F335484

General Info

Members Datasets Scaffolds Average Seq Length
223 164 446 229

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100525208|Ga0075434_1005252082
Length 258
Sequence VGTAILVTNPPDQLPPAFYAAPSAVTRRSMRDWWIVLHPPYTLWHLSYVVIGACLAPHVDGERMAATLVAFFLAVGVGAHALDELHGRPLRTSIPGWALTVAAVASLAGAVGLGLVGVARVGPGLAVFIVVGVVLALGYNLELLGGRLHNDATFALAWGAFPVLTAYYAQTRALRVPAVVAAAAAFGLSCAQRHLSTPARNLRRRAIAVDGTITMRDGRNLHLDSRVLLAPLEAALRTMAWSLVALAVAMAAARLTTW

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.17
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100525208 3300006871 Bacteria 1204
2 Ga0070658_10007708 3300005327 Bacteria 8676
3 Ga0070670_100352619 3300005331 Bacteria 1293
4 Ga0068868_100493147 3300005338 Bacteria 1072
5 Ga0070689_100281899 3300005340 Bacteria 1379
6 Ga0070674_100009719 3300005356 Bacteria 5776
7 Ga0070688_100364833 3300005365 Bacteria 1061
8 Ga0070714_100228883 3300005435 Bacteria 1712
9 Ga0070713_100122725 3300005436 Bacteria 2280
10 Ga0070711_100037858 3300005439 Unclassified 3239
11 Ga0070705_100075553 3300005440 Bacteria 2052
12 Ga0070705_100164727 3300005440 Bacteria 1486
13 Ga0070708_100000080 3300005445 Bacteria 62222
14 Ga0070708_100040630 3300005445 Bacteria 4074
15 Ga0070708_100086167 3300005445 Bacteria 2852
16 Ga0070681_10190282 3300005458 Bacteria 1972
17 Ga0068867_100022832 3300005459 Bacteria 4476
18 Ga0070706_100000013 3300005467 Bacteria 194939
19 Ga0070706_100119442 3300005467 Bacteria 2457
20 Ga0070706_100129365 3300005467 Bacteria 2356
21 Ga0070706_100169585 3300005467 Bacteria 2038
22 Ga0070707_100000038 3300005468 Bacteria 112320
23 Ga0070707_100007353 3300005468 Bacteria 10230
24 Ga0070707_100020589 3300005468 Bacteria 6224
25 Ga0070707_100136244 3300005468 Bacteria 2388
26 Ga0070707_100681372 3300005468 Bacteria 991
27 Ga0070698_100014787 3300005471 Bacteria 8249
28 Ga0070699_100000745 3300005518 Bacteria 30182
29 Ga0070679_100517418 3300005530 Bacteria 1137
30 Ga0070697_100022417 3300005536 Bacteria 5012
31 Ga0070697_100023469 3300005536 Bacteria 4905
32 Ga0070697_100043919 3300005536 Bacteria 3619
33 Ga0070697_100052741 3300005536 Bacteria 3305
34 Ga0070695_100053843 3300005545 Bacteria 2588
35 Ga0070695_100081040 3300005545 Bacteria 2147
36 Ga0070696_100016345 3300005546 Bacteria 4995
37 Ga0070704_100034218 3300005549 Bacteria 3443
38 Ga0068857_100227066 3300005577 Bacteria 1706
39 Ga0068856_100640653 3300005614 Unclassified 1083
40 Ga0070702_100062979 3300005615 Bacteria 2164
41 Ga0068859_100487013 3300005617 Bacteria 1329
42 Ga0068863_100240193 3300005841 Bacteria 1748
43 Ga0068860_100394431 3300005843 Bacteria 1368
44 Ga0068862_100066287 3300005844 Bacteria 3111
45 Ga0081538_10000037 3300005981 Bacteria 119828
46 Ga0081540_1023220 3300005983 Bacteria 3635
47 Ga0070717_10000002 3300006028 Bacteria 378525
48 Ga0070717_10044292 3300006028 Bacteria 3633
49 Ga0070717_10298857 3300006028 Unclassified 1431
50 Ga0070717_10473922 3300006028 Bacteria 1130
51 Ga0075363_100216771 3300006048 Bacteria 1096
