F335745
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 223 | 160 | 211 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10020102|Ga0265327_100201022 |
| Length | 278 |
| Sequence | MTHTIYNTTLTVIIATKGAELQSIVNNNTGLEYMWSGDPAFWAKKSPVLFPVVGGLKNNQYTHNGYTYQLGRHGFAREMEFAVTAQQGNAITFTLADNAETLKNYPFHFSFSVTYTLQQNTVAILFSVGGHPAFKVPVAPGTTFTDYYLQFSHAETAGRYPLDAGGQVETYTTPVLTDASVLPLTKQLFYQDALVFKHLQSNSISIKSNATPHGLAVQFDGFPYMGIWNAKDADFVCIEPWCGIADSVNTTGRLREKEGINTLPPHQTFERTWSVTVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 5 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 6 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 7 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 8 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 9 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 10 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 11 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 12 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 13 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 144 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 145 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 147 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 151 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 152 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 153 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 154 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 155 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 156 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 157 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 158 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 159 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 160 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.62 |
| Metatranscriptomes | 0 |
| Isolates | 5.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.59 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 75.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3032561 | 2162886007 | Bacteria | 2286 |
| 2 | JGI25406J46586_10008656 | 3300003203 | Bacteria | 4593 |
| 3 | JGI25153J46596_10031953 | 3300003215 | Bacteria | 1763 |
| 4 | rootH1_10094733 | 3300003316 | Bacteria | 2161 |
| 5 | rootH1_10140623 | 3300003316 | Unclassified | 1551 |
| 6 | rootH2_10134444 | 3300003320 | Unclassified | 1411 |
| 7 | rootL2_10097932 | 3300003322 | Bacteria | 1637 |
| 8 | rootL2_10171240 | 3300003322 | Bacteria | 2012 |
| 9 | rootL2_10213595 | 3300003322 | Unclassified | 1704 |
| 10 | rootH1_10001828 | 3300003323 | Bacteria | 91608 |
| 11 | rootH1_10157185 | 3300003323 | Unclassified | 3842 |
| 12 | JGI25160J50197_1001007 | 3300003354 | Bacteria | 14612 |
| 13 | JGI25160J50197_1003141 | 3300003354 | Bacteria | 7515 |
| 14 | JGI25160J50197_1009800 | 3300003354 | Unclassified | 3519 |
| 15 | Ga0055526_1005527 | 3300003771 | Bacteria | 7231 |
| 16 | Ga0055528_1000029 | 3300003790 | Bacteria | 122126 |
| 17 | Ga0055530_10000551 | 3300003791 | Bacteria | 32460 |
| 18 | Ga0055543_1007795 | 3300004625 | Unclassified | 2438 |
| 19 | Ga0065165_1000052 | 3300005262 | Bacteria | 192010 |
| 20 | Ga0065704_10071217 | 3300005289 | Bacteria | 12422 |
| 21 | Ga0070676_10227858 | 3300005328 | Bacteria | 1234 |
| 22 | Ga0070683_100006837 | 3300005329 | Bacteria | 9584 |
| 23 | Ga0070666_10000494 | 3300005335 | Bacteria | 23741 |
| 24 | Ga0070666_10037201 | 3300005335 | Bacteria | 3235 |
| 25 | Ga0070682_100053209 | 3300005337 | Bacteria | 2536 |
| 26 | Ga0068868_100013381 | 3300005338 | Bacteria | 6018 |
| 27 | Ga0068868_100109005 | 3300005338 | Bacteria | 2248 |
| 28 | Ga0070660_100006257 | 3300005339 | Bacteria | 8242 |
| 29 | Ga0070661_100020635 | 3300005344 | Bacteria | 4699 |
| 30 | Ga0070668_100026744 | 3300005347 | Bacteria | 4380 |
| 31 | Ga0070675_100035875 | 3300005354 | Bacteria | 4032 |
| 32 | Ga0070671_100111145 | 3300005355 | Bacteria | 2302 |
| 33 | Ga0070674_100020099 | 3300005356 | Bacteria | 4258 |
| 34 | Ga0070674_100342178 | 3300005356 | Unclassified | 1205 |
