 Bacteria 1089
39 Ga0157379_10767950 3300014968 Bacteria 908
40 Ga0213872_10121624 3300021361 Bacteria 1154
41 Ga0213875_10001740 3300021388 Bacteria 13640
42 Ga0213875_10003445 3300021388 Bacteria 9007
43 Ga0228598_1003214 3300024227 Bacteria 3521
44 Ga0207688_10023589 3300025901 Bacteria 3370
45 Ga0207671_10172580 3300025914 Bacteria 1680
46 Ga0207693_10009427 3300025915 Bacteria 7960
47 Ga0207693_10775059 3300025915 Bacteria 740
48 Ga0207660_10159140 3300025917 Bacteria 1741
49 Ga0207681_10230941 3300025923 Bacteria 1436
50 Ga0207700_10130080 3300025928 Bacteria 2054
51 Ga0207700_10385422 3300025928 Bacteria 1226
52 Ga0207664_10742703 3300025929 Bacteria 883
53 Ga0207644_10117820 3300025931 Bacteria 2017
54 Ga0207709_10092005 3300025935 Bacteria 1985
55 Ga0207704_10133771 3300025938 Bacteria 1722
56 Ga0207667_10164789 3300025949 Bacteria 2279
57 Ga0207703_10239602 3300026035 Bacteria 1630
58 Ga0207678_10021831 3300026067 Bacteria 5615
59 Ga0207674_10034278 3300026116 Bacteria 5309
60 Ga0207683_10364941 3300026121 Bacteria 1326
61 Ga0265760_10028396 3300031090 Bacteria 1642
62 Ga0265331_10217029 3300031250 Bacteria 860
63 Ga0307508_10000010 3300031616 Bacteria 255747
64 Ga0316583_10000330 3300032133 Bacteria 13396
65 Ga0373926_0077714 3300035083 Bacteria 1225
66 Ga0373934_0049203 3300035086 Bacteria 1669
67 Ga0373944_0064569 3300035089 Bacteria 1181
68 Ga0373936_0008098 3300035113 Bacteria 3952
69 Ga0373936_0027001 3300035113 Bacteria 2251
70 Ga0373954_0098511 3300035118 Bacteria 1409
71 Ga0373943_0069467 3300035170 Bacteria 1780
72 Ga0373946_0061042 3300035171 Bacteria 1604
73 Ga0373955_0101836 3300035172 Bacteria 1650
74 Ga0373955_0420782 3300035172 Bacteria 813
75 Ga0316574_0160599 3300035398 Bacteria 1447
76 Ga0373935_0320752 3300035692 Bacteria 1099
77 Ga0373927_0116357 3300035695 Bacteria 1743
78 Ga0373947_0005532 3300035725 Bacteria 7367
79 Ga0373947_0115235 3300035725 Bacteria 1703
80 Ga0373947_0263307 3300035725 Bacteria 1143
81 Ga0373947_0357664 3300035725 Bacteria 980
82 Ga0373937_0003012 3300036401 Bacteria 14128
83 Ga0373937_0056732 3300036401 Bacteria 3597
84 Ga0373937_0579123 3300036401 Bacteria 1066
85 Ga0373937_0606193 3300036401 Unclassified 1039
86 Ga0373925_0040502 3300037068 Bacteria 3449
87 Ga0373925_0169884 3300037068 Bacteria 1721
88 Ga0373925_0348368 3300037068 Bacteria 1202
89 Ga0436364_0691025 3300037853 Bacteria 19520
90 Ga0436364_1520677 3300037853 Bacteria 72551
91 Ga0436365_0924125 3300039437 Bacteria 1656
92 Ga0436361_0460373 3300039447 Bacteria 5010
93 Ga0436361_0476641 3300039447 Bacteria 1262
94 Ga0436361_1153265 3300039447 Bacteria 1241
95 Ga0436361_1196158 3300039447 Bacteria 10146
96 Ga0436363_1242834 3300039450 Bacteria 904
97 Ga0436363_1524233 3300039450 Bacteria 3974
98 Ga0439465_0050535 3300041413 Bacteria 1360
99 Ga0466970_0366540 3300044765 Bacteria 819
100 Ga0495592_0003741 3300046454 Bacteria 10971
101 Ga0495592_0052533 3300046454 Bacteria 3025
102 Ga0495603_0003582 3300046455 Bacteria 9244
