F335182

General Info

Members Datasets Scaffolds Average Seq Length
223 148 223 139

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000015|Ga0070658_1000001573
Length 155
Sequence VVYNLPDMQGVIQKINEQYKKQAVVDVRSGDTVRVHQKIREGAKERIQIFQGLVIRTDQKGSHTSRITVRRISSGIGVEKSFLLHSPLVVQVEVTKRSKVRRNYLSYMRNRTGKAARLTGLDFDRSAVNDIHDVAAEAEEAKLHEQALARHEETA

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
145 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
146 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.18
Nodule 0
Rhizoplane 0.45
Rhizosphere 77.58
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000011 3300002244 Bacteria 31137
2 rootH1_10166092 3300003316 Bacteria 2240
3 rootH2_10000244 3300003320 Bacteria 697651
4 rootH1_10116708 3300003323 Bacteria 9089
5 Ga0070658_10000012 3300005327 Bacteria 277871
6 Ga0070658_10000015 3300005327 Bacteria 230579
7 Ga0070658_10002596 3300005327 Bacteria 15044
8 Ga0070658_10041091 3300005327 Bacteria 3731
9 Ga0070676_10001822 3300005328 Bacteria 10833
10 Ga0070676_10284468 3300005328 Bacteria 1115
11 Ga0070683_100162613 3300005329 Bacteria 2118
12 Ga0070683_100220553 3300005329 Bacteria 1802
13 Ga0070670_100168176 3300005331 Unclassified 1901
14 Ga0070670_100739324 3300005331 Bacteria 886
15 Ga0068869_100268412 3300005334 Bacteria 1368
16 Ga0070666_10032186 3300005335 Bacteria 3463
17 Ga0070666_10167576 3300005335 Bacteria 1537
18 Ga0070680_100024901 3300005336 Unclassified 4783
19 Ga0070682_100004673 3300005337 Bacteria 7607
20 Ga0070682_100011445 3300005337 Bacteria 5070
21 Ga0070660_100020653 3300005339 Bacteria 4844
22 Ga0070660_100061242 3300005339 Bacteria 2922
23 Ga0070674_100051332 3300005356 Unclassified 2842
24 Ga0070673_100001360 3300005364 Bacteria 14303
25 Ga0070673_100144959 3300005364 Unclassified 2007
26 Ga0070667_100000001 3300005367 Bacteria 1108638
27 Ga0070667_100083648 3300005367 Bacteria 2734
28 Ga0070709_10198230 3300005434 Unclassified 1420
29 Ga0070678_100000234 3300005456 Bacteria 25286
30 Ga0070678_100036506 3300005456 Bacteria 3441
31 Ga0068867_100716547 3300005459 Bacteria 884
32 Ga0070685_10001561 3300005466 Bacteria 12067
33 Ga0070679_100000652 3300005530 Bacteria 29531
34 Ga0070679_100001645 3300005530 Bacteria 20128
35 Ga0070679_100021794 3300005530 Bacteria 6258
36 Ga0070679_100361010 3300005530 Bacteria 1400
37 Ga0070684_100001437 3300005535 Bacteria 17157
38 Ga0070684_100468269 3300005535 Bacteria 1165
39 Ga0070672_100005074 3300005543 Bacteria 8687
40 Ga0070665_100160788 3300005548 Bacteria 2248
41 Ga0068855_100051246 3300005563 Bacteria 4862
42 Ga0068855_101120556 3300005563 Unclassified 822
43 Ga0070664_100279181 3300005564 Bacteria 1506
44 Ga0068857_100192786 3300005577 Bacteria 1856
45 Ga0068857_100490342 3300005577 Bacteria 1152
46 Ga0068856_100000001 3300005614 Bacteria 565602
47 Ga0068859_101061988 3300005617 Bacteria 890
48 Ga0068864_100223989 3300005618 Bacteria 1736
49 Ga0068861_100097043 3300005719 Bacteria 2337
50 Ga0068863_100407010 3300005841 Unclassified 1331
51 Ga0068860_100005217 3300005843 Bacteria 13193
52 Ga0068862_100636477 3300005844 Bacteria 1027
53 Ga0081455_10000003 3300005937 Bacteria 367763
54 Ga0075368_10000191 3300006042 Bacteria 16758
55 Ga0075363_100001796 3300006048 Bacteria 8392
56 Ga0075367_10027589 3300006178 Bacteria 3232
57 Ga0075369_10000005 3300006186 Bacteria 147699