| 35 | Ga0070688_100093674 | 3300005365 | Unclassified | 1968 |
| 36 | Ga0070667_100477337 | 3300005367 | Bacteria | 1141 |
| 37 | Ga0070667_100505571 | 3300005367 | Bacteria | 1108 |
| 38 | Ga0070662_100090653 | 3300005457 | Bacteria | 2295 |
| 39 | Ga0070681_10581059 | 3300005458 | Bacteria | 1034 |
| 40 | Ga0070679_100008654 | 3300005530 | Bacteria | 9590 |
| 41 | Ga0070684_100012440 | 3300005535 | Bacteria | 6820 |
| 42 | Ga0068853_100005138 | 3300005539 | Bacteria | 10233 |
| 43 | Ga0068855_100032179 | 3300005563 | Bacteria | 6262 |
| 44 | Ga0068856_100108043 | 3300005614 | Bacteria | 2778 |
| 45 | Ga0068852_100004300 | 3300005616 | Bacteria | 10051 |
| 46 | Ga0068852_100039669 | 3300005616 | Bacteria | 3966 |
| 47 | Ga0068852_100078340 | 3300005616 | Bacteria | 2924 |
| 48 | Ga0068859_100000186 | 3300005617 | Bacteria | 60206 |
| 49 | Ga0068859_100015423 | 3300005617 | Bacteria | 7676 |
| 50 | Ga0068864_100070052 | 3300005618 | Bacteria | 3051 |
| 51 | Ga0068864_100191057 | 3300005618 | Bacteria | 1877 |
| 52 | Ga0068851_10009055 | 3300005834 | Bacteria | 4620 |
| 53 | Ga0068851_10205194 | 3300005834 | Unclassified | 1102 |
| 54 | Ga0068863_100005438 | 3300005841 | Bacteria | 12547 |
| 55 | Ga0068858_100062076 | 3300005842 | Bacteria | 3455 |
| 56 | Ga0068860_100003102 | 3300005843 | Bacteria | 17170 |
| 57 | Ga0068860_100005353 | 3300005843 | Bacteria | 13021 |
| 58 | Ga0068860_100032734 | 3300005843 | Bacteria | 4995 |
| 59 | Ga0068862_100115868 | 3300005844 | Bacteria | 2357 |
| 60 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 61 | Ga0075366_10035885 | 3300006195 | Bacteria | 2923 |
| 62 | Ga0075366_10044865 | 3300006195 | Bacteria | 2621 |
| 63 | Ga0097621_100003878 | 3300006237 | Bacteria | 10364 |
| 64 | Ga0097621_100015597 | 3300006237 | Bacteria | 5723 |
| 65 | Ga0097621_100221440 | 3300006237 | Bacteria | 1649 |
| 66 | Ga0097621_100258874 | 3300006237 | Bacteria | 1526 |
| 67 | Ga0068871_100001708 | 3300006358 | Bacteria | 14762 |
| 68 | Ga0068871_100061246 | 3300006358 | Bacteria | 3073 |
| 69 | Ga0068871_100199389 | 3300006358 | Bacteria | 1727 |
| 70 | Ga0068865_100075805 | 3300006881 | Bacteria | 2399 |
| 71 | Ga0097620_100000186 | 3300006931 | Bacteria | 60206 |
| 72 | Ga0097620_100015423 | 3300006931 | Bacteria | 7676 |
| 73 | Ga0111539_10050413 | 3300009094 | Bacteria | 4959 |
| 74 | Ga0105247_10003454 | 3300009101 | Bacteria | 10301 |
| 75 | Ga0114129_10002933 | 3300009147 | Bacteria | 23860 |
| 76 | Ga0105243_10374851 | 3300009148 | Bacteria | 1314 |
| 77 | Ga0105241_10001285 | 3300009174 | Bacteria | 19162 |
| 78 | Ga0105241_10126914 | 3300009174 | Bacteria | 2061 |
| 79 | Ga0105241_10243245 | 3300009174 | Unclassified | 1522 |
| 80 | Ga0105237_10004660 | 3300009545 | Bacteria | 15793 |
| 81 | Ga0105237_10309252 | 3300009545 | Bacteria | 1583 |
| 82 | Ga0105249_10001561 | 3300009553 | Bacteria | 20115 |
| 83 | Ga0105239_10012454 | 3300010375 | Bacteria | 9472 |
| 84 | Ga0105239_10761816 | 3300010375 | Unclassified | 1108 |
| 85 | Ga0105246_10005693 | 3300011119 | Bacteria | 7604 |
| 86 | Ga0157373_10011593 | 3300013100 | Bacteria | 6475 |
| 87 | Ga0157371_10018347 | 3300013102 | Bacteria | 5175 |
| 88 | Ga0157371_10216817 | 3300013102 | Bacteria | 1374 |
| 89 | Ga0157370_10045509 | 3300013104 | Bacteria | 4210 |
| 90 | Ga0157369_10018134 | 3300013105 | Bacteria | 7896 |
| 91 | Ga0157369_10239902 | 3300013105 | Bacteria | 1894 |
| 92 | Ga0157369_10367025 | 3300013105 | Bacteria | 1494 |
| 93 | Ga0157374_10073565 | 3300013296 | Bacteria | 3226 |
| 94 | Ga0157378_10007312 | 3300013297 | Bacteria | 9643 |
| 95 | Ga0157378_10010661 | 3300013297 | Bacteria | 8030 |
| 96 | Ga0163162_10000266 | 3300013306 | Bacteria | 47442 |
| 97 | Ga0163162_10000503 | 3300013306 | Bacteria | 36430 |
| 98 | Ga0163162_10201217 | 3300013306 | Bacteria | 2120 |
| 99 | Ga0157372_10322378 | 3300013307 | Unclassified | 1799 |
| 100 | Ga0157372_10630615 | 3300013307 | Bacteria | 1249 |
| 101 | Ga0157375_10038978 | 3300013308 | Unclassified | 4568 |