103 Ga0495629_0126805 3300046459 Bacteria 1778
104 Ga0495629_0467324 3300046459 Bacteria 853
105 Ga0495651_0002343 3300046462 Bacteria 14627
106 Ga0495651_0045059 3300046462 Bacteria 3417
107 Ga0495653_0031114 3300046463 Bacteria 4244
108 Ga0495582_0001849 3300046473 Bacteria 11949
109 Ga0495639_0002789 3300046475 Bacteria 7596
110 Ga0495662_0149764 3300046476 Bacteria 1149
111 Ga0495664_0081217 3300046477 Bacteria 1944
112 Ga0495664_0172416 3300046477 Bacteria 1312
113 Ga0495608_0004237 3300046511 Bacteria 10278
114 Ga0495618_0012016 3300046514 Bacteria 5254
115 Ga0495618_0085027 3300046514 Bacteria 2021
116 Ga0495618_0361277 3300046514 Bacteria 893
117 Ga0495628_0157298 3300046516 Bacteria 1728
118 Ga0495630_0051159 3300046517 Bacteria 3092
119 Ga0495630_0074860 3300046517 Bacteria 2551
120 Ga0495630_0148021 3300046517 Bacteria 1786
121 Ga0495666_0032765 3300046526 Bacteria 2542
122 Ga0495652_0010318 3300046529 Bacteria 8462
123 Ga0495652_0140505 3300046529 Bacteria 1899
124 Ga0495652_0496533 3300046529 Bacteria 847
125 Ga0495665_0127672 3300046531 Bacteria 1332
126 Ga0495640_0008333 3300046533 Bacteria 8127
127 Ga0495587_0009211 3300046536 Bacteria 6334
128 Ga0495597_0237795 3300046542 Bacteria 719
129 Ga0495633_0019102 3300046558 Bacteria 3469
130 Ga0495667_0001577 3300046559 Bacteria 15129
131 Ga0495634_0019671 3300046642 Bacteria 4795
132 Ga0495634_0022159 3300046642 Bacteria 4477
133 Ga0495635_0299449 3300046663 Bacteria 1078
134 Ga0495588_0021571 3300046674 Bacteria 3175
135 Ga0495657_0012782 3300046675 Bacteria 6223
136 Ga0495599_0037619 3300046678 Bacteria 3040
137 Ga0495623_0003992 3300046679 Bacteria 9714
138 Ga0495623_0054206 3300046679 Bacteria 2530
139 Ga0495647_0005036 3300046681 Bacteria 4327
140 Ga0495669_0114331 3300046684 Bacteria 1262
141 Ga0495613_0116533 3300046689 Bacteria 1921
142 Ga0495624_0007981 3300046690 Bacteria 7422
143 Ga0495624_0071655 3300046690 Bacteria 2156
144 Ga0495670_0116254 3300046691 Bacteria 1387
145 Ga0495671_0097118 3300046692 Bacteria 1441
146 Ga0495600_0042159 3300046809 Bacteria 2975
147 Ga0495581_0008013 3300047315 Bacteria 6118
148 Ga0495581_0061935 3300047315 Bacteria 2162
149 Ga0495604_0003327 3300047317 Bacteria 12810
150 Ga0495674_0013020 3300047319 Bacteria 7829
151 Ga0495674_0173327 3300047319 Bacteria 1799
152 Ga0495674_0566970 3300047319 Bacteria 902
153 Ga0495676_0206543 3300047321 Bacteria 1362
154 Ga0495680_0007313 3300047322 Bacteria 10159
155 Ga0495684_0004456 3300047471 Bacteria 10948
156 Ga0495684_0219256 3300047471 Bacteria 1395
157 Ga0495593_0016923 3300047673 Bacteria 4103
158 Ga0495602_0024110 3300048088 Bacteria 5906
159 Ga0495602_0055621 3300048088 Bacteria 3484
160 Ga0495602_0290734 3300048088 Bacteria 1200
161 Ga0495602_0305602 3300048088 Bacteria 1162
162 Ga0495602_0340394 3300048088 Bacteria 1085
163 Ga0496101_0242931 3300048904 Bacteria 1401
164 Ga0496102_0229384 3300048905 Bacteria 1751
165 Ga0496103_0063140 3300048906 Bacteria 2306
166 Ga0496103_0436004 3300048906 Bacteria 841