52 Ga0070716_100013274 3300006173 Bacteria 4195
53 Ga0070716_100225017 3300006173 Bacteria 1263
54 Ga0070712_100043324 3300006175 Bacteria 3098
55 Ga0070712_100122599 3300006175 Bacteria 1958
56 Ga0097621_100034306 3300006237 Bacteria 4048
57 Ga0068871_100290336 3300006358 Bacteria 1433
58 Ga0075431_100253602 3300006847 Bacteria 1787
59 Ga0075434_100572491 3300006871 Bacteria 1149
60 Ga0068865_100101574 3300006881 Bacteria 2106
61 Ga0075436_100015507 3300006914 Bacteria 5216
62 Ga0075436_100304650 3300006914 Unclassified 1142
63 Ga0097620_100486968 3300006931 Bacteria 1329
64 Ga0099794_10000079 3300007265 Bacteria 35772
65 Ga0105245_10103947 3300009098 Bacteria 2633
66 Ga0105245_10236993 3300009098 Bacteria 1767
67 Ga0105247_10033830 3300009101 Bacteria 3111
68 Ga0105243_10025483 3300009148 Bacteria 4520
69 Ga0105242_10054934 3300009176 Bacteria 3257
70 Ga0105248_10053111 3300009177 Bacteria 4547
71 Ga0105238_10256504 3300009551 Bacteria 1728
72 Ga0105246_10728378 3300011119 Unclassified 872
73 Ga0157369_10232943 3300013105 Bacteria 1925
74 Ga0157378_10002080 3300013297 Bacteria 17906
75 Ga0163162_10334957 3300013306 Bacteria 1646
76 Ga0157375_10062601 3300013308 Bacteria 3698
77 Ga0157375_10119002 3300013308 Bacteria 2748
78 Ga0163163_10003412 3300014325 Bacteria 13498
79 Ga0157379_10056348 3300014968 Bacteria 3512
80 Ga0157379_10131883 3300014968 Bacteria 2249
81 Ga0157376_10197598 3300014969 Bacteria 1848
82 Ga0157376_10310535 3300014969 Bacteria 1496
83 Ga0207705_10012104 3300025909 Bacteria 6234
84 Ga0207684_10000064 3300025910 Bacteria 195300
85 Ga0207684_10091967 3300025910 Bacteria 2586
86 Ga0207684_10095651 3300025910 Bacteria 2535
87 Ga0207684_10143057 3300025910 Bacteria 2057
88 Ga0207646_10000013 3300025922 Bacteria 364371
89 Ga0207646_10000418 3300025922 Bacteria 56835
90 Ga0207646_10063361 3300025922 Bacteria 3301
91 Ga0207650_10352667 3300025925 Bacteria 1211
92 Ga0207687_10185089 3300025927 Bacteria 1616
93 Ga0207700_10034082 3300025928 Bacteria 3651
94 Ga0207700_10338135 3300025928 Bacteria 1308
95 Ga0207664_10034393 3300025929 Bacteria 3903
96 Ga0207664_10064436 3300025929 Bacteria 2931
97 Ga0207664_10100080 3300025929 Unclassified 2393
98 Ga0207664_10118270 3300025929 Bacteria 2213
99 Ga0207704_10026140 3300025938 Bacteria 3198
100 Ga0207665_10008687 3300025939 Bacteria 6684
101 Ga0207658_10110193 3300025986 Bacteria 2175
102 Ga0207677_10411977 3300026023 Bacteria 1149
103 Ga0207703_10170194 3300026035 Bacteria 1915
104 Ga0207708_10073161 3300026075 Bacteria 2626
105 Ga0207648_10031923 3300026089 Bacteria 4653
106 Ga0207675_100116336 3300026118 Bacteria 2527
107 Ga0209588_1000065 3300027671 Bacteria 36875
108 Ga0268266_10188960 3300028379 Bacteria 1880
109 Ga0268264_10534410 3300028381 Unclassified 1148
110 Ga0265327_10016788 3300031251 Bacteria 4627
111 Ga0307416_100249321 3300032002 Bacteria 1727
112 Ga0373936_0112296 3300035113 Bacteria 1158
113 Ga0373953_0052849 3300035117 Bacteria 1645
114 Ga0373943_0010757 3300035170 Bacteria 4106
