F335745

General Info

Members Datasets Scaffolds Average Seq Length
223 160 211 291

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10020102|Ga0265327_100201022
Length 278
Sequence MTHTIYNTTLTVIIATKGAELQSIVNNNTGLEYMWSGDPAFWAKKSPVLFPVVGGLKNNQYTHNGYTYQLGRHGFAREMEFAVTAQQGNAITFTLADNAETLKNYPFHFSFSVTYTLQQNTVAILFSVGGHPAFKVPVAPGTTFTDYYLQFSHAETAGRYPLDAGGQVETYTTPVLTDASVLPLTKQLFYQDALVFKHLQSNSISIKSNATPHGLAVQFDGFPYMGIWNAKDADFVCIEPWCGIADSVNTTGRLREKEGINTLPPHQTFERTWSVTVF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2914759650 Rhizosphaericola mali Isolate Rhizosphere
9 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
10 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
11 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
12 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
13 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.62
Metatranscriptomes 0
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 0
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3032561 2162886007 Bacteria 2286
2 JGI25406J46586_10008656 3300003203 Bacteria 4593
3 JGI25153J46596_10031953 3300003215 Bacteria 1763
4 rootH1_10094733 3300003316 Bacteria 2161
5 rootH1_10140623 3300003316 Unclassified 1551
6 rootH2_10134444 3300003320 Unclassified 1411
7 rootL2_10097932 3300003322 Bacteria 1637
8 rootL2_10171240 3300003322 Bacteria 2012
9 rootL2_10213595 3300003322 Unclassified 1704
10 rootH1_10001828 3300003323 Bacteria 91608
11 rootH1_10157185 3300003323 Unclassified 3842
12 JGI25160J50197_1001007 3300003354 Bacteria 14612
13 JGI25160J50197_1003141 3300003354 Bacteria 7515
14 JGI25160J50197_1009800 3300003354 Unclassified 3519
15 Ga0055526_1005527 3300003771 Bacteria 7231
16 Ga0055528_1000029 3300003790 Bacteria 122126
17 Ga0055530_10000551 3300003791 Bacteria 32460
18 Ga0055543_1007795 3300004625 Unclassified 2438
19 Ga0065165_1000052 3300005262 Bacteria 192010
20 Ga0065704_10071217 3300005289 Bacteria 12422
21 Ga0070676_10227858 3300005328 Bacteria 1234
22 Ga0070683_100006837 3300005329 Bacteria 9584
23 Ga0070666_10000494 3300005335 Bacteria 23741
24 Ga0070666_10037201 3300005335 Bacteria 3235
25 Ga0070682_100053209 3300005337 Bacteria 2536
26 Ga0068868_100013381 3300005338 Bacteria 6018
27 Ga0068868_100109005 3300005338 Bacteria 2248
28 Ga0070660_100006257 3300005339 Bacteria 8242
29 Ga0070661_100020635 3300005344 Bacteria 4699
30 Ga0070668_100026744 3300005347 Bacteria 4380
31 Ga0070675_100035875 3300005354 Bacteria 4032
32 Ga0070671_100111145 3300005355 Bacteria 2302
33 Ga0070674_100020099 3300005356 Bacteria 4258
34 Ga0070674_100342178 3300005356 Unclassified 1205
35 Ga0070688_100093674 3300005365 Unclassified 1968
36 Ga0070667_100477337 3300005367 Bacteria 1141
37 Ga0070667_100505571 3300005367 Bacteria 1108
38 Ga0070662_100090653 3300005457 Bacteria 2295
39 Ga0070681_10581059 3300005458 Bacteria 1034
40 Ga0070679_100008654 3300005530 Bacteria 9590
41 Ga0070684_100012440 3300005535 Bacteria 6820
42 Ga0068853_100005138 3300005539 Bacteria 10233
43 Ga0068855_100032179 3300005563 Bacteria 6262
44 Ga0068856_100108043 3300005614 Bacteria 2778
45 Ga0068852_100004300 3300005616 Bacteria 10051
46 Ga0068852_100039669 3300005616 Bacteria 3966
47 Ga0068852_100078340 3300005616 Bacteria 2924