58 Ga0075369_10000056 3300006186 Bacteria 28912
59 Ga0075369_10038587 3300006186 Bacteria 2038
60 Ga0075369_10084707 3300006186 Bacteria 1409
61 Ga0075366_10000001 3300006195 Bacteria 569172
62 Ga0075366_10114601 3300006195 Bacteria 1623
63 Ga0097621_100000370 3300006237 Bacteria 31223
64 Ga0075370_10026125 3300006353 Bacteria 3232
65 Ga0068871_100000156 3300006358 Bacteria 45103
66 Ga0075428_100023417 3300006844 Bacteria 6834
67 Ga0075430_100144665 3300006846 Bacteria 1980
68 Ga0075430_101076899 3300006846 Bacteria 662
69 Ga0097620_101061779 3300006931 Bacteria 890
70 Ga0105245_10000002 3300009098 Bacteria 634374
71 Ga0105245_10502247 3300009098 Bacteria 1229
72 Ga0105245_11309255 3300009098 Unclassified 774
73 Ga0105241_10002073 3300009174 Bacteria 15150
74 Ga0105242_10148198 3300009176 Bacteria 2043
75 Ga0105242_10599200 3300009176 Bacteria 1064
76 Ga0105248_11599381 3300009177 Unclassified 738
77 Ga0105238_10078049 3300009551 Bacteria 3302
78 Ga0105238_10184794 3300009551 Unclassified 2061
79 Ga0105249_10000802 3300009553 Bacteria 28271
80 Ga0105249_10578313 3300009553 Unclassified 1176
81 Ga0105030_102332 3300009987 Bacteria 1662
82 Ga0105239_10219473 3300010375 Unclassified 2132
83 Ga0105239_10960717 3300010375 Bacteria 982
84 Ga0157373_10074023 3300013100 Bacteria 2403
85 Ga0157373_10656166 3300013100 Bacteria 766
86 Ga0157369_10315836 3300013105 Bacteria 1624
87 Ga0157374_10000031 3300013296 Bacteria 204840
88 Ga0157374_10007870 3300013296 Bacteria 9099
89 Ga0157372_10032188 3300013307 Bacteria 5748
90 Ga0157372_10450622 3300013307 Bacteria 1500
91 Ga0207697_10403633 3300025315 Unclassified 607
92 Ga0207680_10021780 3300025903 Bacteria 3474
93 Ga0207680_10250646 3300025903 Bacteria 1223
94 Ga0207645_10001792 3300025907 Bacteria 17339
95 Ga0207645_10271440 3300025907 Bacteria 1125
96 Ga0207705_10000011 3300025909 Bacteria 517768
97 Ga0207705_10000056 3300025909 Bacteria 157554
98 Ga0207705_10001854 3300025909 Bacteria 16602
99 Ga0207705_10033441 3300025909 Bacteria 3673
100 Ga0207654_10003824 3300025911 Bacteria 7590
101 Ga0207654_10746145 3300025911 Unclassified 705
102 Ga0207660_10001351 3300025917 Bacteria 16443
103 Ga0207660_10114422 3300025917 Bacteria 2035
104 Ga0207657_10071572 3300025919 Bacteria 2936
105 Ga0207657_10150064 3300025919 Bacteria 1899
106 Ga0207652_10001980 3300025921 Bacteria 17726
107 Ga0207652_10005637 3300025921 Bacteria 10158
108 Ga0207652_10030767 3300025921 Bacteria 4498
109 Ga0207652_10376866 3300025921 Bacteria 1281
110 Ga0207694_10047125 3300025924 Bacteria 3333
111 Ga0207694_10251952 3300025924 Unclassified 1445
112 Ga0207650_10065068 3300025925 Bacteria 2731
113 Ga0207687_10000001 3300025927 Bacteria 1130810
114 Ga0207686_10634470 3300025934 Bacteria 844
115 Ga0207669_10024191 3300025937 Unclassified 3260
116 Ga0207704_11046550 3300025938 Bacteria 692
117 Ga0207691_10022874 3300025940 Bacteria 5892
118 Ga0207711_10731787 3300025941 Unclassified 922
119 Ga0207689_10205178 3300025942 Bacteria 1628
120 Ga0207661_10000021 3300025944 Bacteria 205381
121 Ga0207661_10133983 3300025944 Bacteria 2126
122 Ga0207667_10015676 3300025949 Bacteria 8596
123 Ga0207651_10000191 3300025960 Bacteria 26637
124 Ga0207712_10006986 3300025961 Bacteria 7120
125 Ga0207658_10000003 3300025986 Bacteria 1151934
126 Ga0207658_10029244 3300025986 Bacteria 3889
127 Ga0207708_10670696 3300026075 Bacteria 884