| 102 | Ga0157375_10421999 | 3300013308 | Bacteria | 1500 |
| 103 | Ga0163163_10021503 | 3300014325 | Bacteria | 6090 |
| 104 | Ga0157380_10090484 | 3300014326 | Bacteria | 2524 |
| 105 | Ga0157379_10037792 | 3300014968 | Bacteria | 4306 |
| 106 | Ga0157379_10095047 | 3300014968 | Bacteria | 2674 |
| 107 | Ga0157379_10098079 | 3300014968 | Unclassified | 2631 |
| 108 | Ga0157376_10085987 | 3300014969 | Bacteria | 2711 |
| 109 | Ga0163161_10210902 | 3300017792 | Bacteria | 1500 |
| 110 | Ga0163161_10374454 | 3300017792 | Bacteria | 1137 |
| 111 | Ga0209436_100280 | 3300025208 | Bacteria | 23454 |
| 112 | Ga0209673_1000993 | 3300025273 | Bacteria | 34627 |
| 113 | Ga0209564_1007918 | 3300025295 | Bacteria | 5361 |
| 114 | Ga0209564_1010227 | 3300025295 | Unclassified | 4351 |
| 115 | Ga0209758_1005373 | 3300025297 | Bacteria | 9923 |
| 116 | Ga0209758_1014165 | 3300025297 | Bacteria | 4269 |
| 117 | Ga0209758_1045203 | 3300025297 | Unclassified | 1601 |
| 118 | Ga0209050_1000259 | 3300025298 | Bacteria | 113475 |
| 119 | Ga0207426_1000132 | 3300025302 | Bacteria | 209623 |
| 120 | Ga0207426_1000154 | 3300025302 | Bacteria | 179701 |
| 121 | Ga0207426_1000678 | 3300025302 | Bacteria | 41242 |
| 122 | Ga0209051_1020962 | 3300025303 | Unclassified | 2798 |
| 123 | Ga0209257_1015683 | 3300025304 | Unclassified | 3131 |
| 124 | Ga0207656_10033095 | 3300025321 | Bacteria | 2151 |
| 125 | Ga0207656_10134478 | 3300025321 | Unclassified | 1161 |
| 126 | Ga0207710_10001886 | 3300025900 | Bacteria | 10072 |
| 127 | Ga0207680_10000236 | 3300025903 | Bacteria | 26619 |
| 128 | Ga0207680_10348817 | 3300025903 | Bacteria | 1039 |
| 129 | Ga0207654_10003343 | 3300025911 | Bacteria | 8125 |
| 130 | Ga0207707_10486747 | 3300025912 | Bacteria | 1053 |
| 131 | Ga0207695_10124411 | 3300025913 | Bacteria | 2543 |
| 132 | Ga0207671_10017972 | 3300025914 | Bacteria | 5440 |
| 133 | Ga0207657_10006472 | 3300025919 | Bacteria | 12138 |
| 134 | Ga0207652_10081541 | 3300025921 | Bacteria | 2830 |
| 135 | Ga0207659_10278385 | 3300025926 | Bacteria | 1367 |
| 136 | Ga0207690_10026915 | 3300025932 | Bacteria | 3628 |
| 137 | Ga0207706_10037765 | 3300025933 | Bacteria | 4286 |
| 138 | Ga0207689_10000687 | 3300025942 | Bacteria | 32323 |
| 139 | Ga0207689_10015329 | 3300025942 | Bacteria | 6487 |
| 140 | Ga0207661_10188335 | 3300025944 | Bacteria | 1807 |
| 141 | Ga0207667_10076696 | 3300025949 | Bacteria | 3468 |
| 142 | Ga0207651_10085792 | 3300025960 | Unclassified | 2286 |
| 143 | Ga0207651_10402845 | 3300025960 | Bacteria | 1164 |
| 144 | Ga0207651_10557366 | 3300025960 | Bacteria | 997 |
| 145 | Ga0207712_10001621 | 3300025961 | Bacteria | 15164 |
| 146 | Ga0207640_10255842 | 3300025981 | Bacteria | 1362 |
| 147 | Ga0207658_10016550 | 3300025986 | Bacteria | 5074 |
| 148 | Ga0207658_10184764 | 3300025986 | Bacteria | 1728 |
| 149 | Ga0207677_10042113 | 3300026023 | Bacteria | 3025 |
| 150 | Ga0207677_10282228 | 3300026023 | Bacteria | 1364 |
| 151 | Ga0207703_10004922 | 3300026035 | Bacteria | 10837 |
| 152 | Ga0207639_10212104 | 3300026041 | Bacteria | 1667 |
| 153 | Ga0207702_10029055 | 3300026078 | Bacteria | 4599 |
| 154 | Ga0207641_10000194 | 3300026088 | Bacteria | 82153 |
| 155 | Ga0207648_10397409 | 3300026089 | Bacteria | 1248 |
| 156 | Ga0207676_10190768 | 3300026095 | Bacteria | 1803 |
| 157 | Ga0207676_10370931 | 3300026095 | Bacteria | 1329 |
| 158 | Ga0207674_10017417 | 3300026116 | Bacteria | 7840 |
| 159 | Ga0207698_10013662 | 3300026142 | Bacteria | 5366 |
| 160 | Ga0268264_10002228 | 3300028381 | Bacteria | 17192 |
| 161 | Ga0268264_10024877 | 3300028381 | Bacteria | 4892 |
| 162 | Ga0268264_10041178 | 3300028381 | Bacteria | 3819 |
| 163 | Ga0268264_10362519 | 3300028381 | Bacteria | 1383 |
| 164 | Ga0268264_10484069 | 3300028381 | Bacteria | 1204 |
| 165 | Ga0307515_10000074 | 3300028794 | Bacteria | 229874 |
| 166 | Ga0265327_10000199 | 3300031251 | Bacteria | 125838 |
| 167 | Ga0265327_10020102 | 3300031251 | Bacteria | 4082 |