167 Ga0496105_0195099 3300048908 Bacteria 1654
168 Ga0496106_0142868 3300048909 Bacteria 1883
169 Ga0496109_0110185 3300048912 Bacteria 2559
170 Ga0496111_0036165 3300048914 Bacteria 3530
171 Ga0496112_0034499 3300048915 Bacteria 4924
172 Ga0496112_0179236 3300048915 Bacteria 2083
173 Ga0496112_0811397 3300048915 Bacteria 860
174 Ga0496126_0014508 3300048929 Bacteria 7962
175 Ga0501032_0070872 3300049569 Bacteria 2324
176 Ga0501033_0031410 3300049570 Bacteria 3991
177 Ga0501034_0253529 3300049571 Bacteria 1704
178 Ga0501034_0393860 3300049571 Bacteria 1309
179 Ga0501036_0010017 3300049572 Bacteria 7808
180 Ga0501037_0360463 3300049573 Bacteria 1002
181 Ga0501038_0038621 3300049574 Bacteria 4180
182 Ga0501038_0162852 3300049574 Bacteria 1811
183 Ga0501039_0018791 3300049575 Bacteria 5305
184 Ga0501040_0079041 3300049576 Bacteria 2276
185 Ga0501042_0055918 3300049578 Bacteria 2816
186 Ga0501043_0150721 3300049579 Bacteria 1820
187 Ga0501046_0045885 3300049580 Bacteria 3469
188 Ga0501047_0155788 3300049581 Bacteria 2158
189 Ga0501067_0052570 3300049583 Bacteria 2257
190 Ga0501070_0197081 3300049586 Bacteria 1654
191 Ga0501071_0019423 3300049587 Bacteria 4715
192 Ga0501073_0000695 3300049589 Bacteria 23661
193 Ga0501074_0112725 3300049590 Bacteria 1946
194 Ga0501075_0105416 3300049591 Bacteria 2142
195 Ga0501075_0181183 3300049591 Bacteria 1607
196 Ga0501076_0018637 3300049592 Bacteria 5296
197 Ga0501077_0026735 3300049593 Bacteria 3663
198 Ga0501080_0010827 3300049742 Bacteria 8345
199 Ga0501080_0122966 3300049742 Bacteria 2404
200 Ga0501081_0442881 3300049743 Bacteria 964
201 Ga0501083_0220097 3300049744 Bacteria 1237
202 Ga0501044_0030809 3300049823 Bacteria 5650
203 Ga0501045_0420784 3300049824 Bacteria 994
204 nmdc:mga0yw44_14473_c1 3300050492 Bacteria 2450
205 nmdc:mga0yw44_316884_c1 3300050492 Bacteria 1047
206 nmdc:mga0yw44_605_c1 3300050492 Bacteria 12983
207 nmdc:mga0n895_838610_c1 3300050512 Bacteria 908
208 nmdc:mga08x19_224044_c1 3300050514 Bacteria 1293
209 nmdc:mga0a205_328276_c1 3300050515 Bacteria 1400
210 Ga0495601_0014139 3300053077 Bacteria 4808
211 Ga0495601_0089680 3300053077 Bacteria 1977
212 Ga0495601_0427658 3300053077 Bacteria 857
213 Ga0495612_0004148 3300053078 Bacteria 6003
214 Ga0495595_0001212 3300053084 Bacteria 10028
215 Ga0495595_0244688 3300053084 Bacteria 897
216 Ga0495619_0004131 3300053085 Bacteria 9278
217 Ga0501084_0045763 3300054114 Bacteria 3663
218 Ga0501082_0048473 3300060353 Bacteria 3661
219 Ga0501082_0095729 3300060353 Bacteria 2566
220 Ga0530510_0191230 3300061734 Bacteria 1519
221 Ga0530510_0358390 3300061734 Bacteria 1096
222 2643756070 2643221547 Bacteria 4740017
223 2644288175 2643221651 Bacteria 4798932
224 Ga0373953_0083542
225 JGI24744J21845_10025847
226 JGI24033J26618_1007083
227 JGI24034J26672_10011785
228 Ga0068869_100077459
229 Ga0070671_100076968
230 Ga0070713_100023564
231 Ga0070711_100029111
232 Ga0070711_100045248
233 Ga0070694_100160806
234 Ga0070678_100157907
235 Ga0070679_100015158
236 Ga0070679_100029852
237 Ga0070693_100052273