128 Ga0207702_10000001 3300026078 Bacteria 895738
129 Ga0207702_10006320 3300026078 Bacteria 10235
130 Ga0207674_10080709 3300026116 Bacteria 3255
131 Ga0207674_10129378 3300026116 Bacteria 2489
132 Ga0207683_10007035 3300026121 Bacteria 9648
133 Ga0207683_10015104 3300026121 Bacteria 6571
134 Ga0209813_10000004 3300027866 Bacteria 139340
135 Ga0207428_10006981 3300027907 Bacteria 10343
136 Ga0268264_10018543 3300028381 Bacteria 5691
137 Ga0265337_1035866 3300028556 Bacteria 1450
138 Ga0265327_10000017 3300031251 Bacteria 445264
139 Ga0265327_10004018 3300031251 Bacteria 13393
140 Ga0373952_0048583 3300035092 Unclassified 1004
141 Ga0395899_0005886 3300037312 Bacteria 9515
142 Ga0395899_0202822 3300037312 Bacteria 1382
143 Ga0395900_0004371 3300037418 Bacteria 14994
144 Ga0395900_0011364 3300037418 Bacteria 9108
145 Ga0395898_0003425 3300037466 Bacteria 17764
146 Ga0395898_0018336 3300037466 Bacteria 7137
147 Ga0395898_0679618 3300037466 Bacteria 972
148 Ga0395905_0004532 3300037471 Bacteria 14388
149 Ga0395905_0225979 3300037471 Bacteria 1751
150 Ga0395905_0428940 3300037471 Bacteria 1219
151 Ga0395901_0006077 3300038443 Bacteria 12237
152 Ga0395901_0010296 3300038443 Bacteria 9470
153 Ga0395901_0077736 3300038443 Bacteria 3464
154 Ga0395901_0424186 3300038443 Bacteria 1363
155 Ga0451802_0118349 3300041460 Bacteria 1385
156 Ga0451851_1277668 3300041507 Bacteria 618
157 Ga0466967_0583732 3300045976 Bacteria 1102
158 Ga0495587_0048605 3300046536 Bacteria 2512
159 Ga0495622_0000082 3300046557 Bacteria 85266
160 Ga0495658_0001953 3300046683 Bacteria 10540
161 Ga0495600_0003845 3300046809 Bacteria 8906
162 Ga0495672_0000129 3300047320 Bacteria 112879
163 Ga0495686_0296065 3300047472 Bacteria 895
164 Ga0495593_0061381 3300047673 Bacteria 1966
165 Ga0501031_0000446 3300049568 Bacteria 23856
166 Ga0501032_0025133 3300049569 Bacteria 4107
167 Ga0501032_0303725 3300049569 Bacteria 1031
168 Ga0501033_0041801 3300049570 Unclassified 3419
169 Ga0501034_0002719 3300049571 Bacteria 20818
170 Ga0501034_0280105 3300049571 Bacteria 1607
171 Ga0501037_0000121 3300049573 Bacteria 72862
172 Ga0501037_0279221 3300049573 Bacteria 1164
173 Ga0501038_0007638 3300049574 Bacteria 9972
174 Ga0501040_0574141 3300049576 Bacteria 814
175 Ga0501042_0075611 3300049578 Unclassified 2410
176 Ga0501043_0011557 3300049579 Bacteria 6911
177 Ga0501046_0000922 3300049580 Bacteria 28825
178 Ga0501046_0041024 3300049580 Bacteria 3695
179 Ga0501047_0000229 3300049581 Bacteria 66412
180 Ga0501047_0003170 3300049581 Bacteria 15588
181 Ga0501048_0002409 3300049582 Bacteria 14272
182 Ga0501070_0050893 3300049586 Bacteria 3438
183 Ga0501073_0043727 3300049589 Bacteria 3158
184 Ga0501083_0167365 3300049744 Bacteria 1437
185 Ga0501035_0000033 3300049822 Bacteria 175087
186 Ga0501035_0000801 3300049822 Bacteria 33495
187 Ga0501044_0152317 3300049823 Bacteria 2294
188 nmdc:mga03n38_8561_c1 3300050490 Bacteria 3679
189 nmdc:mga0k408_152301_c2 3300050493 Unclassified 1007
190 nmdc:mga0k408_16584_c1 3300050493 Bacteria 4089
191 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
192 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
193 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
194 nmdc:mga07m45_15944_c2 3300050496 Bacteria 2504
195 nmdc:mga07m45_95100_c1 3300050496 Bacteria 1709