| 168 | Ga0307513_10248203 | 3300031456 | Bacteria | 1578 |
| 169 | Ga0373931_0187727 | 3300035691 | Bacteria | 1228 |
| 170 | Ga0395900_0254791 | 3300037418 | Bacteria | 1755 |
| 171 | Ga0395900_0475993 | 3300037418 | Bacteria | 1202 |
| 172 | Ga0439449_0038473 | 3300042007 | Unclassified | 1779 |
| 173 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 174 | Ga0466972_0000096 | 3300044658 | Bacteria | 77400 |
| 175 | Ga0466961_0046970 | 3300044693 | Bacteria | 2762 |
| 176 | Ga0466970_0040434 | 3300044765 | Bacteria | 2476 |
| 177 | Ga0466957_0005828 | 3300044842 | Bacteria | 6936 |
| 178 | Ga0466957_0012541 | 3300044842 | Bacteria | 4906 |
| 179 | Ga0466957_0037909 | 3300044842 | Bacteria | 2903 |
| 180 | Ga0495633_0000245 | 3300046558 | Bacteria | 64798 |
| 181 | Ga0495672_0010466 | 3300047320 | Bacteria | 6605 |
| 182 | Ga0501290_004477 | 3300049513 | Bacteria | 1740 |
| 183 | Ga0501032_0026608 | 3300049569 | Bacteria | 3977 |
| 184 | Ga0501033_0034149 | 3300049570 | Bacteria | 3817 |
| 185 | Ga0501034_0066803 | 3300049571 | Unclassified | 3609 |
| 186 | Ga0501034_0129024 | 3300049571 | Bacteria | 2512 |
| 187 | Ga0501036_0279247 | 3300049572 | Bacteria | 1398 |
| 188 | Ga0501037_0218564 | 3300049573 | Bacteria | 1342 |
| 189 | Ga0501038_0146141 | 3300049574 | Bacteria | 1930 |
| 190 | Ga0501039_0234382 | 3300049575 | Bacteria | 1443 |
| 191 | Ga0501043_0042613 | 3300049579 | Bacteria | 3567 |
| 192 | Ga0501047_0016911 | 3300049581 | Bacteria | 6973 |
| 193 | Ga0501219_000069 | 3300049703 | Bacteria | 17436 |
| 194 | Ga0501225_0013433 | 3300049705 | Bacteria | 2291 |
| 195 | Ga0501044_0007248 | 3300049823 | Bacteria | 12192 |
| 196 | Ga0501044_0037867 | 3300049823 | Bacteria | 5040 |
| 197 | Ga0501284_00022 | 3300050005 | Bacteria | 89450 |
| 198 | nmdc:mga0k408_108055_c1 | 3300050493 | Unclassified | 1643 |
| 199 | nmdc:mga05p37_20854_c1 | 3300050507 | Bacteria | 7933 |
| 200 | Ga0500644_0000151 | 3300053088 | Bacteria | 43560 |
| 201 | Ga0500583_0000015 | 3300053092 | Bacteria | 147804 |
| 202 | Ga0500569_044715 | 3300053109 | Bacteria | 1312 |
| 203 | Ga0500652_055450 | 3300053131 | Bacteria | 1624 |
| 204 | Ga0500559_0017981 | 3300053136 | Unclassified | 2988 |
| 205 | Ga0500568_0037073 | 3300053139 | Bacteria | 1980 |
| 206 | Ga0500577_0006065 | 3300053142 | Bacteria | 3303 |
| 207 | Ga0500588_0022105 | 3300053146 | Unclassified | 1727 |
| 208 | Ga0500604_0004997 | 3300053151 | Bacteria | 3511 |
| 209 | Ga0500616_0011394 | 3300053153 | Bacteria | 5252 |
| 210 | Ga0500622_0000280 | 3300053156 | Bacteria | 51950 |
| 211 | Ga0500661_009001 | 3300055283 | Bacteria | 1833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0146141 | Ga0501038_0146141_1153_1905 | 250 |
| 2 | iso_pu_bacteria | 2945977869 | 2945977944 | 276 |
| 3 | 3300031251 | Ga0265327_10020102 | Ga0265327_100201022 | 277 |
| 4 | iso_pu_bacteria | 2738541278 | 2738730944 | 285 |
| 5 | iso_pu_bacteria | 2818991444 | 2819586343 | 285 |
| 6 | iso_pu_bacteria | 2883068021 | 2883072157 | 285 |
| 7 | iso_pu_bacteria | 2884791551 | 2884792026 | 285 |
| 8 | iso_pu_bacteria | 2896085136 | 2896088701 | 285 |
| 9 | iso_pu_bacteria | 2896109856 | 2896110106 | 285 |
| 10 | iso_pu_bacteria | 2914759650 | 2914762593 | 285 |
| 11 | iso_pu_bacteria | 2929154850 | 2929158665 | 285 |
| 12 | iso_pu_bacteria | 2929177148 | 2929182003 | 285 |
| 13 | iso_pu_bacteria | 2929921140 | 2929924781 | 285 |
| 14 | iso_pu_bacteria | 2946013367 | 2946016204 | 285 |
| 15 | 3300003316 | rootH1_10094733 | rootH1_100947332 | 288 |
| 16 | 3300046558 | Ga0495633_0000245 | Ga0495633_0000245_21819_22685 | 288 |
| 17 | 3300053156 | Ga0500622_0000280 | Ga0500622_0000280_21919_22785 | 288 |
| 18 | 2162886007 | SwRhRL2b_contig_3032561 | SwRhRL2b_0924.00007610 | 289 |
| 19 | 3300003203 | JGI25406J46586_10008656 | JGI25406J46586_100086562 | 289 |
| 20 | 3300003215 | JGI25153J46596_10031953 | JGI25153J46596_100319532 | 289 |
| 21 | 3300003316 | rootH1_10140623 | rootH1_101406232 | 289 |