238 Ga0070665_100516493
239 Ga0068855_100184795
240 Ga0068856_100384720
241 Ga0070702_100030724
242 Ga0068859_100257876
243 Ga0068861_100505336
244 Ga0068851_10219879
245 Ga0068863_100038622
246 Ga0068862_100362506
247 Ga0070712_100182702
248 Ga0070712_100376320
249 Ga0075367_10318240
250 Ga0068865_100346928
251 Ga0075436_100238803
252 Ga0097620_100257856
253 Ga0105248_10019772
254 Ga0105237_10203368
255 Ga0105238_10132204
256 Ga0105030_100573
257 Ga0157374_10385229
258 Ga0157378_10098522
259 Ga0163162_10423637
260 Ga0157514_120578
261 Ga0157379_10534457
262 Ga0157379_10767950
263 Ga0213872_10121624
264 Ga0213875_10001740
265 Ga0213875_10003445
266 Ga0228598_1003214
267 Ga0207688_10023589
268 Ga0207671_10172580
269 Ga0207693_10009427
270 Ga0207693_10775059
271 Ga0207660_10159140
272 Ga0207681_10230941
273 Ga0207700_10130080
274 Ga0207700_10385422
275 Ga0207664_10742703
276 Ga0207644_10117820
277 Ga0207709_10092005
278 Ga0207704_10133771
279 Ga0207667_10164789
280 Ga0207703_10239602
281 Ga0207678_10021831
282 Ga0207674_10034278
283 Ga0207683_10364941
284 Ga0265760_10028396
285 Ga0265331_10217029
286 Ga0307508_10000010
287 Ga0316583_10000330
288 Ga0373926_0077714
289 Ga0373934_0049203
290 Ga0373944_0064569
291 Ga0373936_0008098
292 Ga0373936_0027001
293 Ga0373954_0098511
294 Ga0373943_0069467
295 Ga0373946_0061042
296 Ga0373955_0101836
297 Ga0373955_0420782
298 Ga0316574_0160599
299 Ga0373935_0320752
300 Ga0373927_0116357
301 Ga0373947_0005532
302 Ga0373947_0115235
303 Ga0373947_0263307
304 Ga0373947_0357664
305 Ga0373937_0003012
306 Ga0373937_0056732
307 Ga0373937_0579123
308 Ga0373937_0606193
309 Ga0373925_0040502
310 Ga0373925_0169884
311 Ga0373925_0348368
312 Ga0436364_0691025
313 Ga0436364_1520677
314 Ga0436365_0924125
315 Ga0436361_0460373
316 Ga0436361_0476641
317 Ga0436361_1153265
318 Ga0436361_1196158
319 Ga0436363_1242834
320 Ga0436363_1524233
321 Ga0439465_0050535
322 Ga0466970_0366540
323 Ga0495592_0003741
324 Ga0495592_0052533
325 Ga0495603_0003582
326 Ga0495629_0126805
327 Ga0495629_0467324
328 Ga0495651_0002343
329 Ga0495651_0045059
330 Ga0495653_0031114
331 Ga0495582_0001849
332 Ga0495639_0002789
333 Ga0495662_0149764
334 Ga0495664_0081217
335 Ga0495664_0172416
336 Ga0495608_0004237
337 Ga0495618_0012016
338 Ga0495618_0085027
339 Ga0495618_0361277
340 Ga0495628_0157298
341 Ga0495630_0051159
342 Ga0495630_0074860
343 Ga0495630_0148021
344 Ga0495666_0032765
345 Ga0495652_0010318
346 Ga0495652_0140505
347 Ga0495652_0496533
348 Ga0495665_0127672
349 Ga0495640_0008333
350 Ga0495587_0009211
351 Ga0495597_0237795
352 Ga0495633_0019102
353 Ga0495667_0001577
354 Ga0495634_0019671
355 Ga0495634_0022159
356 Ga0495635_0299449
357 Ga0495588_0021571
358 Ga0495657_0012782
359 Ga0495599_0037619
360 Ga0495623_0003992
361 Ga0495623_0054206
362 Ga0495647_0005036
363 Ga0495669_0114331
364 Ga0495613_0116533
365 Ga0495624_0007981
366 Ga0495624_0071655
367 Ga0495670_0116254
368 Ga0495671_0097118
369 Ga0495600_0042159
370 Ga0495581_0008013
371 Ga0495581_0061935