196 nmdc:mga0qj67_890194_c1 3300050509 Unclassified 702
197 nmdc:mga08y16_1132_c1 3300050511 Bacteria 26248
198 nmdc:mga0sz30_12781_c2 3300050516 Bacteria 2771
199 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
200 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
201 nmdc:mga0sz30_9988_c2 3300050516 Bacteria 1409
202 Ga0500610_0000001 3300053079 Bacteria 185468
203 Ga0500610_0036914 3300053079 Bacteria 2514
204 Ga0500643_000038 3300053087 Bacteria 178974
205 Ga0500643_020544 3300053087 Unclassified 2156
206 Ga0500644_0000006 3300053088 Bacteria 143304
207 Ga0500644_0002318 3300053088 Bacteria 4791
208 Ga0500583_0000052 3300053092 Bacteria 75622
209 Ga0500583_0240101 3300053092 Bacteria 896
210 Ga0500651_0381835 3300053093 Bacteria 794
211 Ga0500566_0000001 3300053094 Bacteria 1101031
212 Ga0500555_000002 3300053103 Bacteria 1314346
213 Ga0500556_0000295 3300053104 Bacteria 38375
214 Ga0500562_132838 3300053108 Bacteria 678
215 Ga0500593_000001 3300053117 Bacteria 784404
216 Ga0500594_0000196 3300053118 Bacteria 15125
217 Ga0500652_000020 3300053131 Bacteria 119198
218 Ga0500559_0031524 3300053136 Bacteria 2274
219 Ga0500574_122673 3300053141 Bacteria 768
220 Ga0500589_000016 3300053147 Bacteria 107090
221 Ga0500604_0155796 3300053151 Bacteria 777
222 Ga0500616_0000005 3300053153 Bacteria 961725
223 Ga0500570_000005 3300053724 Bacteria 132994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100490342 Ga0068857_1004903422 119
2 3300025924 Ga0207694_10047125 Ga0207694_100471251 119
3 3300026116 Ga0207674_10129378 Ga0207674_101293781 119
4 3300053079 Ga0500610_0036914 Ga0500610_0036914_334_846 127
5 3300053092 Ga0500583_0000052 Ga0500583_0000052_2404_2916 127
6 3300053093 Ga0500651_0381835 Ga0500651_0381835_269_781 127
7 3300053147 Ga0500589_000016 Ga0500589_000016_59950_60462 127
8 3300009176 Ga0105242_10599200 Ga0105242_105992001 128
9 3300005614 Ga0068856_100000001 Ga0068856_100000001235 129
10 3300026078 Ga0207702_10000001 Ga0207702_10000001784 129
11 3300026078 Ga0207702_10006320 Ga0207702_100063206 129
12 3300006237 Ga0097621_100000370 Ga0097621_10000037012 130
13 3300006358 Ga0068871_100000156 Ga0068871_10000015631 130
14 3300009098 Ga0105245_10000002 Ga0105245_10000002207 130
15 3300009176 Ga0105242_10148198 Ga0105242_101481982 130
16 3300013296 Ga0157374_10000031 Ga0157374_10000031165 130
17 3300025927 Ga0207687_10000001 Ga0207687_100000011004 130
18 3300037466 Ga0395898_0679618 Ga0395898_0679618_267_788 130
19 3300038443 Ga0395901_0010296 Ga0395901_0010296_991_1512 130
20 3300049744 Ga0501083_0167365 Ga0501083_0167365_627_1229 130
21 3300005367 Ga0070667_100083648 Ga0070667_1000836483 131
22 3300005456 Ga0070678_100036506 Ga0070678_1000365063 131
23 3300005563 Ga0068855_100051246 Ga0068855_1000512464 131
24 3300025949 Ga0207667_10015676 Ga0207667_100156766 131
25 3300025986 Ga0207658_10029244 Ga0207658_100292441 131
26 3300026121 Ga0207683_10015104 Ga0207683_100151046 131
27 3300037312 Ga0395899_0005886 Ga0395899_0005886_2546_3067 131
28 3300037418 Ga0395900_0011364 Ga0395900_0011364_336_857 131
29 3300037466 Ga0395898_0018336 Ga0395898_0018336_4531_5052 131
30 3300037471 Ga0395905_0004532 Ga0395905_0004532_12297_12818 131
31 3300038443 Ga0395901_0424186 Ga0395901_0424186_507_1028 131
32 3300041507 Ga0451851_1277668 Ga0451851_1277668_34_438 131
33 3300005334 Ga0068869_100268412 Ga0068869_1002684122 132