| 22 | 3300003320 | rootH2_10134444 | rootH2_101344441 | 289 |
| 23 | 3300003322 | rootL2_10097932 | rootL2_100979322 | 289 |
| 24 | 3300003322 | rootL2_10171240 | rootL2_101712402 | 289 |
| 25 | 3300003322 | rootL2_10213595 | rootL2_102135951 | 289 |
| 26 | 3300003323 | rootH1_10001828 | rootH1_1000182878 | 289 |
| 27 | 3300003323 | rootH1_10157185 | rootH1_101571852 | 289 |
| 28 | 3300003354 | JGI25160J50197_1001007 | JGI25160J50197_10010076 | 289 |
| 29 | 3300003354 | JGI25160J50197_1003141 | JGI25160J50197_10031412 | 289 |
| 30 | 3300003354 | JGI25160J50197_1009800 | JGI25160J50197_10098003 | 289 |
| 31 | 3300003771 | Ga0055526_1005527 | Ga0055526_10055273 | 289 |
| 32 | 3300003790 | Ga0055528_1000029 | Ga0055528_10000298 | 289 |
| 33 | 3300003791 | Ga0055530_10000551 | Ga0055530_100005514 | 289 |
| 34 | 3300004625 | Ga0055543_1007795 | Ga0055543_10077952 | 289 |
| 35 | 3300005262 | Ga0065165_1000052 | Ga0065165_100005282 | 289 |
| 36 | 3300005289 | Ga0065704_10071217 | Ga0065704_100712179 | 289 |
| 37 | 3300005328 | Ga0070676_10227858 | Ga0070676_102278582 | 289 |
| 38 | 3300005329 | Ga0070683_100006837 | Ga0070683_1000068375 | 289 |
| 39 | 3300005335 | Ga0070666_10000494 | Ga0070666_100004945 | 289 |
| 40 | 3300005335 | Ga0070666_10037201 | Ga0070666_100372012 | 289 |
| 41 | 3300005337 | Ga0070682_100053209 | Ga0070682_1000532091 | 289 |
| 42 | 3300005338 | Ga0068868_100013381 | Ga0068868_1000133813 | 289 |
| 43 | 3300005338 | Ga0068868_100109005 | Ga0068868_1001090051 | 289 |
| 44 | 3300005339 | Ga0070660_100006257 | Ga0070660_1000062575 | 289 |
| 45 | 3300005344 | Ga0070661_100020635 | Ga0070661_1000206354 | 289 |
| 46 | 3300005347 | Ga0070668_100026744 | Ga0070668_1000267445 | 289 |
| 47 | 3300005354 | Ga0070675_100035875 | Ga0070675_1000358754 | 289 |
| 48 | 3300005355 | Ga0070671_100111145 | Ga0070671_1001111452 | 289 |
| 49 | 3300005356 | Ga0070674_100020099 | Ga0070674_1000200992 | 289 |
| 50 | 3300005356 | Ga0070674_100342178 | Ga0070674_1003421781 | 289 |
| 51 | 3300005365 | Ga0070688_100093674 | Ga0070688_1000936742 | 289 |
| 52 | 3300005367 | Ga0070667_100477337 | Ga0070667_1004773372 | 289 |
| 53 | 3300005367 | Ga0070667_100505571 | Ga0070667_1005055711 | 289 |
| 54 | 3300005457 | Ga0070662_100090653 | Ga0070662_1000906532 | 289 |
| 55 | 3300005458 | Ga0070681_10581059 | Ga0070681_105810591 | 289 |
| 56 | 3300005530 | Ga0070679_100008654 | Ga0070679_1000086545 | 289 |
| 57 | 3300005535 | Ga0070684_100012440 | Ga0070684_1000124407 | 289 |
| 58 | 3300005539 | Ga0068853_100005138 | Ga0068853_1000051385 | 289 |
| 59 | 3300005563 | Ga0068855_100032179 | Ga0068855_1000321792 | 289 |
| 60 | 3300005614 | Ga0068856_100108043 | Ga0068856_1001080432 | 289 |
| 61 | 3300005616 | Ga0068852_100004300 | Ga0068852_1000043006 | 289 |
| 62 | 3300005616 | Ga0068852_100039669 | Ga0068852_1000396694 | 289 |
| 63 | 3300005616 | Ga0068852_100078340 | Ga0068852_1000783402 | 289 |
| 64 | 3300005617 | Ga0068859_100000186 | Ga0068859_10000018648 | 289 |
| 65 | 3300005617 | Ga0068859_100015423 | Ga0068859_1000154238 | 289 |
| 66 | 3300005618 | Ga0068864_100070052 | Ga0068864_1000700522 | 289 |
| 67 | 3300005618 | Ga0068864_100191057 | Ga0068864_1001910572 | 289 |
| 68 | 3300005834 | Ga0068851_10009055 | Ga0068851_100090552 | 289 |
| 69 | 3300005834 | Ga0068851_10205194 | Ga0068851_102051941 | 289 |
| 70 | 3300005841 | Ga0068863_100005438 | Ga0068863_10000543817 | 289 |
| 71 | 3300005842 | Ga0068858_100062076 | Ga0068858_1000620762 | 289 |
| 72 | 3300005843 | Ga0068860_100003102 | Ga0068860_1000031027 | 289 |
| 73 | 3300005843 | Ga0068860_100005353 | Ga0068860_1000053535 | 289 |
| 74 | 3300005843 | Ga0068860_100032734 | Ga0068860_1000327342 | 289 |
| 75 | 3300005844 | Ga0068862_100115868 | Ga0068862_1001158682 | 289 |
| 76 | 3300005985 | Ga0081539_10000037 | Ga0081539_10000037241 | 289 |
| 77 | 3300006195 | Ga0075366_10035885 | Ga0075366_100358853 | 289 |
| 78 | 3300006195 | Ga0075366_10044865 | Ga0075366_100448651 | 289 |
| 79 | 3300006237 | Ga0097621_100003878 | Ga0097621_1000038789 | 289 |