115 Ga0373955_0040221 3300035172 Bacteria 2499
116 Ga0373924_0011293 3300035410 Bacteria 3314
117 Ga0373935_0071807 3300035692 Bacteria 2234
118 Ga0373933_0102408 3300035724 Bacteria 1778
119 Ga0373937_0204979 3300036401 Bacteria 1854
120 Ga0395899_0110541 3300037312 Bacteria 1976
121 Ga0395900_0004030 3300037418 Bacteria 15679
122 Ga0395900_0196464 3300037418 Bacteria 2043
123 Ga0395898_0025769 3300037466 Bacteria 5922
124 Ga0395898_0068317 3300037466 Bacteria 3438
125 Ga0395898_0278026 3300037466 Unclassified 1597
126 Ga0395905_0192420 3300037471 Bacteria 1913
127 Ga0395905_0259825 3300037471 Bacteria 1621
128 Ga0395901_0021656 3300038443 Bacteria 6585
129 Ga0395901_0100133 3300038443 Bacteria 3039
130 Ga0451789_1076214 3300041443 Bacteria 1685
131 Ga0451793_0076565 3300041452 Bacteria 971
132 Ga0451793_0234912 3300041452 Bacteria 848
133 Ga0451804_0114724 3300041463 Bacteria 1356
134 Ga0451833_1464812 3300041491 Bacteria 1163
135 Ga0451839_0514884 3300041496 Bacteria 1386
136 Ga0451841_0351880 3300041498 Bacteria 1111
137 Ga0451855_0333315 3300041511 Bacteria 1622
138 Ga0451853_1714758 3300041512 Unclassified 904
139 Ga0451853_3883333 3300041512 Bacteria 2273
140 Ga0466961_0242793 3300044693 Bacteria 1107
141 Ga0466964_0156049 3300044706 Bacteria 1062
142 Ga0466968_0017707 3300044735 Bacteria 2851
143 Ga0466957_0028183 3300044842 Bacteria 3342
144 Ga0466960_0022328 3300044901 Bacteria 2828
145 Ga0466959_0114139 3300045049 Bacteria 1925
146 Ga0466959_0374699 3300045049 Unclassified 969
147 Ga0466958_0019768 3300045836 Bacteria 3921
148 Ga0495603_0107737 3300046455 Bacteria 1626
149 Ga0495629_0078418 3300046459 Bacteria 2306
150 Ga0495641_0024335 3300046461 Bacteria 2991
151 Ga0495651_0119060 3300046462 Bacteria 1942
152 Ga0495653_0121937 3300046463 Bacteria 1856
153 Ga0495653_0153351 3300046463 Bacteria 1607
154 Ga0495653_0158197 3300046463 Bacteria 1576
155 Ga0495639_0033595 3300046475 Bacteria 2291
156 Ga0495664_0056137 3300046477 Bacteria 2342
157 Ga0495594_0335079 3300046499 Unclassified 862
158 Ga0495608_0011529 3300046511 Bacteria 6151
159 Ga0495618_0247674 3300046514 Bacteria 1118
160 Ga0495628_0035837 3300046516 Bacteria 3985
161 Ga0495628_0128585 3300046516 Bacteria 1939
162 Ga0495628_0130576 3300046516 Bacteria 1922
163 Ga0495630_0475424 3300046517 Bacteria 958
164 Ga0495587_0004185 3300046536 Bacteria 9552
165 Ga0495645_0020776 3300046543 Bacteria 4742
166 Ga0495667_0032588 3300046559 Bacteria 3491
167 Ga0495634_0150414 3300046642 Bacteria 1472
168 Ga0495635_0051567 3300046663 Bacteria 2834
169 Ga0495635_0056522 3300046663 Bacteria 2701
170 Ga0495657_0014947 3300046675 Bacteria 5693
171 Ga0495599_0166422 3300046678 Bacteria 1361
172 Ga0495623_0002607 3300046679 Bacteria 11904
173 Ga0495613_0342909 3300046689 Bacteria 1027
174 Ga0495600_0032455 3300046809 Bacteria 3388
175 Ga0495676_0047811 3300047321 Bacteria 3455
176 Ga0495680_0012666 3300047322 Bacteria 7406
177 Ga0495680_0196989 3300047322 Bacteria 1447