372 Ga0495604_0003327
373 Ga0495674_0013020
374 Ga0495674_0173327
375 Ga0495674_0566970
376 Ga0495676_0206543
377 Ga0495680_0007313
378 Ga0495684_0004456
379 Ga0495684_0219256
380 Ga0495593_0016923
381 Ga0495602_0024110
382 Ga0495602_0055621
383 Ga0495602_0290734
384 Ga0495602_0305602
385 Ga0495602_0340394
386 Ga0496101_0242931
387 Ga0496102_0229384
388 Ga0496103_0063140
389 Ga0496103_0436004
390 Ga0496105_0195099
391 Ga0496106_0142868
392 Ga0496109_0110185
393 Ga0496111_0036165
394 Ga0496112_0034499
395 Ga0496112_0179236
396 Ga0496112_0811397
397 Ga0496126_0014508
398 Ga0501032_0070872
399 Ga0501033_0031410
400 Ga0501034_0253529
401 Ga0501034_0393860
402 Ga0501036_0010017
403 Ga0501037_0360463
404 Ga0501038_0038621
405 Ga0501038_0162852
406 Ga0501039_0018791
407 Ga0501040_0079041
408 Ga0501042_0055918
409 Ga0501043_0150721
410 Ga0501046_0045885
411 Ga0501047_0155788
412 Ga0501067_0052570
413 Ga0501070_0197081
414 Ga0501071_0019423
415 Ga0501073_0000695
416 Ga0501074_0112725
417 Ga0501075_0105416
418 Ga0501075_0181183
419 Ga0501076_0018637
420 Ga0501077_0026735
421 Ga0501080_0010827
422 Ga0501080_0122966
423 Ga0501081_0442881
424 Ga0501083_0220097
425 Ga0501044_0030809
426 Ga0501045_0420784
427 nmdc:mga0yw44_14473_c1
428 nmdc:mga0yw44_316884_c1
429 nmdc:mga0yw44_605_c1
430 nmdc:mga0n895_838610_c1
431 nmdc:mga08x19_224044_c1
432 nmdc:mga0a205_328276_c1
433 Ga0495601_0014139
434 Ga0495601_0089680
435 Ga0495601_0427658
436 Ga0495612_0004148
437 Ga0495595_0001212
438 Ga0495595_0244688
439 Ga0495619_0004131
440 Ga0501084_0045763
441 Ga0501082_0048473
442 Ga0501082_0095729
443 Ga0530510_0191230
444 Ga0530510_0358390
445 2643756070
446 2644288175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

72

242

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9282 10 209
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8471 10 209
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.8014 10 210
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7954 10 209
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7822 10 213
ID Description Score Start End Superfamily
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9144 10 209 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9075 12 209 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8343 10 209 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8132 12 209 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7954 10 209 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A1M3ADW1-F1-model_v4 deleted 0.9932 15 172
AF-A0A6N7AJZ6-F1-model_v4 Uracil-DNA glycosylase 0.9902 7 147 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A521VYS5-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9897 8 213 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A3D2L3Z4-F1-model_v4 Uracil-DNA glycosylase 0.9896 17 148 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A380W9D4-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9895 8 212 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539

Map