48 Ga0068859_100000186 3300005617 Bacteria 60206
49 Ga0068859_100015423 3300005617 Bacteria 7676
50 Ga0068864_100070052 3300005618 Bacteria 3051
51 Ga0068864_100191057 3300005618 Bacteria 1877
52 Ga0068851_10009055 3300005834 Bacteria 4620
53 Ga0068851_10205194 3300005834 Unclassified 1102
54 Ga0068863_100005438 3300005841 Bacteria 12547
55 Ga0068858_100062076 3300005842 Bacteria 3455
56 Ga0068860_100003102 3300005843 Bacteria 17170
57 Ga0068860_100005353 3300005843 Bacteria 13021
58 Ga0068860_100032734 3300005843 Bacteria 4995
59 Ga0068862_100115868 3300005844 Bacteria 2357
60 Ga0081539_10000037 3300005985 Bacteria 296160
61 Ga0075366_10035885 3300006195 Bacteria 2923
62 Ga0075366_10044865 3300006195 Bacteria 2621
63 Ga0097621_100003878 3300006237 Bacteria 10364
64 Ga0097621_100015597 3300006237 Bacteria 5723
65 Ga0097621_100221440 3300006237 Bacteria 1649
66 Ga0097621_100258874 3300006237 Bacteria 1526
67 Ga0068871_100001708 3300006358 Bacteria 14762
68 Ga0068871_100061246 3300006358 Bacteria 3073
69 Ga0068871_100199389 3300006358 Bacteria 1727
70 Ga0068865_100075805 3300006881 Bacteria 2399
71 Ga0097620_100000186 3300006931 Bacteria 60206
72 Ga0097620_100015423 3300006931 Bacteria 7676
73 Ga0111539_10050413 3300009094 Bacteria 4959
74 Ga0105247_10003454 3300009101 Bacteria 10301
75 Ga0114129_10002933 3300009147 Bacteria 23860
76 Ga0105243_10374851 3300009148 Bacteria 1314
77 Ga0105241_10001285 3300009174 Bacteria 19162
78 Ga0105241_10126914 3300009174 Bacteria 2061
79 Ga0105241_10243245 3300009174 Unclassified 1522
80 Ga0105237_10004660 3300009545 Bacteria 15793
81 Ga0105237_10309252 3300009545 Bacteria 1583
82 Ga0105249_10001561 3300009553 Bacteria 20115
83 Ga0105239_10012454 3300010375 Bacteria 9472
84 Ga0105239_10761816 3300010375 Unclassified 1108
85 Ga0105246_10005693 3300011119 Bacteria 7604
86 Ga0157373_10011593 3300013100 Bacteria 6475
87 Ga0157371_10018347 3300013102 Bacteria 5175
88 Ga0157371_10216817 3300013102 Bacteria 1374
89 Ga0157370_10045509 3300013104 Bacteria 4210
90 Ga0157369_10018134 3300013105 Bacteria 7896
91 Ga0157369_10239902 3300013105 Bacteria 1894
92 Ga0157369_10367025 3300013105 Bacteria 1494
93 Ga0157374_10073565 3300013296 Bacteria 3226
94 Ga0157378_10007312 3300013297 Bacteria 9643
95 Ga0157378_10010661 3300013297 Bacteria 8030
96 Ga0163162_10000266 3300013306 Bacteria 47442
97 Ga0163162_10000503 3300013306 Bacteria 36430
98 Ga0163162_10201217 3300013306 Bacteria 2120
99 Ga0157372_10322378 3300013307 Unclassified 1799
100 Ga0157372_10630615 3300013307 Bacteria 1249
101 Ga0157375_10038978 3300013308 Unclassified 4568
102 Ga0157375_10421999 3300013308 Bacteria 1500
103 Ga0163163_10021503 3300014325 Bacteria 6090
104 Ga0157380_10090484 3300014326 Bacteria 2524
105 Ga0157379_10037792 3300014968 Bacteria 4306
106 Ga0157379_10095047 3300014968 Bacteria 2674
107 Ga0157379_10098079 3300014968 Unclassified 2631
108 Ga0157376_10085987 3300014969 Bacteria 2711
109 Ga0163161_10210902 3300017792 Bacteria 1500
110 Ga0163161_10374454 3300017792 Bacteria 1137
111 Ga0209436_100280 3300025208 Bacteria 23454
112 Ga0209673_1000993 3300025273 Bacteria 34627
113 Ga0209564_1007918 3300025295 Bacteria 5361
114 Ga0209564_1010227 3300025295 Unclassified 4351