178 Ga0495675_0009356 3300047444 Bacteria 6095
179 Ga0495684_0002558 3300047471 Bacteria 14475
180 Ga0495684_0012963 3300047471 Bacteria 6435
181 Ga0495593_0093872 3300047673 Bacteria 1544
182 Ga0496101_0074600 3300048904 Bacteria 2495
183 Ga0496102_0400413 3300048905 Bacteria 1291
184 Ga0496104_0053204 3300048907 Bacteria 3824
185 Ga0496104_0909187 3300048907 Bacteria 785
186 Ga0496105_0015214 3300048908 Bacteria 6127
187 Ga0496105_0118348 3300048908 Bacteria 2185
188 Ga0496105_0477836 3300048908 Bacteria 981
189 Ga0496106_0011513 3300048909 Bacteria 6542
190 Ga0496108_0207695 3300048911 Bacteria 1700
191 Ga0496109_0047612 3300048912 Bacteria 3899
192 Ga0496110_0040860 3300048913 Bacteria 4044
193 Ga0496111_0053341 3300048914 Bacteria 2921
194 Ga0501036_0152333 3300049572 Bacteria 1950
195 Ga0501039_0015171 3300049575 Bacteria 5896
196 Ga0501039_0095068 3300049575 Bacteria 2323
197 Ga0501040_0009814 3300049576 Bacteria 6250
198 Ga0501042_0006362 3300049578 Bacteria 7656
199 Ga0501042_0287172 3300049578 Bacteria 1188
200 Ga0501046_0119357 3300049580 Bacteria 2008
201 Ga0501048_0053615 3300049582 Bacteria 2867
202 Ga0501068_0308740 3300049584 Bacteria 1013
203 Ga0501070_0044772 3300049586 Bacteria 3681
204 Ga0501071_0126981 3300049587 Bacteria 1893
205 Ga0501072_0055292 3300049588 Bacteria 3128
206 Ga0501075_0023841 3300049591 Bacteria 4481
207 Ga0501076_0024470 3300049592 Bacteria 4667
208 Ga0501076_0402773 3300049592 Bacteria 1125
209 Ga0501079_0052934 3300049741 Bacteria 3132
210 Ga0501079_0112597 3300049741 Bacteria 2115
211 Ga0501080_0213045 3300049742 Bacteria 1770
212 Ga0501083_0117187 3300049744 Bacteria 1748
213 Ga0501045_0026963 3300049824 Bacteria 4136
214 nmdc:mga0n895_178994_c1 3300050512 Bacteria 2151
215 nmdc:mga0n895_496106_c1 3300050512 Bacteria 1230
216 nmdc:mga0rr50_30909_c1 3300050513 Bacteria 3797
217 Ga0495612_0042771 3300053078 Bacteria 1850
218 Ga0495595_0025977 3300053084 Bacteria 2598
219 Ga0495595_0072913 3300053084 Bacteria 1625
220 Ga0495619_0035551 3300053085 Bacteria 3240
221 Ga0495619_0092450 3300053085 Bacteria 2049
222 Ga0501084_0098029 3300054114 Bacteria 2461
223 Ga0501082_0306760 3300060353 Unclassified 1382
224 Ga0075434_100525208
225 Ga0070658_10007708
226 Ga0070670_100352619
227 Ga0068868_100493147
228 Ga0070689_100281899
229 Ga0070674_100009719
230 Ga0070688_100364833
231 Ga0070714_100228883
232 Ga0070713_100122725
233 Ga0070711_100037858
234 Ga0070705_100075553
235 Ga0070705_100164727
236 Ga0070708_100000080
237 Ga0070708_100040630
238 Ga0070708_100086167
239 Ga0070681_10190282
240 Ga0068867_100022832
241 Ga0070706_100000013
242 Ga0070706_100119442
243 Ga0070706_100129365
244 Ga0070706_100169585
245 Ga0070707_100000038
246 Ga0070707_100007353
247 Ga0070707_100020589
248 Ga0070707_100136244
249 Ga0070707_100681372
250 Ga0070698_100014787
251 Ga0070699_100000745
252 Ga0070679_100517418
253 Ga0070697_100022417
254 Ga0070697_100023469
255 Ga0070697_100043919
256 Ga0070697_100052741
257 Ga0070695_100053843
258 Ga0070695_100081040