34 3300005337 Ga0070682_100011445 Ga0070682_1000114455 132
35 3300005459 Ga0068867_100716547 Ga0068867_1007165472 132
36 3300025934 Ga0207686_10634470 Ga0207686_106344701 132
37 3300025942 Ga0207689_10205178 Ga0207689_102051783 132
38 3300049569 Ga0501032_0303725 Ga0501032_0303725_26_619 132
39 3300049570 Ga0501033_0041801 Ga0501033_0041801_639_1232 132
40 3300049571 Ga0501034_0002719 Ga0501034_0002719_12497_13090 132
41 3300049573 Ga0501037_0279221 Ga0501037_0279221_289_882 132
42 3300049581 Ga0501047_0000229 Ga0501047_0000229_10926_11519 132
43 3300049822 Ga0501035_0000033 Ga0501035_0000033_108970_109563 132
44 3300049823 Ga0501044_0152317 Ga0501044_0152317_1330_1923 132
45 3300053117 Ga0500593_000001 Ga0500593_000001_608341_608871 132
46 3300005327 Ga0070658_10000012 Ga0070658_10000012300 133
47 3300005327 Ga0070658_10041091 Ga0070658_100410913 133
48 3300005328 Ga0070676_10284468 Ga0070676_102844682 133
49 3300005331 Ga0070670_100168176 Ga0070670_1001681763 133
50 3300005335 Ga0070666_10167576 Ga0070666_101675762 133
51 3300005339 Ga0070660_100061242 Ga0070660_1000612422 133
52 3300005356 Ga0070674_100051332 Ga0070674_1000513323 133
53 3300005364 Ga0070673_100001360 Ga0070673_1000013607 133
54 3300005367 Ga0070667_100000001 Ga0070667_100000001753 133
55 3300005456 Ga0070678_100000234 Ga0070678_1000002348 133
56 3300005466 Ga0070685_10001561 Ga0070685_100015615 133
57 3300005530 Ga0070679_100000652 Ga0070679_10000065231 133
58 3300005543 Ga0070672_100005074 Ga0070672_1000050746 133
59 3300005577 Ga0068857_100192786 Ga0068857_1001927863 133
60 3300005841 Ga0068863_100407010 Ga0068863_1004070102 133
61 3300005843 Ga0068860_100005217 Ga0068860_10000521710 133
62 3300010375 Ga0105239_10219473 Ga0105239_102194731 133
63 3300013105 Ga0157369_10315836 Ga0157369_103158363 133
64 3300013296 Ga0157374_10007870 Ga0157374_100078705 133
65 3300025903 Ga0207680_10250646 Ga0207680_102506462 133
66 3300025907 Ga0207645_10271440 Ga0207645_102714402 133
67 3300025909 Ga0207705_10000056 Ga0207705_10000056124 133
68 3300025909 Ga0207705_10033441 Ga0207705_100334414 133
69 3300025919 Ga0207657_10071572 Ga0207657_100715724 133
70 3300025921 Ga0207652_10001980 Ga0207652_1000198010 133
71 3300025925 Ga0207650_10065068 Ga0207650_100650684 133
72 3300025937 Ga0207669_10024191 Ga0207669_100241913 133
73 3300025938 Ga0207704_11046550 Ga0207704_110465501 133
74 3300025940 Ga0207691_10022874 Ga0207691_100228742 133
75 3300025960 Ga0207651_10000191 Ga0207651_100001915 133
76 3300025986 Ga0207658_10000003 Ga0207658_10000003626 133
77 3300026116 Ga0207674_10080709 Ga0207674_100807092 133
78 3300026121 Ga0207683_10007035 Ga0207683_100070352 133
79 3300028381 Ga0268264_10018543 Ga0268264_100185432 133
80 3300028556 Ga0265337_1035866 Ga0265337_10358661 133
81 3300037471 Ga0395905_0428940 Ga0395905_0428940_212_727 133
82 3300041460 Ga0451802_0118349 Ga0451802_0118349_192_704 133
83 3300053088 Ga0500644_0002318 Ga0500644_0002318_1413_1925 133
84 3300053118 Ga0500594_0000196 Ga0500594_0000196_7454_7966 133
85 3300003320 rootH2_10000244 rootH2_10000244408 134
86 3300005329 Ga0070683_100162613 Ga0070683_1001626132 134
87 3300005434 Ga0070709_10198230 Ga0070709_101982301 134
88 3300005530 Ga0070679_100361010 Ga0070679_1003610102 134
89 3300009174 Ga0105241_10002073 Ga0105241_100020739 134
90 3300009177 Ga0105248_11599381 Ga0105248_115993811 134