115 Ga0209758_1005373 3300025297 Bacteria 9923
116 Ga0209758_1014165 3300025297 Bacteria 4269
117 Ga0209758_1045203 3300025297 Unclassified 1601
118 Ga0209050_1000259 3300025298 Bacteria 113475
119 Ga0207426_1000132 3300025302 Bacteria 209623
120 Ga0207426_1000154 3300025302 Bacteria 179701
121 Ga0207426_1000678 3300025302 Bacteria 41242
122 Ga0209051_1020962 3300025303 Unclassified 2798
123 Ga0209257_1015683 3300025304 Unclassified 3131
124 Ga0207656_10033095 3300025321 Bacteria 2151
125 Ga0207656_10134478 3300025321 Unclassified 1161
126 Ga0207710_10001886 3300025900 Bacteria 10072
127 Ga0207680_10000236 3300025903 Bacteria 26619
128 Ga0207680_10348817 3300025903 Bacteria 1039
129 Ga0207654_10003343 3300025911 Bacteria 8125
130 Ga0207707_10486747 3300025912 Bacteria 1053
131 Ga0207695_10124411 3300025913 Bacteria 2543
132 Ga0207671_10017972 3300025914 Bacteria 5440
133 Ga0207657_10006472 3300025919 Bacteria 12138
134 Ga0207652_10081541 3300025921 Bacteria 2830
135 Ga0207659_10278385 3300025926 Bacteria 1367
136 Ga0207690_10026915 3300025932 Bacteria 3628
137 Ga0207706_10037765 3300025933 Bacteria 4286
138 Ga0207689_10000687 3300025942 Bacteria 32323
139 Ga0207689_10015329 3300025942 Bacteria 6487
140 Ga0207661_10188335 3300025944 Bacteria 1807
141 Ga0207667_10076696 3300025949 Bacteria 3468
142 Ga0207651_10085792 3300025960 Unclassified 2286
143 Ga0207651_10402845 3300025960 Bacteria 1164
144 Ga0207651_10557366 3300025960 Bacteria 997
145 Ga0207712_10001621 3300025961 Bacteria 15164
146 Ga0207640_10255842 3300025981 Bacteria 1362
147 Ga0207658_10016550 3300025986 Bacteria 5074
148 Ga0207658_10184764 3300025986 Bacteria 1728
149 Ga0207677_10042113 3300026023 Bacteria 3025
150 Ga0207677_10282228 3300026023 Bacteria 1364
151 Ga0207703_10004922 3300026035 Bacteria 10837
152 Ga0207639_10212104 3300026041 Bacteria 1667
153 Ga0207702_10029055 3300026078 Bacteria 4599
154 Ga0207641_10000194 3300026088 Bacteria 82153
155 Ga0207648_10397409 3300026089 Bacteria 1248
156 Ga0207676_10190768 3300026095 Bacteria 1803
157 Ga0207676_10370931 3300026095 Bacteria 1329
158 Ga0207674_10017417 3300026116 Bacteria 7840
159 Ga0207698_10013662 3300026142 Bacteria 5366
160 Ga0268264_10002228 3300028381 Bacteria 17192
161 Ga0268264_10024877 3300028381 Bacteria 4892
162 Ga0268264_10041178 3300028381 Bacteria 3819
163 Ga0268264_10362519 3300028381 Bacteria 1383
164 Ga0268264_10484069 3300028381 Bacteria 1204
165 Ga0307515_10000074 3300028794 Bacteria 229874
166 Ga0265327_10000199 3300031251 Bacteria 125838
167 Ga0265327_10020102 3300031251 Bacteria 4082
168 Ga0307513_10248203 3300031456 Bacteria 1578
169 Ga0373931_0187727 3300035691 Bacteria 1228
170 Ga0395900_0254791 3300037418 Bacteria 1755
171 Ga0395900_0475993 3300037418 Bacteria 1202
172 Ga0439449_0038473 3300042007 Unclassified 1779
173 Ga0466972_0000016 3300044658 Bacteria 208802
174 Ga0466972_0000096 3300044658 Bacteria 77400
175 Ga0466961_0046970 3300044693 Bacteria 2762
176 Ga0466970_0040434 3300044765 Bacteria 2476
177 Ga0466957_0005828 3300044842 Bacteria 6936
178 Ga0466957_0012541 3300044842 Bacteria 4906
179 Ga0466957_0037909 3300044842 Bacteria 2903
180 Ga0495633_0000245 3300046558 Bacteria 64798
181 Ga0495672_0010466 3300047320 Bacteria 6605
182 Ga0501290_004477 3300049513 Bacteria 1740
183 Ga0501032_0026608 3300049569 Bacteria 3977
184 Ga0501033_0034149 3300049570 Bacteria 3817
185 Ga0501034_0066803 3300049571 Unclassified 3609
186 Ga0501034_0129024 3300049571 Bacteria 2512
187 Ga0501036_0279247 3300049572 Bacteria 1398
188 Ga0501037_0218564 3300049573 Bacteria 1342
189 Ga0501038_0146141 3300049574 Bacteria 1930
190 Ga0501039_0234382 3300049575 Bacteria 1443
191 Ga0501043_0042613 3300049579 Bacteria 3567
192 Ga0501047_0016911 3300049581 Bacteria 6973
193 Ga0501219_000069 3300049703 Bacteria 17436
194 Ga0501225_0013433 3300049705 Bacteria 2291
195 Ga0501044_0007248 3300049823 Bacteria 12192
196 Ga0501044_0037867 3300049823 Bacteria 5040
197 Ga0501284_00022 3300050005 Bacteria 89450
198 nmdc:mga0k408_108055_c1 3300050493 Unclassified 1643
199 nmdc:mga05p37_20854_c1 3300050507 Bacteria 7933
200 Ga0500644_0000151 3300053088 Bacteria 43560
201 Ga0500583_0000015 3300053092 Bacteria 147804
202 Ga0500569_044715 3300053109 Bacteria 1312
203 Ga0500652_055450 3300053131 Bacteria 1624
204 Ga0500559_0017981 3300053136 Unclassified 2988
205 Ga0500568_0037073 3300053139 Bacteria 1980
206 Ga0500577_0006065 3300053142 Bacteria 3303
207 Ga0500588_0022105 3300053146 Unclassified 1727
208 Ga0500604_0004997 3300053151 Bacteria 3511
209 Ga0500616_0011394 3300053153 Bacteria 5252
210 Ga0500622_0000280 3300053156 Bacteria 51950
211 Ga0500661_009001 3300055283 Bacteria 1833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0146141 Ga0501038_0146141_1153_1905 250
2 iso_pu_bacteria 2945977869 2945977944 276
3 3300031251 Ga0265327_10020102 Ga0265327_100201022 277
4 iso_pu_bacteria 2738541278 2738730944 285
5 iso_pu_bacteria 2818991444 2819586343 285
6 iso_pu_bacteria 2883068021 2883072157 285
7 iso_pu_bacteria 2884791551 2884792026 285
8 iso_pu_bacteria 2896085136 2896088701 285
9 iso_pu_bacteria 2896109856 2896110106 285
10 iso_pu_bacteria 2914759650 2914762593 285
11 iso_pu_bacteria 2929154850 2929158665 285
12 iso_pu_bacteria 2929177148 2929182003 285
13 iso_pu_bacteria 2929921140 2929924781 285
14 iso_pu_bacteria 2946013367 2946016204 285
15 3300003316 rootH1_10094733 rootH1_100947332 288
16 3300046558 Ga0495633_0000245 Ga0495633_0000245_21819_22685 288
17 3300053156 Ga0500622_0000280 Ga0500622_0000280_21919_22785 288
18 2162886007 SwRhRL2b_contig_3032561 SwRhRL2b_0924.00007610 289
19 3300003203 JGI25406J46586_10008656 JGI25406J46586_100086562 289
20 3300003215 JGI25153J46596_10031953 JGI25153J46596_100319532 289
21 3300003316 rootH1_10140623 rootH1_101406232 289
22 3300003320 rootH2_10134444 rootH2_101344441 289
23 3300003322 rootL2_10097932 rootL2_100979322 289
24 3300003322 rootL2_10171240 rootL2_101712402 289
25 3300003322 rootL2_10213595 rootL2_102135951 289
26 3300003323 rootH1_10001828 rootH1_1000182878 289
27 3300003323 rootH1_10157185 rootH1_101571852 289
28 3300003354 JGI25160J50197_1001007 JGI25160J50197_10010076 289
29 3300003354 JGI25160J50197_1003141 JGI25160J50197_10031412 289
30 3300003354 JGI25160J50197_1009800 JGI25160J50197_10098003 289
31 3300003771 Ga0055526_1005527 Ga0055526_10055273 289
32 3300003790 Ga0055528_1000029 Ga0055528_10000298 289
33 3300003791 Ga0055530_10000551 Ga0055530_100005514 289
34 3300004625 Ga0055543_1007795 Ga0055543_10077952 289
35 3300005262 Ga0065165_1000052 Ga0065165_100005282 289
36 3300005289 Ga0065704_10071217 Ga0065704_100712179 289
37 3300005328 Ga0070676_10227858 Ga0070676_102278582 289
38 3300005329 Ga0070683_100006837 Ga0070683_1000068375 289
39 3300005335 Ga0070666_10000494 Ga0070666_100004945 289
40 3300005335 Ga0070666_10037201 Ga0070666_100372012 289
41 3300005337 Ga0070682_100053209 Ga0070682_1000532091 289
42 3300005338 Ga0068868_100013381 Ga0068868_1000133813 289
43 3300005338 Ga0068868_100109005 Ga0068868_1001090051 289
44 3300005339 Ga0070660_100006257 Ga0070660_1000062575 289
45 3300005344 Ga0070661_100020635 Ga0070661_1000206354 289
46 3300005347 Ga0070668_100026744 Ga0070668_1000267445 289
47 3300005354 Ga0070675_100035875 Ga0070675_1000358754 289
48 3300005355 Ga0070671_100111145 Ga0070671_1001111452 289
49 3300005356 Ga0070674_100020099 Ga0070674_1000200992 289
50 3300005356 Ga0070674_100342178 Ga0070674_1003421781 289
51 3300005365 Ga0070688_100093674 Ga0070688_1000936742 289
52 3300005367 Ga0070667_100477337 Ga0070667_1004773372 289
53 3300005367 Ga0070667_100505571 Ga0070667_1005055711 289
54 3300005457 Ga0070662_100090653 Ga0070662_1000906532 289
55 3300005458 Ga0070681_10581059 Ga0070681_105810591 289
56 3300005530 Ga0070679_100008654 Ga0070679_1000086545 289
57 3300005535 Ga0070684_100012440 Ga0070684_1000124407 289
58 3300005539 Ga0068853_100005138 Ga0068853_1000051385 289
59 3300005563 Ga0068855_100032179 Ga0068855_1000321792 289
60 3300005614 Ga0068856_100108043 Ga0068856_1001080432 289
61 3300005616 Ga0068852_100004300 Ga0068852_1000043006 289
62 3300005616 Ga0068852_100039669 Ga0068852_1000396694 289
63 3300005616 Ga0068852_100078340 Ga0068852_1000783402 289
64 3300005617 Ga0068859_100000186 Ga0068859_10000018648 289
65 3300005617 Ga0068859_100015423 Ga0068859_1000154238 289
66 3300005618 Ga0068864_100070052 Ga0068864_1000700522 289
67 3300005618 Ga0068864_100191057 Ga0068864_1001910572 289
68 3300005834 Ga0068851_10009055 Ga0068851_100090552 289
69 3300005834 Ga0068851_10205194 Ga0068851_102051941 289
70 3300005841 Ga0068863_100005438 Ga0068863_10000543817 289
71 3300005842 Ga0068858_100062076 Ga0068858_1000620762 289
72 3300005843 Ga0068860_100003102 Ga0068860_1000031027 289
73 3300005843 Ga0068860_100005353 Ga0068860_1000053535 289
74 3300005843 Ga0068860_100032734 Ga0068860_1000327342 289
75 3300005844 Ga0068862_100115868 Ga0068862_1001158682 289
76 3300005985 Ga0081539_10000037 Ga0081539_10000037241 289
77 3300006195 Ga0075366_10035885 Ga0075366_100358853 289
78 3300006195 Ga0075366_10044865 Ga0075366_100448651 289
79 3300006237 Ga0097621_100003878 Ga0097621_1000038789 289
80 3300006237 Ga0097621_100015597 Ga0097621_1000155972 289
81 3300006237 Ga0097621_100221440 Ga0097621_1002214401 289
82 3300006237 Ga0097621_100258874 Ga0097621_1002588741 289
83 3300006358 Ga0068871_100001708 Ga0068871_1000017087 289
84 3300006358 Ga0068871_100061246 Ga0068871_1000612463 289
85 3300006358 Ga0068871_100199389 Ga0068871_1001993891 289
86 3300006881 Ga0068865_100075805 Ga0068865_1000758052 289
87 3300006931 Ga0097620_100000186 Ga0097620_10000018614 289
88 3300006931 Ga0097620_100015423 Ga0097620_1000154232 289
89 3300009094 Ga0111539_10050413 Ga0111539_100504133 289
90 3300009101 Ga0105247_10003454 Ga0105247_100034542 289
91 3300009147 Ga0114129_10002933 Ga0114129_100029337 289
92 3300009148 Ga0105243_10374851 Ga0105243_103748511 289
93 3300009174 Ga0105241_10001285 Ga0105241_100012855 289
94 3300009174 Ga0105241_10126914 Ga0105241_101269143 289
95 3300009174 Ga0105241_10243245 Ga0105241_102432451 289
96 3300009545 Ga0105237_10004660 Ga0105237_1000466013 289
97 3300009545 Ga0105237_10309252 Ga0105237_103092521 289
98 3300009553 Ga0105249_10001561 Ga0105249_1000156122 289
99 3300010375 Ga0105239_10012454 Ga0105239_100124542 289
100 3300010375 Ga0105239_10761816 Ga0105239_107618161 289
101 3300011119 Ga0105246_10005693 Ga0105246_100056938 289
102 3300013100 Ga0157373_10011593 Ga0157373_100115937 289
103 3300013102 Ga0157371_10018347 Ga0157371_100183476 289
104 3300013102 Ga0157371_10216817 Ga0157371_102168171 289
105 3300013104 Ga0157370_10045509 Ga0157370_100455092 289
106 3300013105 Ga0157369_10018134 Ga0157369_100181345 289
107 3300013105 Ga0157369_10239902 Ga0157369_102399022 289
108 3300013105 Ga0157369_10367025 Ga0157369_103670252 289
109 3300013296 Ga0157374_10073565 Ga0157374_100735652 289
110 3300013297 Ga0157378_10007312 Ga0157378_100073122 289
111 3300013297 Ga0157378_10010661 Ga0157378_100106612 289
112 3300013306 Ga0163162_10000266 Ga0163162_1000026624 289
113 3300013306 Ga0163162_10000503 Ga0163162_1000050330 289
114 3300013306 Ga0163162_10201217 Ga0163162_102012172 289
115 3300013307 Ga0157372_10322378 Ga0157372_103223782 289
116 3300013307 Ga0157372_10630615 Ga0157372_106306151 289
117 3300013308 Ga0157375_10038978 Ga0157375_100389782 289
118 3300013308 Ga0157375_10421999 Ga0157375_104219993 289
119 3300014325 Ga0163163_10021503 Ga0163163_100215034 289
120 3300014326 Ga0157380_10090484 Ga0157380_100904842 289
121 3300014968 Ga0157379_10037792 Ga0157379_100377923 289
122 3300014968 Ga0157379_10095047 Ga0157379_100950472 289
123 3300014968 Ga0157379_10098079 Ga0157379_100980793 289
124 3300014969 Ga0157376_10085987 Ga0157376_100859873 289
125 3300017792 Ga0163161_10210902 Ga0163161_102109022 289
126 3300017792 Ga0163161_10374454 Ga0163161_103744541 289
127 3300025208 Ga0209436_100280 Ga0209436_10028011 289
128 3300025273 Ga0209673_1000993 Ga0209673_100099313 289
129 3300025295 Ga0209564_1007918 Ga0209564_10079184 289
130 3300025295 Ga0209564_1010227 Ga0209564_10102273 289
131 3300025297 Ga0209758_1005373 Ga0209758_10053735 289
132 3300025297 Ga0209758_1014165 Ga0209758_10141652 289
133 3300025297 Ga0209758_1045203 Ga0209758_10452031 289
134 3300025298 Ga0209050_1000259 Ga0209050_100025952 289
135 3300025302 Ga0207426_1000132 Ga0207426_100013285 289
136 3300025302 Ga0207426_1000154 Ga0207426_100015490 289
137 3300025302 Ga0207426_1000678 Ga0207426_100067823 289
138 3300025303 Ga0209051_1020962 Ga0209051_10209624 289
139 3300025304 Ga0209257_1015683 Ga0209257_10156832 289
140 3300025321 Ga0207656_10033095 Ga0207656_100330952 289
141 3300025321 Ga0207656_10134478 Ga0207656_101344782 289
142 3300025900 Ga0207710_10001886 Ga0207710_100018864 289
143 3300025903 Ga0207680_10000236 Ga0207680_100002365 289
144 3300025903 Ga0207680_10348817 Ga0207680_103488171 289
145 3300025911 Ga0207654_10003343 Ga0207654_100033436 289
146 3300025912 Ga0207707_10486747 Ga0207707_104867471 289
147 3300025913 Ga0207695_10124411 Ga0207695_101244112 289
148 3300025914 Ga0207671_10017972 Ga0207671_100179721 289
149 3300025919 Ga0207657_10006472 Ga0207657_100064725 289
150 3300025921 Ga0207652_10081541 Ga0207652_100815413 289
151 3300025926 Ga0207659_10278385 Ga0207659_102783852 289
152 3300025932 Ga0207690_10026915 Ga0207690_100269152 289
153 3300025933 Ga0207706_10037765 Ga0207706_100377651 289
154 3300025942 Ga0207689_10000687 Ga0207689_100006875 289
155 3300025942 Ga0207689_10015329 Ga0207689_100153294 289
156 3300025944 Ga0207661_10188335 Ga0207661_101883351 289
157 3300025949 Ga0207667_10076696 Ga0207667_100766961 289
158 3300025960 Ga0207651_10085792 Ga0207651_100857921 289
159 3300025960 Ga0207651_10402845 Ga0207651_104028452 289
160 3300025960 Ga0207651_10557366 Ga0207651_105573661 289
161 3300025961 Ga0207712_10001621 Ga0207712_100016212 289
162 3300025981 Ga0207640_10255842 Ga0207640_102558421 289
163 3300025986 Ga0207658_10016550 Ga0207658_100165505 289
164 3300025986 Ga0207658_10184764 Ga0207658_101847643 289
165 3300026023 Ga0207677_10042113 Ga0207677_100421132 289
166 3300026023 Ga0207677_10282228 Ga0207677_102822281 289
167 3300026035 Ga0207703_10004922 Ga0207703_100049223 289
168 3300026041 Ga0207639_10212104 Ga0207639_102121042 289
169 3300026078 Ga0207702_10029055 Ga0207702_100290554 289
170 3300026088 Ga0207641_10000194 Ga0207641_1000019444 289
171 3300026089 Ga0207648_10397409 Ga0207648_103974092 289
172 3300026095 Ga0207676_10190768 Ga0207676_101907682 289
173 3300026095 Ga0207676_10370931 Ga0207676_103709311 289
174 3300026116 Ga0207674_10017417 Ga0207674_100174175 289
175 3300026142 Ga0207698_10013662 Ga0207698_100136623 289
176 3300028381 Ga0268264_10002228 Ga0268264_100022287 289
177 3300028381 Ga0268264_10024877 Ga0268264_100248775 289
178 3300028381 Ga0268264_10041178 Ga0268264_100411783 289
179 3300028381 Ga0268264_10362519 Ga0268264_103625192 289
180 3300028381 Ga0268264_10484069 Ga0268264_104840691 289
181 3300028794 Ga0307515_10000074 Ga0307515_10000074121 289
182 3300031251 Ga0265327_10000199 Ga0265327_1000019931 289
183 3300031456 Ga0307513_10248203 Ga0307513_102482031 289
184 3300035691 Ga0373931_0187727 Ga0373931_0187727_61_933 289
185 3300037418 Ga0395900_0254791 Ga0395900_0254791_178_1050 289
186 3300037418 Ga0395900_0475993 Ga0395900_0475993_131_1000 289
187 3300042007 Ga0439449_0038473 Ga0439449_0038473_832_1701 289
188 3300044658 Ga0466972_0000016 Ga0466972_0000016_96502_97371 289
189 3300044658 Ga0466972_0000096 Ga0466972_0000096_57962_58831 289
190 3300044693 Ga0466961_0046970 Ga0466961_0046970_680_1549 289
191 3300044765 Ga0466970_0040434 Ga0466970_0040434_1314_2183 289
192 3300044842 Ga0466957_0005828 Ga0466957_0005828_2502_3371 289
193 3300044842 Ga0466957_0012541 Ga0466957_0012541_3117_3986 289
194 3300044842 Ga0466957_0037909 Ga0466957_0037909_867_1757 289
195 3300047320 Ga0495672_0010466 Ga0495672_0010466_1503_2372 289
196 3300049513 Ga0501290_004477 Ga0501290_004477_443_1318 289
197 3300049569 Ga0501032_0026608 Ga0501032_0026608_406_1275 289
198 3300049570 Ga0501033_0034149 Ga0501033_0034149_1340_2209 289
199 3300049571 Ga0501034_0066803 Ga0501034_0066803_420_1289 289
200 3300049571 Ga0501034_0129024 Ga0501034_0129024_521_1390 289
201 3300049572 Ga0501036_0279247 Ga0501036_0279247_306_1175 289
202 3300049573 Ga0501037_0218564 Ga0501037_0218564_162_1031 289
203 3300049575 Ga0501039_0234382 Ga0501039_0234382_471_1340 289
204 3300049579 Ga0501043_0042613 Ga0501043_0042613_2395_3264 289
205 3300049581 Ga0501047_0016911 Ga0501047_0016911_2350_3219 289
206 3300049703 Ga0501219_000069 Ga0501219_000069_15698_16567 289
207 3300049705 Ga0501225_0013433 Ga0501225_0013433_805_1674 289
208 3300049823 Ga0501044_0007248 Ga0501044_0007248_5479_6348 289
209 3300049823 Ga0501044_0037867 Ga0501044_0037867_4042_4911 289
210 3300050005 Ga0501284_00022 Ga0501284_00022_31865_32734 289
211 3300050493 nmdc:mga0k408_108055_c1 nmdc:mga0k408_108055_c1_616_1488 289
212 3300050507 nmdc:mga05p37_20854_c1 nmdc:mga05p37_20854_c1_2636_3505 289
213 3300053088 Ga0500644_0000151 Ga0500644_0000151_6419_7288 289
214 3300053092 Ga0500583_0000015 Ga0500583_0000015_52089_52958 289
215 3300053109 Ga0500569_044715 Ga0500569_044715_36_905 289
216 3300053131 Ga0500652_055450 Ga0500652_055450_649_1518 289
217 3300053136 Ga0500559_0017981 Ga0500559_0017981_1055_1924 289
218 3300053139 Ga0500568_0037073 Ga0500568_0037073_79_948 289
219 3300053142 Ga0500577_0006065 Ga0500577_0006065_936_1805 289
220 3300053146 Ga0500588_0022105 Ga0500588_0022105_44_913 289
221 3300053151 Ga0500604_0004997 Ga0500604_0004997_1548_2417 289
222 3300053153 Ga0500616_0011394 Ga0500616_0011394_78_947 289
223 3300055283 Ga0500661_009001 Ga0500661_009001_127_996 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

1

257

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q1n-assembly1.cif.gz_A crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution 0.9455 1 289
3dcd-assembly2.cif.gz_B x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. 0.9423 2 289
3q1n-assembly1.cif.gz_A crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution 0.9423 1 289
3dcd-assembly2.cif.gz_B x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. 0.9359 2 289
3k25-assembly2.cif.gz_B crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 0.834 2 288
ID Description Score Start End Superfamily
3dcdA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9482 1 289 2.70.98.10
3q1nA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9344 1 289 2.70.98.10
3q1nA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9313 1 289 2.70.98.10
3dcdA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9289 1 289 2.70.98.10
3k25A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8564 2 288 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A353K294-F1-model_v4 Aldose epimerase 0.9998 2 129 GO:0005975
GO:0016853
GO:0030246
AF-A0A3D5LZ24-F1-model_v4 deleted 0.9989 2 92
AF-K1T670-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9987 2 117 GO:0004034
GO:0005975
GO:0030246
AF-A0A5P2GDS0-F1-model_v4 Aldose 1-epimerase family protein 0.9985 1 289 GO:0005975
GO:0016853
GO:0030246
AF-A0A258MTU4-F1-model_v4 Aldose epimerase 0.9982 1 289 GO:0005975
GO:0016853
GO:0030246

Feature Viewer

pLDDT pTM Quality
96.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map