259 Ga0070696_100016345
260 Ga0070704_100034218
261 Ga0068857_100227066
262 Ga0068856_100640653
263 Ga0070702_100062979
264 Ga0068859_100487013
265 Ga0068863_100240193
266 Ga0068860_100394431
267 Ga0068862_100066287
268 Ga0081538_10000037
269 Ga0081540_1023220
270 Ga0070717_10000002
271 Ga0070717_10044292
272 Ga0070717_10298857
273 Ga0070717_10473922
274 Ga0075363_100216771
275 Ga0070716_100013274
276 Ga0070716_100225017
277 Ga0070712_100043324
278 Ga0070712_100122599
279 Ga0097621_100034306
280 Ga0068871_100290336
281 Ga0075431_100253602
282 Ga0075434_100572491
283 Ga0068865_100101574
284 Ga0075436_100015507
285 Ga0075436_100304650
286 Ga0097620_100486968
287 Ga0099794_10000079
288 Ga0105245_10103947
289 Ga0105245_10236993
290 Ga0105247_10033830
291 Ga0105243_10025483
292 Ga0105242_10054934
293 Ga0105248_10053111
294 Ga0105238_10256504
295 Ga0105246_10728378
296 Ga0157369_10232943
297 Ga0157378_10002080
298 Ga0163162_10334957
299 Ga0157375_10062601
300 Ga0157375_10119002
301 Ga0163163_10003412
302 Ga0157379_10056348
303 Ga0157379_10131883
304 Ga0157376_10197598
305 Ga0157376_10310535
306 Ga0207705_10012104
307 Ga0207684_10000064
308 Ga0207684_10091967
309 Ga0207684_10095651
310 Ga0207684_10143057
311 Ga0207646_10000013
312 Ga0207646_10000418
313 Ga0207646_10063361
314 Ga0207650_10352667
315 Ga0207687_10185089
316 Ga0207700_10034082
317 Ga0207700_10338135
318 Ga0207664_10034393
319 Ga0207664_10064436
320 Ga0207664_10100080
321 Ga0207664_10118270
322 Ga0207704_10026140
323 Ga0207665_10008687
324 Ga0207658_10110193
325 Ga0207677_10411977
326 Ga0207703_10170194
327 Ga0207708_10073161
328 Ga0207648_10031923
329 Ga0207675_100116336
330 Ga0209588_1000065
331 Ga0268266_10188960
332 Ga0268264_10534410
333 Ga0265327_10016788
334 Ga0307416_100249321
335 Ga0373936_0112296
336 Ga0373953_0052849
337 Ga0373943_0010757
338 Ga0373955_0040221
339 Ga0373924_0011293
340 Ga0373935_0071807
341 Ga0373933_0102408
342 Ga0373937_0204979
343 Ga0395899_0110541
344 Ga0395900_0004030
345 Ga0395900_0196464
346 Ga0395898_0025769
347 Ga0395898_0068317
348 Ga0395898_0278026
349 Ga0395905_0192420
350 Ga0395905_0259825
351 Ga0395901_0021656
352 Ga0395901_0100133
353 Ga0451789_1076214
354 Ga0451793_0076565
355 Ga0451793_0234912
356 Ga0451804_0114724
357 Ga0451833_1464812
358 Ga0451839_0514884
359 Ga0451841_0351880
360 Ga0451855_0333315
361 Ga0451853_1714758
362 Ga0451853_3883333
363 Ga0466961_0242793
364 Ga0466964_0156049
365 Ga0466968_0017707
366 Ga0466957_0028183
367 Ga0466960_0022328
368 Ga0466959_0114139
369 Ga0466959_0374699
370 Ga0466958_0019768
371 Ga0495603_0107737
372 Ga0495629_0078418
373 Ga0495641_0024335
374 Ga0495651_0119060
375 Ga0495653_0121937
376 Ga0495653_0153351
377 Ga0495653_0158197
378 Ga0495639_0033595
379 Ga0495664_0056137
380 Ga0495594_0335079
381 Ga0495608_0011529
382 Ga0495618_0247674
383 Ga0495628_0035837
384 Ga0495628_0128585
385 Ga0495628_0130576
386 Ga0495630_0475424
387 Ga0495587_0004185
388 Ga0495645_0020776
389 Ga0495667_0032588
390 Ga0495634_0150414