| 80 | 3300006237 | Ga0097621_100015597 | Ga0097621_1000155972 | 289 |
| 81 | 3300006237 | Ga0097621_100221440 | Ga0097621_1002214401 | 289 |
| 82 | 3300006237 | Ga0097621_100258874 | Ga0097621_1002588741 | 289 |
| 83 | 3300006358 | Ga0068871_100001708 | Ga0068871_1000017087 | 289 |
| 84 | 3300006358 | Ga0068871_100061246 | Ga0068871_1000612463 | 289 |
| 85 | 3300006358 | Ga0068871_100199389 | Ga0068871_1001993891 | 289 |
| 86 | 3300006881 | Ga0068865_100075805 | Ga0068865_1000758052 | 289 |
| 87 | 3300006931 | Ga0097620_100000186 | Ga0097620_10000018614 | 289 |
| 88 | 3300006931 | Ga0097620_100015423 | Ga0097620_1000154232 | 289 |
| 89 | 3300009094 | Ga0111539_10050413 | Ga0111539_100504133 | 289 |
| 90 | 3300009101 | Ga0105247_10003454 | Ga0105247_100034542 | 289 |
| 91 | 3300009147 | Ga0114129_10002933 | Ga0114129_100029337 | 289 |
| 92 | 3300009148 | Ga0105243_10374851 | Ga0105243_103748511 | 289 |
| 93 | 3300009174 | Ga0105241_10001285 | Ga0105241_100012855 | 289 |
| 94 | 3300009174 | Ga0105241_10126914 | Ga0105241_101269143 | 289 |
| 95 | 3300009174 | Ga0105241_10243245 | Ga0105241_102432451 | 289 |
| 96 | 3300009545 | Ga0105237_10004660 | Ga0105237_1000466013 | 289 |
| 97 | 3300009545 | Ga0105237_10309252 | Ga0105237_103092521 | 289 |
| 98 | 3300009553 | Ga0105249_10001561 | Ga0105249_1000156122 | 289 |
| 99 | 3300010375 | Ga0105239_10012454 | Ga0105239_100124542 | 289 |
| 100 | 3300010375 | Ga0105239_10761816 | Ga0105239_107618161 | 289 |
| 101 | 3300011119 | Ga0105246_10005693 | Ga0105246_100056938 | 289 |
| 102 | 3300013100 | Ga0157373_10011593 | Ga0157373_100115937 | 289 |
| 103 | 3300013102 | Ga0157371_10018347 | Ga0157371_100183476 | 289 |
| 104 | 3300013102 | Ga0157371_10216817 | Ga0157371_102168171 | 289 |
| 105 | 3300013104 | Ga0157370_10045509 | Ga0157370_100455092 | 289 |
| 106 | 3300013105 | Ga0157369_10018134 | Ga0157369_100181345 | 289 |
| 107 | 3300013105 | Ga0157369_10239902 | Ga0157369_102399022 | 289 |
| 108 | 3300013105 | Ga0157369_10367025 | Ga0157369_103670252 | 289 |
| 109 | 3300013296 | Ga0157374_10073565 | Ga0157374_100735652 | 289 |
| 110 | 3300013297 | Ga0157378_10007312 | Ga0157378_100073122 | 289 |
| 111 | 3300013297 | Ga0157378_10010661 | Ga0157378_100106612 | 289 |
| 112 | 3300013306 | Ga0163162_10000266 | Ga0163162_1000026624 | 289 |
| 113 | 3300013306 | Ga0163162_10000503 | Ga0163162_1000050330 | 289 |
| 114 | 3300013306 | Ga0163162_10201217 | Ga0163162_102012172 | 289 |
| 115 | 3300013307 | Ga0157372_10322378 | Ga0157372_103223782 | 289 |
| 116 | 3300013307 | Ga0157372_10630615 | Ga0157372_106306151 | 289 |
| 117 | 3300013308 | Ga0157375_10038978 | Ga0157375_100389782 | 289 |
| 118 | 3300013308 | Ga0157375_10421999 | Ga0157375_104219993 | 289 |
| 119 | 3300014325 | Ga0163163_10021503 | Ga0163163_100215034 | 289 |
| 120 | 3300014326 | Ga0157380_10090484 | Ga0157380_100904842 | 289 |
| 121 | 3300014968 | Ga0157379_10037792 | Ga0157379_100377923 | 289 |
| 122 | 3300014968 | Ga0157379_10095047 | Ga0157379_100950472 | 289 |
| 123 | 3300014968 | Ga0157379_10098079 | Ga0157379_100980793 | 289 |
| 124 | 3300014969 | Ga0157376_10085987 | Ga0157376_100859873 | 289 |
| 125 | 3300017792 | Ga0163161_10210902 | Ga0163161_102109022 | 289 |
| 126 | 3300017792 | Ga0163161_10374454 | Ga0163161_103744541 | 289 |
| 127 | 3300025208 | Ga0209436_100280 | Ga0209436_10028011 | 289 |
| 128 | 3300025273 | Ga0209673_1000993 | Ga0209673_100099313 | 289 |
| 129 | 3300025295 | Ga0209564_1007918 | Ga0209564_10079184 | 289 |
| 130 | 3300025295 | Ga0209564_1010227 | Ga0209564_10102273 | 289 |
| 131 | 3300025297 | Ga0209758_1005373 | Ga0209758_10053735 | 289 |
| 132 | 3300025297 | Ga0209758_1014165 | Ga0209758_10141652 | 289 |
| 133 | 3300025297 | Ga0209758_1045203 | Ga0209758_10452031 | 289 |
| 134 | 3300025298 | Ga0209050_1000259 | Ga0209050_100025952 | 289 |
| 135 | 3300025302 | Ga0207426_1000132 | Ga0207426_100013285 | 289 |
| 136 | 3300025302 | Ga0207426_1000154 | Ga0207426_100015490 | 289 |