91 3300025911 Ga0207654_10003824 Ga0207654_100038243 134
92 3300025911 Ga0207654_10746145 Ga0207654_107461451 134
93 3300025921 Ga0207652_10376866 Ga0207652_103768661 134
94 3300025941 Ga0207711_10731787 Ga0207711_107317871 134
95 3300025944 Ga0207661_10133983 Ga0207661_101339832 134
96 3300045976 Ga0466967_0583732 Ga0466967_0583732_45_569 134
97 3300047320 Ga0495672_0000129 Ga0495672_0000129_24095_24619 134
98 3300047472 Ga0495686_0296065 Ga0495686_0296065_61_591 134
99 3300049571 Ga0501034_0280105 Ga0501034_0280105_700_1218 134
100 3300049580 Ga0501046_0041024 Ga0501046_0041024_1949_2470 134
101 3300053092 Ga0500583_0240101 Ga0500583_0240101_43_555 134
102 3300002244 JGI24742J22300_10000011 JGI24742J22300_1000001112 135
103 3300003316 rootH1_10166092 rootH1_101660923 135
104 3300003323 rootH1_10116708 rootH1_101167085 135
105 3300005327 Ga0070658_10000015 Ga0070658_1000001573 135
106 3300005327 Ga0070658_10002596 Ga0070658_100025965 135
107 3300005328 Ga0070676_10001822 Ga0070676_1000182210 135
108 3300005329 Ga0070683_100220553 Ga0070683_1002205531 135
109 3300005331 Ga0070670_100739324 Ga0070670_1007393242 135
110 3300005335 Ga0070666_10032186 Ga0070666_100321865 135
111 3300005336 Ga0070680_100024901 Ga0070680_1000249014 135
112 3300005337 Ga0070682_100004673 Ga0070682_1000046736 135
113 3300005339 Ga0070660_100020653 Ga0070660_1000206534 135
114 3300005364 Ga0070673_100144959 Ga0070673_1001449592 135
115 3300005530 Ga0070679_100001645 Ga0070679_1000016454 135
116 3300005530 Ga0070679_100021794 Ga0070679_1000217944 135
117 3300005535 Ga0070684_100001437 Ga0070684_10000143712 135
118 3300005535 Ga0070684_100468269 Ga0070684_1004682692 135
119 3300005548 Ga0070665_100160788 Ga0070665_1001607884 135
120 3300005563 Ga0068855_101120556 Ga0068855_1011205561 135
121 3300005564 Ga0070664_100279181 Ga0070664_1002791812 135
122 3300005617 Ga0068859_101061988 Ga0068859_1010619881 135
123 3300005618 Ga0068864_100223989 Ga0068864_1002239892 135
124 3300005719 Ga0068861_100097043 Ga0068861_1000970431 135
125 3300005844 Ga0068862_100636477 Ga0068862_1006364772 135
126 3300005937 Ga0081455_10000003 Ga0081455_10000003337 135
127 3300006042 Ga0075368_10000191 Ga0075368_1000019111 135
128 3300006048 Ga0075363_100001796 Ga0075363_1000017966 135
129 3300006178 Ga0075367_10027589 Ga0075367_100275891 135
130 3300006186 Ga0075369_10000005 Ga0075369_1000000574 135
131 3300006186 Ga0075369_10000056 Ga0075369_1000005617 135
132 3300006186 Ga0075369_10038587 Ga0075369_100385871 135
133 3300006186 Ga0075369_10084707 Ga0075369_100847072 135
134 3300006195 Ga0075366_10000001 Ga0075366_10000001437 135
135 3300006195 Ga0075366_10114601 Ga0075366_101146011 135
136 3300006353 Ga0075370_10026125 Ga0075370_100261254 135
137 3300006844 Ga0075428_100023417 Ga0075428_1000234174 135
138 3300006846 Ga0075430_100144665 Ga0075430_1001446653 135
139 3300006846 Ga0075430_101076899 Ga0075430_1010768991 135
140 3300006931 Ga0097620_101061779 Ga0097620_1010617791 135
141 3300009098 Ga0105245_10502247 Ga0105245_105022472 135
142 3300009098 Ga0105245_11309255 Ga0105245_113092552 135
143 3300009551 Ga0105238_10078049 Ga0105238_100780491 135
144 3300009551 Ga0105238_10184794 Ga0105238_101847943 135
145 3300009553 Ga0105249_10000802 Ga0105249_100008029 135
146 3300009553 Ga0105249_10578313 Ga0105249_105783132 135
147 3300009987 Ga0105030_102332 Ga0105030_1023323 135
148 3300010375 Ga0105239_10960717 Ga0105239_109607171 135
149 3300013100 Ga0157373_10074023 Ga0157373_100740233 135
150 3300013100 Ga0157373_10656166 Ga0157373_106561661 135
151 3300013307 Ga0157372_10032188 Ga0157372_100321887 135
152 3300013307 Ga0157372_10450622 Ga0157372_104506222 135
153 3300025315 Ga0207697_10403633 Ga0207697_104036331 135
154 3300025903 Ga0207680_10021780 Ga0207680_100217805 135
155 3300025907 Ga0207645_10001792 Ga0207645_100017924 135
156 3300025909 Ga0207705_10000011 Ga0207705_10000011272 135
157 3300025909 Ga0207705_10001854 Ga0207705_1000185412 135
158 3300025917 Ga0207660_10001351 Ga0207660_1000135111 135
159 3300025917 Ga0207660_10114422 Ga0207660_101144223 135
160 3300025919 Ga0207657_10150064 Ga0207657_101500643 135
161 3300025921 Ga0207652_10005637 Ga0207652_100056377 135
162 3300025921 Ga0207652_10030767 Ga0207652_100307674 135
163 3300025924 Ga0207694_10251952 Ga0207694_102519522 135
164 3300025944 Ga0207661_10000021 Ga0207661_10000021101 135
165 3300025961 Ga0207712_10006986 Ga0207712_100069865 135
166 3300026075 Ga0207708_10670696 Ga0207708_106706961 135
167 3300027866 Ga0209813_10000004 Ga0209813_10000004122 135
168 3300027907 Ga0207428_10006981 Ga0207428_100069818 135
169 3300031251 Ga0265327_10000017 Ga0265327_10000017130 135
170 3300031251 Ga0265327_10004018 Ga0265327_100040187 135
171 3300035092 Ga0373952_0048583 Ga0373952_0048583_420_941 135
172 3300037312 Ga0395899_0202822 Ga0395899_0202822_475_993 135
173 3300037418 Ga0395900_0004371 Ga0395900_0004371_8399_8917 135
174 3300037466 Ga0395898_0003425 Ga0395898_0003425_16191_16709 135
175 3300037471 Ga0395905_0225979 Ga0395905_0225979_295_816 135
176 3300038443 Ga0395901_0006077 Ga0395901_0006077_2686_3204 135
177 3300038443 Ga0395901_0077736 Ga0395901_0077736_2734_3255 135
178 3300046536 Ga0495587_0048605 Ga0495587_0048605_1342_1794 135
179 3300046557 Ga0495622_0000082 Ga0495622_0000082_19352_19804 135
180 3300046683 Ga0495658_0001953 Ga0495658_0001953_3687_4139 135
181 3300046809 Ga0495600_0003845 Ga0495600_0003845_2810_3262 135
182 3300047673 Ga0495593_0061381 Ga0495593_0061381_439_891 135
183 3300049568 Ga0501031_0000446 Ga0501031_0000446_16545_17105 135
184 3300049569 Ga0501032_0025133 Ga0501032_0025133_2279_2839 135
185 3300049573 Ga0501037_0000121 Ga0501037_0000121_71674_72234 135
186 3300049574 Ga0501038_0007638 Ga0501038_0007638_9113_9673 135
187 3300049576 Ga0501040_0574141 Ga0501040_0574141_49_609 135
188 3300049578 Ga0501042_0075611 Ga0501042_0075611_1193_1753 135
189 3300049579 Ga0501043_0011557 Ga0501043_0011557_4518_5078 135
190 3300049580 Ga0501046_0000922 Ga0501046_0000922_12049_12609 135
191 3300049581 Ga0501047_0003170 Ga0501047_0003170_12043_12603 135
192 3300049582 Ga0501048_0002409 Ga0501048_0002409_12722_13282 135
193 3300049586 Ga0501070_0050893 Ga0501070_0050893_286_846 135
194 3300049589 Ga0501073_0043727 Ga0501073_0043727_167_727 135
195 3300049822 Ga0501035_0000801 Ga0501035_0000801_31048_31608 135
196 3300050490 nmdc:mga03n38_8561_c1 nmdc:mga03n38_8561_c1_2810_3331 135
197 3300050493 nmdc:mga0k408_152301_c2 nmdc:mga0k408_152301_c2_369_890 135
198 3300050493 nmdc:mga0k408_16584_c1 nmdc:mga0k408_16584_c1_576_1094 135
199 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_675724_676179 135
200 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_93917_94438 135
201 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_26624_27145 135
202 3300050496 nmdc:mga07m45_15944_c2 nmdc:mga07m45_15944_c2_1111_1566 135
203 3300050496 nmdc:mga07m45_95100_c1 nmdc:mga07m45_95100_c1_698_1219 135
204 3300050509 nmdc:mga0qj67_890194_c1 nmdc:mga0qj67_890194_c1_111_632 135
205 3300050511 nmdc:mga08y16_1132_c1 nmdc:mga08y16_1132_c1_14260_14778 135
206 3300050516 nmdc:mga0sz30_12781_c2 nmdc:mga0sz30_12781_c2_2178_2699 135
207 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_223564_223995 135
208 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_17151_17606 135
209 3300050516 nmdc:mga0sz30_9988_c2 nmdc:mga0sz30_9988_c2_843_1361 135
210 3300053079 Ga0500610_0000001 Ga0500610_0000001_108912_109430 135
211 3300053087 Ga0500643_000038 Ga0500643_000038_81053_81574 135
212 3300053087 Ga0500643_020544 Ga0500643_020544_1523_2041 135
213 3300053088 Ga0500644_0000006 Ga0500644_0000006_131204_131722 135
214 3300053094 Ga0500566_0000001 Ga0500566_0000001_626662_627114 135
215 3300053103 Ga0500555_000002 Ga0500555_000002_525443_525961 135
216 3300053104 Ga0500556_0000295 Ga0500556_0000295_21295_21822 135
217 3300053108 Ga0500562_132838 Ga0500562_132838_91_609 135
218 3300053131 Ga0500652_000020 Ga0500652_000020_13498_14016 135
219 3300053136 Ga0500559_0031524 Ga0500559_0031524_80_532 135
220 3300053141 Ga0500574_122673 Ga0500574_122673_221_673 135
221 3300053151 Ga0500604_0155796 Ga0500604_0155796_194_616 135
222 3300053153 Ga0500616_0000005 Ga0500616_0000005_346424_346954 135
223 3300053724 Ga0500570_000005 Ga0500570_000005_58904_59431 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01245

Ribosomal_L19

Ribosomal protein L19

10

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7asn-assembly1.cif.gz_N staphylococcus aureus 50s after 30 minutes incubation a 37c 0.8655 1 95
5nd8-assembly1.cif.gz_S hibernating ribosome from staphylococcus aureus (unrotated state) 0.8587 2 95
4csu-assembly1.cif.gz_P cryo-em structures of the 50s ribosome subunit bound with obge 0.8328 4 95
5mrc-assembly1.cif.gz_M structure of the yeast mitochondrial ribosome - class a 0.8159 19 91
5dm7-assembly1.cif.gz_M crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.8142 4 102
ID Description Score Start End Superfamily
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7953 6 109 2.30.30.790
af_I1N0B6_91_236_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7479 5 103 2.30.30.790
af_Q8W463_117_224_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.745 5 103 2.30.30.790
af_C0P2I3_122_238_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7415 5 103 2.30.30.790
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7403 6 109 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A1Q7S5A4-F1-model_v4 50S ribosomal protein L19 0.9346 6 92 GO:0003735
GO:0006412
GO:0022625
AF-A0A0G1WT03-F1-model_v4 50S ribosomal protein L19 0.9339 5 92 GO:0003735
GO:0006412
GO:0022625
AF-A0A1W6EGW6-F1-model_v4 Ribosomal protein L19 0.9287 1 87 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904
AF-A0A383C2L1-F1-model_v4 50S ribosomal protein L19 0.9221 2 89 GO:0003735
GO:0006412
GO:0022625
AF-A0A258HDF6-F1-model_v4 50S ribosomal protein L19 0.9217 2 88 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
73.56 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map