391 Ga0495635_0051567
392 Ga0495635_0056522
393 Ga0495657_0014947
394 Ga0495599_0166422
395 Ga0495623_0002607
396 Ga0495613_0342909
397 Ga0495600_0032455
398 Ga0495676_0047811
399 Ga0495680_0012666
400 Ga0495680_0196989
401 Ga0495675_0009356
402 Ga0495684_0002558
403 Ga0495684_0012963
404 Ga0495593_0093872
405 Ga0496101_0074600
406 Ga0496102_0400413
407 Ga0496104_0053204
408 Ga0496104_0909187
409 Ga0496105_0015214
410 Ga0496105_0118348
411 Ga0496105_0477836
412 Ga0496106_0011513
413 Ga0496108_0207695
414 Ga0496109_0047612
415 Ga0496110_0040860
416 Ga0496111_0053341
417 Ga0501036_0152333
418 Ga0501039_0015171
419 Ga0501039_0095068
420 Ga0501040_0009814
421 Ga0501042_0006362
422 Ga0501042_0287172
423 Ga0501046_0119357
424 Ga0501048_0053615
425 Ga0501068_0308740
426 Ga0501070_0044772
427 Ga0501071_0126981
428 Ga0501072_0055292
429 Ga0501075_0023841
430 Ga0501076_0024470
431 Ga0501076_0402773
432 Ga0501079_0052934
433 Ga0501079_0112597
434 Ga0501080_0213045
435 Ga0501083_0117187
436 Ga0501045_0026963
437 nmdc:mga0n895_178994_c1
438 nmdc:mga0n895_496106_c1
439 nmdc:mga0rr50_30909_c1
440 Ga0495612_0042771
441 Ga0495595_0025977
442 Ga0495595_0072913
443 Ga0495619_0035551
444 Ga0495619_0092450
445 Ga0501084_0098029
446 Ga0501082_0306760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph7-assembly2.cif.gz_D crystal structure of plasmodium vivax putative polyprenyl pyrophosphate synthase in complex with geranylgeranyl diphosphate 0.6186 32 203
6v0k-assembly1.cif.gz_A crystal structure of penicillium verruculosum copalyl diphosphate synthase (pvcps) alpha prenyltransferase domain 0.6183 28 194
6b06-assembly2.cif.gz_C-2 crystal structure of cffpps2, a lepidopteran type-ii farnesyl diphosphate synthase, complexed with ipp and [2-(1-methylpyridin-2-yl)-1-phosphono-ethyl]phosphonic acid (inhibitor 1b) 0.6134 31 194
4n1z-assembly1.cif.gz_F-2 crystal structure of human farnesyl diphosphate synthase in complex with bph-1222 0.5885 37 204
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.5841 30 249
ID Description Score Start End Superfamily
af_Q54JB3_152_315_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8048 38 185 1.10.357.140
af_K7LZY1_114_275_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8018 33 169 1.10.357.140
af_Q8I0W6_322_470_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.784 43 173 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7688 43 173 1.10.357.140
af_K8ES01_95_243_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.751 43 173 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A1Q7DBQ0-F1-model_v4 Methyltransferase domain-containing protein 0.9829 37 252 GO:0008168
GO:0016020
GO:0032259
AF-A0A160VBF6-F1-model_v4 Prepilin type IV endopeptidase peptidase domain-containing protein 0.9797 52 252 GO:0016020
AF-A0A7V8WJA5-F1-model_v4 Uncharacterized protein 0.9785 45 252 GO:0016020
AF-A0A537G6C7-F1-model_v4 Prenyltransferase 0.9702 31 196 GO:0016020
AF-A0A2N0L117-F1-model_v4 Uncharacterized protein 0.97 16 252 GO:0016020

Map