| 137 | 3300025302 | Ga0207426_1000678 | Ga0207426_100067823 | 289 |
| 138 | 3300025303 | Ga0209051_1020962 | Ga0209051_10209624 | 289 |
| 139 | 3300025304 | Ga0209257_1015683 | Ga0209257_10156832 | 289 |
| 140 | 3300025321 | Ga0207656_10033095 | Ga0207656_100330952 | 289 |
| 141 | 3300025321 | Ga0207656_10134478 | Ga0207656_101344782 | 289 |
| 142 | 3300025900 | Ga0207710_10001886 | Ga0207710_100018864 | 289 |
| 143 | 3300025903 | Ga0207680_10000236 | Ga0207680_100002365 | 289 |
| 144 | 3300025903 | Ga0207680_10348817 | Ga0207680_103488171 | 289 |
| 145 | 3300025911 | Ga0207654_10003343 | Ga0207654_100033436 | 289 |
| 146 | 3300025912 | Ga0207707_10486747 | Ga0207707_104867471 | 289 |
| 147 | 3300025913 | Ga0207695_10124411 | Ga0207695_101244112 | 289 |
| 148 | 3300025914 | Ga0207671_10017972 | Ga0207671_100179721 | 289 |
| 149 | 3300025919 | Ga0207657_10006472 | Ga0207657_100064725 | 289 |
| 150 | 3300025921 | Ga0207652_10081541 | Ga0207652_100815413 | 289 |
| 151 | 3300025926 | Ga0207659_10278385 | Ga0207659_102783852 | 289 |
| 152 | 3300025932 | Ga0207690_10026915 | Ga0207690_100269152 | 289 |
| 153 | 3300025933 | Ga0207706_10037765 | Ga0207706_100377651 | 289 |
| 154 | 3300025942 | Ga0207689_10000687 | Ga0207689_100006875 | 289 |
| 155 | 3300025942 | Ga0207689_10015329 | Ga0207689_100153294 | 289 |
| 156 | 3300025944 | Ga0207661_10188335 | Ga0207661_101883351 | 289 |
| 157 | 3300025949 | Ga0207667_10076696 | Ga0207667_100766961 | 289 |
| 158 | 3300025960 | Ga0207651_10085792 | Ga0207651_100857921 | 289 |
| 159 | 3300025960 | Ga0207651_10402845 | Ga0207651_104028452 | 289 |
| 160 | 3300025960 | Ga0207651_10557366 | Ga0207651_105573661 | 289 |
| 161 | 3300025961 | Ga0207712_10001621 | Ga0207712_100016212 | 289 |
| 162 | 3300025981 | Ga0207640_10255842 | Ga0207640_102558421 | 289 |
| 163 | 3300025986 | Ga0207658_10016550 | Ga0207658_100165505 | 289 |
| 164 | 3300025986 | Ga0207658_10184764 | Ga0207658_101847643 | 289 |
| 165 | 3300026023 | Ga0207677_10042113 | Ga0207677_100421132 | 289 |
| 166 | 3300026023 | Ga0207677_10282228 | Ga0207677_102822281 | 289 |
| 167 | 3300026035 | Ga0207703_10004922 | Ga0207703_100049223 | 289 |
| 168 | 3300026041 | Ga0207639_10212104 | Ga0207639_102121042 | 289 |
| 169 | 3300026078 | Ga0207702_10029055 | Ga0207702_100290554 | 289 |
| 170 | 3300026088 | Ga0207641_10000194 | Ga0207641_1000019444 | 289 |
| 171 | 3300026089 | Ga0207648_10397409 | Ga0207648_103974092 | 289 |
| 172 | 3300026095 | Ga0207676_10190768 | Ga0207676_101907682 | 289 |
| 173 | 3300026095 | Ga0207676_10370931 | Ga0207676_103709311 | 289 |
| 174 | 3300026116 | Ga0207674_10017417 | Ga0207674_100174175 | 289 |
| 175 | 3300026142 | Ga0207698_10013662 | Ga0207698_100136623 | 289 |
| 176 | 3300028381 | Ga0268264_10002228 | Ga0268264_100022287 | 289 |
| 177 | 3300028381 | Ga0268264_10024877 | Ga0268264_100248775 | 289 |
| 178 | 3300028381 | Ga0268264_10041178 | Ga0268264_100411783 | 289 |
| 179 | 3300028381 | Ga0268264_10362519 | Ga0268264_103625192 | 289 |
| 180 | 3300028381 | Ga0268264_10484069 | Ga0268264_104840691 | 289 |
| 181 | 3300028794 | Ga0307515_10000074 | Ga0307515_10000074121 | 289 |
| 182 | 3300031251 | Ga0265327_10000199 | Ga0265327_1000019931 | 289 |
| 183 | 3300031456 | Ga0307513_10248203 | Ga0307513_102482031 | 289 |
| 184 | 3300035691 | Ga0373931_0187727 | Ga0373931_0187727_61_933 | 289 |
| 185 | 3300037418 | Ga0395900_0254791 | Ga0395900_0254791_178_1050 | 289 |
| 186 | 3300037418 | Ga0395900_0475993 | Ga0395900_0475993_131_1000 | 289 |
| 187 | 3300042007 | Ga0439449_0038473 | Ga0439449_0038473_832_1701 | 289 |
| 188 | 3300044658 | Ga0466972_0000016 | Ga0466972_0000016_96502_97371 | 289 |
| 189 | 3300044658 | Ga0466972_0000096 | Ga0466972_0000096_57962_58831 | 289 |
| 190 | 3300044693 | Ga0466961_0046970 | Ga0466961_0046970_680_1549 | 289 |
| 191 | 3300044765 | Ga0466970_0040434 | Ga0466970_0040434_1314_2183 | 289 |
| 192 | 3300044842 | Ga0466957_0005828 | Ga0466957_0005828_2502_3371 | 289 |
| 193 | 3300044842 | Ga0466957_0012541 | Ga0466957_0012541_3117_3986 | 289 |
| 194 | 3300044842 | Ga0466957_0037909 | Ga0466957_0037909_867_1757 | 289 |
| 195 | 3300047320 | Ga0495672_0010466 | Ga0495672_0010466_1503_2372 | 289 |
| 196 | 3300049513 | Ga0501290_004477 | Ga0501290_004477_443_1318 | 289 |
| 197 | 3300049569 | Ga0501032_0026608 | Ga0501032_0026608_406_1275 | 289 |
| 198 | 3300049570 | Ga0501033_0034149 | Ga0501033_0034149_1340_2209 | 289 |
| 199 | 3300049571 | Ga0501034_0066803 | Ga0501034_0066803_420_1289 | 289 |
| 200 | 3300049571 | Ga0501034_0129024 | Ga0501034_0129024_521_1390 | 289 |
| 201 | 3300049572 | Ga0501036_0279247 | Ga0501036_0279247_306_1175 | 289 |
| 202 | 3300049573 | Ga0501037_0218564 | Ga0501037_0218564_162_1031 | 289 |
| 203 | 3300049575 | Ga0501039_0234382 | Ga0501039_0234382_471_1340 | 289 |
| 204 | 3300049579 | Ga0501043_0042613 | Ga0501043_0042613_2395_3264 | 289 |
| 205 | 3300049581 | Ga0501047_0016911 | Ga0501047_0016911_2350_3219 | 289 |
| 206 | 3300049703 | Ga0501219_000069 | Ga0501219_000069_15698_16567 | 289 |
| 207 | 3300049705 | Ga0501225_0013433 | Ga0501225_0013433_805_1674 | 289 |
| 208 | 3300049823 | Ga0501044_0007248 | Ga0501044_0007248_5479_6348 | 289 |
| 209 | 3300049823 | Ga0501044_0037867 | Ga0501044_0037867_4042_4911 | 289 |
| 210 | 3300050005 | Ga0501284_00022 | Ga0501284_00022_31865_32734 | 289 |
| 211 | 3300050493 | nmdc:mga0k408_108055_c1 | nmdc:mga0k408_108055_c1_616_1488 | 289 |
| 212 | 3300050507 | nmdc:mga05p37_20854_c1 | nmdc:mga05p37_20854_c1_2636_3505 | 289 |
| 213 | 3300053088 | Ga0500644_0000151 | Ga0500644_0000151_6419_7288 | 289 |
| 214 | 3300053092 | Ga0500583_0000015 | Ga0500583_0000015_52089_52958 | 289 |
| 215 | 3300053109 | Ga0500569_044715 | Ga0500569_044715_36_905 | 289 |
| 216 | 3300053131 | Ga0500652_055450 | Ga0500652_055450_649_1518 | 289 |
| 217 | 3300053136 | Ga0500559_0017981 | Ga0500559_0017981_1055_1924 | 289 |
| 218 | 3300053139 | Ga0500568_0037073 | Ga0500568_0037073_79_948 | 289 |
| 219 | 3300053142 | Ga0500577_0006065 | Ga0500577_0006065_936_1805 | 289 |
| 220 | 3300053146 | Ga0500588_0022105 | Ga0500588_0022105_44_913 | 289 |
| 221 | 3300053151 | Ga0500604_0004997 | Ga0500604_0004997_1548_2417 | 289 |
| 222 | 3300053153 | Ga0500616_0011394 | Ga0500616_0011394_78_947 | 289 |
| 223 | 3300055283 | Ga0500661_009001 | Ga0500661_009001_127_996 | 289 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q1n-assembly1.cif.gz_A | crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution | 0.9455 | 1 | 289 |
| 3dcd-assembly2.cif.gz_B | x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. | 0.9423 | 2 | 289 |
| 3q1n-assembly1.cif.gz_A | crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution | 0.9423 | 1 | 289 |
| 3dcd-assembly2.cif.gz_B | x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. | 0.9359 | 2 | 289 |
| 3k25-assembly2.cif.gz_B | crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 | 0.834 | 2 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dcdA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9482 | 1 | 289 | 2.70.98.10 |
| 3q1nA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9344 | 1 | 289 | 2.70.98.10 |
| 3q1nA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9313 | 1 | 289 | 2.70.98.10 |
| 3dcdA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9289 | 1 | 289 | 2.70.98.10 |
| 3k25A00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8564 | 2 | 288 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353K294-F1-model_v4 | Aldose epimerase | 0.9998 | 2 | 129 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A3D5LZ24-F1-model_v4 | deleted | 0.9989 | 2 | 92 |
|
| AF-K1T670-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) | 0.9987 | 2 | 117 |
GO:0004034
GO:0005975 GO:0030246 |
| AF-A0A5P2GDS0-F1-model_v4 | Aldose 1-epimerase family protein | 0.9985 | 1 | 289 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A258MTU4-F1-model_v4 | Aldose epimerase | 0.9982 | 1 | 289 |
GO:0005975
GO:0016853 GO:0030246 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar