F335133

General Info

Members Datasets Scaffolds Average Seq Length
223 139 446 284

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002519|JGI25406J46586_100025195
Length 295
Sequence MADERARDARVSILADPKLREHKVMGGMDSFADRSFWPNFFSKLVARLQWDHAAIDLTPDAREWPRLPAERRRRLTTLLAGFRVGDDLVSEHIAPFADAARQGTMTSQESLMAWVFFLQRRDEQRHAKFFDRVAAEVLGLPGVTPEERRAAARAKAPPAMVELFEEKLPAMAAEIAAGRKELSEGVSLYHMLLEGVVFDAGQRTLIDDLADGALPGVYEGVQRVQLDERWHIGFGLRCLIETQPSREILGDLLERAEEAAEVWGDAVSAAMRRACAQRVAHRLHVSGLIHAPAAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.9
Rhizosphere 85.2
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002519 3300003203 Bacteria 8676
2 JGI25407J50210_10001042 3300003373 Bacteria 6088
3 JGI25407J50210_10031443 3300003373 Bacteria 1374
4 Ga0070676_10077585 3300005328 Bacteria 2008
5 Ga0070683_100021600 3300005329 Bacteria 5745
6 Ga0070683_100039894 3300005329 Bacteria 4313
7 Ga0070683_100040579 3300005329 Bacteria 4280
8 Ga0070680_100470433 3300005336 Bacteria 1074
9 Ga0070682_100029185 3300005337 Bacteria 3320
10 Ga0070691_10126287 3300005341 Bacteria 1292
11 Ga0070687_100159472 3300005343 Bacteria 1332
12 Ga0070675_100436277 3300005354 Bacteria 1173
13 Ga0070671_100194333 3300005355 Bacteria 1720
14 Ga0070674_100288828 3300005356 Bacteria 1303
15 Ga0070688_100155333 3300005365 Bacteria 1567
16 Ga0070659_100078487 3300005366 Bacteria 2634
17 Ga0070710_10050595 3300005437 Bacteria 2330
18 Ga0070701_10056781 3300005438 Bacteria 2049
19 Ga0070701_10144432 3300005438 Bacteria 1364
20 Ga0070700_100013163 3300005441 Bacteria 4641
21 Ga0070700_100086675 3300005441 Bacteria 2034
22 Ga0070685_10047724 3300005466 Bacteria 2464
23 Ga0070684_100004108 3300005535 Bacteria 11008
24 Ga0070684_100161326 3300005535 Bacteria 2034
25 Ga0068853_100152762 3300005539 Bacteria 2079
26 Ga0070665_100630728 3300005548 Bacteria 1085
27 Ga0070664_100198864 3300005564 Bacteria 1788
28 Ga0068856_100375475 3300005614 Bacteria 1441
29 Ga0068856_100400786 3300005614 Bacteria 1392
30 Ga0070702_100004068 3300005615 Bacteria 6631
31 Ga0068852_100144234 3300005616 Bacteria 2207
32 Ga0068866_10016804 3300005718 Bacteria 3278
33 Ga0068863_100119503 3300005841 Bacteria 2512
34 Ga0081538_10000166 3300005981 Bacteria 70452
35 Ga0081538_10001996 3300005981 Bacteria 20387
36 Ga0081538_10002041 3300005981 Bacteria 20145
37 Ga0081538_10002546 3300005981 Bacteria 17728
38 Ga0081538_10008406 3300005981 Bacteria 8769
39 Ga0081538_10024675 3300005981 Bacteria 4276
40 Ga0081538_10032655 3300005981 Bacteria 3482
41 Ga0081538_10071353 3300005981 Bacteria 1911
42 Ga0081538_10115582 3300005981 Bacteria 1304
43 Ga0081540_1000312 3300005983 Bacteria 50256
44 Ga0081540_1032219 3300005983 Bacteria 2866
45 Ga0081539_10000834 3300005985 Bacteria 59270
46 Ga0081539_10001410 3300005985 Bacteria 41377
47 Ga0081539_10131888 3300005985 Bacteria 1226
48 Ga0070712_100050161 3300006175 Bacteria 2902
49 Ga0075428_100053546 3300006844 Bacteria 4422
50 Ga0075428_100344879 3300006844 Bacteria 1599
51 Ga0075430_100005761 3300006846 Bacteria 10452
52 Ga0075431_100004111 3300006847 Bacteria 14211
53 Ga0075431_100203594 3300006847 Bacteria 2024
54 Ga0075433_10019479 3300006852 Bacteria 5655
55 Ga0075434_100218739 3300006871 Bacteria 1924
56 Ga0068865_100055782 3300006881 Bacteria 2751
57 Ga0075435_100159121 3300007076 Bacteria 1902
58 Ga0111539_10017881 3300009094 Bacteria 8780
59 Ga0111539_10022839 3300009094 Bacteria 7683
60 Ga0105245_10009511 3300009098 Bacteria 8475
61 Ga0105247_10121597 3300009101 Bacteria 1692
62 Ga0114129_10253000 3300009147 Bacteria 2364
63 Ga0114129_10504628 3300009147 Bacteria 1579
64 Ga0105243_10095992 3300009148 Bacteria 2451
65 Ga0105243_10140760 3300009148 Bacteria 2058
66 Ga0105243_10440068 3300009148 Bacteria 1220
67 Ga0105242_10323630 3300009176 Bacteria 1415
68 Ga0105248_10098510 3300009177 Bacteria 3294
69 Ga0105249_10007578 3300009553 Bacteria 9471
70 Ga0105249_10395561 3300009553 Bacteria 1411
71 Ga0105239_10049779 3300010375 Bacteria 4595
72 Ga0105239_10390742 3300010375 Bacteria 1574
73 Ga0157369_10553916 3300013105 Bacteria 1188
74 Ga0157374_10695006 3300013296 Bacteria 1030
75 Ga0163162_10365777 3300013306 Bacteria 1575
76 Ga0157372_10210389 3300013307 Bacteria 2254
77 Ga0157375_10386216 3300013308 Bacteria 1567
78 Ga0157375_10672861 3300013308 Bacteria 1190
79 Ga0157375_10853304 3300013308 Unclassified 1057
80 Ga0163163_10933851 3300014325 Bacteria 931
81 Ga0157380_10017613 3300014326 Bacteria 5287
82 Ga0157377_10003497 3300014745 Bacteria 7113
83 Ga0213873_10003730 3300021358 Bacteria 2777
84 Ga0207692_10016691 3300025898 Bacteria 3259
85 Ga0207642_10013915 3300025899 Bacteria 2952
86 Ga0207688_10013876 3300025901 Bacteria 4380
87 Ga0207688_10058480 3300025901 Bacteria 2169
88 Ga0207645_10109172 3300025907 Bacteria 1790
89 Ga0207643_10036409 3300025908 Bacteria 2760
90 Ga0207693_10062908 3300025915 Bacteria 2907
91 Ga0207657_10099758 3300025919 Bacteria 2411
92 Ga0207690_10061114 3300025932 Bacteria 2560
93 Ga0207706_10013719 3300025933 Bacteria 7353
94 Ga0207706_10026126 3300025933 Bacteria 5228
95 Ga0207709_10049901 3300025935 Bacteria 2556
96 Ga0207709_10200963 3300025935 Bacteria 1423
97 Ga0207711_10110782 3300025941 Bacteria 2441
98 Ga0207661_10082771 3300025944 Bacteria 2654
99 Ga0207661_10137432 3300025944 Bacteria 2100
100 Ga0207679_10137605 3300025945 Bacteria 1969
101 Ga0207712_10150613 3300025961 Bacteria 1796
102 Ga0207668_10237789 3300025972 Bacteria 1472
103 Ga0207677_10318011 3300026023 Bacteria 1292
104 Ga0207708_10000271 3300026075 Bacteria 40456
105 Ga0207708_10008250 3300026075 Bacteria 7713
106 Ga0207708_10024225 3300026075 Bacteria 4589
107 Ga0207648_10153408 3300026089 Bacteria 2033
108 Ga0207676_10018064 3300026095 Bacteria 5121
109 Ga0207676_10159823 3300026095 Bacteria 1951
110 Ga0207675_100074996 3300026118 Bacteria 3166
111 Ga0207698_10192429 3300026142 Bacteria 1819
112 Ga0207428_10021026 3300027907 Bacteria 5532
113 Ga0207428_10142583 3300027907 Bacteria 1827
114 Ga0307408_100076231 3300031548 Bacteria 2494
115 Ga0307406_10012011 3300031901 Bacteria 4926
116 Ga0307406_10130271 3300031901 Unclassified 1765
117 Ga0307406_10213277 3300031901 Bacteria 1430
118 Ga0307406_10232267 3300031901 Bacteria 1378
119 Ga0307409_100192624 3300031995 Unclassified 1816
120 Ga0307416_100098138 3300032002 Bacteria 2540
121 Ga0307416_100135464 3300032002 Bacteria 2227
122 Ga0307416_100346552 3300032002 Unclassified 1501
123 Ga0307416_100374798 3300032002 Bacteria 1451
124 Ga0307415_100260722 3300032126 Bacteria 1414
125 Ga0373943_0126095 3300035170 Bacteria 1365
126 Ga0395898_0203373 3300037466 Bacteria 1890
127 Ga0436364_1027295 3300037853 Bacteria 21751
128 Ga0395901_0011632 3300038443 Bacteria 8912
129 Ga0395901_0179622 3300038443 Bacteria 2220
130 Ga0395901_0380756 3300038443 Unclassified 1452
131 Ga0436365_0764156 3300039437 Bacteria 2245
132 Ga0436362_0282739 3300039453 Bacteria 2851
133 Ga0439444_0024112 3300042437 Bacteria 1097
134 Ga0466963_0137051 3300044694 Bacteria 1694
135 Ga0466957_0045928 3300044842 Bacteria 2650
136 Ga0466967_0009580 3300045976 Bacteria 7198
137 Ga0466967_0040036 3300045976 Bacteria 4033
138 Ga0495609_0146588 3300046538 Unclassified 1006
139 Ga0495656_0021089 3300046615 Bacteria 2534
140 Ga0495670_0172161 3300046691 Bacteria 1141
141 Ga0495581_0070266 3300047315 Bacteria 2025
142 Ga0496100_0078025 3300048903 Bacteria 2228
143 Ga0496101_0003564 3300048904 Bacteria 9713
144 Ga0496101_0163703 3300048904 Bacteria 1707
145 Ga0496102_0005604 3300048905 Bacteria 10658
146 Ga0496102_0012766 3300048905 Bacteria 7273
147 Ga0496102_0394437 3300048905 Bacteria 1302
148 Ga0496103_0103717 3300048906 Bacteria 1802
149 Ga0496103_0103840 3300048906 Bacteria 1801
150 Ga0496104_0054003 3300048907 Bacteria 3797
151 Ga0496104_0231233 3300048907 Bacteria 1761
152 Ga0496106_0015486 3300048909 Bacteria 5645
153 Ga0496106_0017885 3300048909 Bacteria 5242
154 Ga0496106_0025325 3300048909 Bacteria 4415
155 Ga0496106_0143766 3300048909 Bacteria 1878
156 Ga0496107_0024845 3300048910 Bacteria 4240
157 Ga0496108_0023943 3300048911 Bacteria 5026
158 Ga0496108_0130052 3300048911 Bacteria 2164
159 Ga0496109_0108711 3300048912 Bacteria 2577
160 Ga0496109_0226290 3300048912 Bacteria 1759
161 Ga0496110_0024275 3300048913 Bacteria 5165
162 Ga0496110_0092837 3300048913 Bacteria 2701
163 Ga0496110_0157590 3300048913 Bacteria 2057
164 Ga0496111_0044115 3300048914 Bacteria 3205
165 Ga0496111_0050283 3300048914 Bacteria 3006
166 Ga0496111_0142888 3300048914 Bacteria 1773
167 Ga0496112_0017040 3300048915 Bacteria 6821
168 Ga0496112_0275134 3300048915 Bacteria 1631
169 Ga0496113_0023024 3300048916 Bacteria 4414
170 Ga0496113_0045806 3300048916 Bacteria 3245
171 Ga0496113_0245958 3300048916 Bacteria 1427
172 Ga0496115_0024602 3300048918 Bacteria 4683
173 Ga0501031_0173465 3300049568 Bacteria 1409
174 Ga0501031_0191341 3300049568 Bacteria 1336
175 Ga0501033_0484481 3300049570 Bacteria 857
176 Ga0501036_0181936 3300049572 Bacteria 1769
177 Ga0501036_0197696 3300049572 Bacteria 1691
178 Ga0501037_0165528 3300049573 Bacteria 1575
179 Ga0501038_0077689 3300049574 Bacteria 2802
180 Ga0501038_0153410 3300049574 Bacteria 1877
181 Ga0501040_0064229 3300049576 Bacteria 2527
182 Ga0501040_0111218 3300049576 Bacteria 1915
183 Ga0501040_0139472 3300049576 Bacteria 1707
184 Ga0501041_0046920 3300049577 Bacteria 2629
185 Ga0501041_0110293 3300049577 Bacteria 1707
186 Ga0501042_0038486 3300049578 Bacteria 3396
187 Ga0501042_0168798 3300049578 Bacteria 1579
188 Ga0501042_0305467 3300049578 Bacteria 1149
189 Ga0501046_0067877 3300049580 Bacteria 2776
190 Ga0501048_0020170 3300049582 Bacteria 4889
191 Ga0501070_0300356 3300049586 Bacteria 1308
192 Ga0501071_0024556 3300049587 Bacteria 4217
193 Ga0501071_0063623 3300049587 Bacteria 2675
194 Ga0501072_0013042 3300049588 Bacteria 6362
195 Ga0501075_0113001 3300049591 Bacteria 2065
196 Ga0501075_0120573 3300049591 Bacteria 1996
197 Ga0501076_0007008 3300049592 Bacteria 8188
198 Ga0501076_0311334 3300049592 Bacteria 1291
199 Ga0501077_0051034 3300049593 Bacteria 2629
200 Ga0501077_0060493 3300049593 Bacteria 2404
201 Ga0501079_0024974 3300049741 Bacteria 4584
202 Ga0501079_0037190 3300049741 Bacteria 3751
203 Ga0501079_0184588 3300049741 Bacteria 1628
204 Ga0501081_0109254 3300049743 Bacteria 1962
205 Ga0501035_0449133 3300049822 Bacteria 1067
206 Ga0501045_0017454 3300049824 Bacteria 5096
207 nmdc:mga05p37_499802_c1 3300050507 Bacteria 1396
208 nmdc:mga0qj67_17901_c1 3300050509 Bacteria 5394
209 nmdc:mga06r32_593791_c1 3300050510 Bacteria 1078
210 nmdc:mga06r32_62177_c1 3300050510 Bacteria 3597
211 nmdc:mga08y16_120317_c1 3300050511 Bacteria 2732
212 nmdc:mga08y16_65103_c1 3300050511 Bacteria 3805
213 nmdc:mga0n895_187148_c1 3300050512 Bacteria 2101
214 nmdc:mga0a205_263761_c1 3300050515 Bacteria 1600
215 Ga0501084_0027910 3300054114 Bacteria 4717
216 Ga0501084_0033289 3300054114 Bacteria 4312
217 Ga0501084_0073244 3300054114 Bacteria 2868
218 Ga0501084_0235816 3300054114 Bacteria 1544
219 Ga0501082_0017693 3300060353 Bacteria 6137
220 Ga0501082_0058160 3300060353 Bacteria 3331
221 Ga0530510_0020997 3300061734 Bacteria 4644
222 Ga0530510_0030605 3300061734 Bacteria 3867
223 Ga0530510_0047694 3300061734 Bacteria 3095
224 JGI25406J46586_10002519
225 JGI25407J50210_10001042
226 JGI25407J50210_10031443
227 Ga0070676_10077585
228 Ga0070683_100021600
229 Ga0070683_100039894
230 Ga0070683_100040579
231 Ga0070680_100470433
232 Ga0070682_100029185
233 Ga0070691_10126287
234 Ga0070687_100159472
235 Ga0070675_100436277
236 Ga0070671_100194333
237 Ga0070674_100288828
238 Ga0070688_100155333
239 Ga0070659_100078487
240 Ga0070710_10050595
241 Ga0070701_10056781
242 Ga0070701_10144432
243 Ga0070700_100013163
244 Ga0070700_100086675
245 Ga0070685_10047724
246 Ga0070684_100004108
247 Ga0070684_100161326
248 Ga0068853_100152762
249 Ga0070665_100630728
250 Ga0070664_100198864
251 Ga0068856_100375475
252 Ga0068856_100400786
253 Ga0070702_100004068
254 Ga0068852_100144234
255 Ga0068866_10016804
256 Ga0068863_100119503
257 Ga0081538_10000166
258 Ga0081538_10001996
259 Ga0081538_10002041
260 Ga0081538_10002546
261 Ga0081538_10008406
262 Ga0081538_10024675
263 Ga0081538_10032655
264 Ga0081538_10071353
265 Ga0081538_10115582
266 Ga0081540_1000312
267 Ga0081540_1032219
268 Ga0081539_10000834
269 Ga0081539_10001410
270 Ga0081539_10131888
271 Ga0070712_100050161
272 Ga0075428_100053546
273 Ga0075428_100344879
274 Ga0075430_100005761
275 Ga0075431_100004111
276 Ga0075431_100203594
277 Ga0075433_10019479
278 Ga0075434_100218739
279 Ga0068865_100055782
280 Ga0075435_100159121
281 Ga0111539_10017881
282 Ga0111539_10022839
283 Ga0105245_10009511
284 Ga0105247_10121597
285 Ga0114129_10253000
286 Ga0114129_10504628
287 Ga0105243_10095992
288 Ga0105243_10140760
289 Ga0105243_10440068
290 Ga0105242_10323630
291 Ga0105248_10098510
292 Ga0105249_10007578
293 Ga0105249_10395561
294 Ga0105239_10049779
295 Ga0105239_10390742
296 Ga0157369_10553916
297 Ga0157374_10695006
298 Ga0163162_10365777
299 Ga0157372_10210389
300 Ga0157375_10386216
301 Ga0157375_10672861
302 Ga0157375_10853304
303 Ga0163163_10933851
304 Ga0157380_10017613
305 Ga0157377_10003497
306 Ga0213873_10003730
307 Ga0207692_10016691
308 Ga0207642_10013915
309 Ga0207688_10013876
310 Ga0207688_10058480
311 Ga0207645_10109172
312 Ga0207643_10036409
313 Ga0207693_10062908
314 Ga0207657_10099758
315 Ga0207690_10061114
316 Ga0207706_10013719
317 Ga0207706_10026126
318 Ga0207709_10049901
319 Ga0207709_10200963
320 Ga0207711_10110782
321 Ga0207661_10082771
322 Ga0207661_10137432
323 Ga0207679_10137605
324 Ga0207712_10150613
325 Ga0207668_10237789
326 Ga0207677_10318011
327 Ga0207708_10000271
328 Ga0207708_10008250
329 Ga0207708_10024225
330 Ga0207648_10153408
331 Ga0207676_10018064
332 Ga0207676_10159823
333 Ga0207675_100074996
334 Ga0207698_10192429
335 Ga0207428_10021026
336 Ga0207428_10142583
337 Ga0307408_100076231
338 Ga0307406_10012011
339 Ga0307406_10130271
340 Ga0307406_10213277
341 Ga0307406_10232267
342 Ga0307409_100192624
343 Ga0307416_100098138
344 Ga0307416_100135464
345 Ga0307416_100346552
346 Ga0307416_100374798
347 Ga0307415_100260722
348 Ga0373943_0126095
349 Ga0395898_0203373
350 Ga0436364_1027295
351 Ga0395901_0011632
352 Ga0395901_0179622
353 Ga0395901_0380756
354 Ga0436365_0764156
355 Ga0436362_0282739
356 Ga0439444_0024112
357 Ga0466963_0137051
358 Ga0466957_0045928
359 Ga0466967_0009580
360 Ga0466967_0040036
361 Ga0495609_0146588
362 Ga0495656_0021089
363 Ga0495670_0172161
364 Ga0495581_0070266
365 Ga0496100_0078025
366 Ga0496101_0003564
367 Ga0496101_0163703
368 Ga0496102_0005604
369 Ga0496102_0012766
370 Ga0496102_0394437
371 Ga0496103_0103717
372 Ga0496103_0103840
373 Ga0496104_0054003
374 Ga0496104_0231233
375 Ga0496106_0015486
376 Ga0496106_0017885
377 Ga0496106_0025325
378 Ga0496106_0143766
379 Ga0496107_0024845
380 Ga0496108_0023943
381 Ga0496108_0130052
382 Ga0496109_0108711
383 Ga0496109_0226290
384 Ga0496110_0024275
385 Ga0496110_0092837
386 Ga0496110_0157590
387 Ga0496111_0044115
388 Ga0496111_0050283
389 Ga0496111_0142888
390 Ga0496112_0017040
391 Ga0496112_0275134
392 Ga0496113_0023024
393 Ga0496113_0045806
394 Ga0496113_0245958
395 Ga0496115_0024602
396 Ga0501031_0173465
397 Ga0501031_0191341
398 Ga0501033_0484481
399 Ga0501036_0181936
400 Ga0501036_0197696
401 Ga0501037_0165528
402 Ga0501038_0077689
403 Ga0501038_0153410
404 Ga0501040_0064229
405 Ga0501040_0111218
406 Ga0501040_0139472
407 Ga0501041_0046920
408 Ga0501041_0110293
409 Ga0501042_0038486
410 Ga0501042_0168798
411 Ga0501042_0305467
412 Ga0501046_0067877
413 Ga0501048_0020170
414 Ga0501070_0300356
415 Ga0501071_0024556
416 Ga0501071_0063623
417 Ga0501072_0013042
418 Ga0501075_0113001
419 Ga0501075_0120573
420 Ga0501076_0007008
421 Ga0501076_0311334
422 Ga0501077_0051034
423 Ga0501077_0060493
424 Ga0501079_0024974
425 Ga0501079_0037190
426 Ga0501079_0184588
427 Ga0501081_0109254
428 Ga0501035_0449133
429 Ga0501045_0017454
430 nmdc:mga05p37_499802_c1
431 nmdc:mga0qj67_17901_c1
432 nmdc:mga06r32_593791_c1
433 nmdc:mga06r32_62177_c1
434 nmdc:mga08y16_120317_c1
435 nmdc:mga08y16_65103_c1
436 nmdc:mga0n895_187148_c1
437 nmdc:mga0a205_263761_c1
438 Ga0501084_0027910
439 Ga0501084_0033289
440 Ga0501084_0073244
441 Ga0501084_0235816
442 Ga0501082_0017693
443 Ga0501082_0058160
444 Ga0530510_0020997
445 Ga0530510_0030605
446 Ga0530510_0047694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ani-assembly1.cif.gz_A-2 crystal structure of the f127y mutant of ribonucleotide reductase r2 from chlamydia trachomatis 0.8128 36 283
4d8g-assembly2.cif.gz_D chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 2 - low mn) 0.8071 36 283
6qrz-assembly1.cif.gz_A-2 crystal structure of r2-like ligand-binding oxidase from sulfolobus acidocaldarius solved by 3d micro-crystal electron diffraction 0.7987 35 286
7qbp-assembly1.cif.gz_A-2 crystal structure of r2-like ligand-binding oxidase from saccharopolyspora erythraea 0.7822 24 286
6y2n-assembly1.cif.gz_A-2 crystal structure of ribonucleotide reductase r2 subunit solved by serial synchrotron crystallography 0.7814 36 295
ID Description Score Start End Superfamily
4d8gD00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8071 36 283 1.10.620.20
6qrzA00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.7987 35 286 1.10.620.20
af_Q54E77_71_257_1.10.620.20 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.7813 23 224 1.10.620.20
2vuxB00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.7622 25 286 1.10.620.20
af_Q54E77_71_257_1.10.620.20 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.7546 23 224 1.10.620.20
ID Description Score Start End GO Terms
AF-A0A7V9PMN5-F1-model_v4 Ribonucleotide reductase 0.9869 37 288 GO:0016491
AF-A0A660KZQ1-F1-model_v4 Ribonucleoside-diphosphate reductase beta chain 0.9463 38 286 GO:0016491
AF-A0A7W1MZ36-F1-model_v4 Ribonucleotide-diphosphate reductase subunit beta 0.9413 38 295 GO:0009263
GO:0016491
AF-A0A7V9PMN5-F1-model_v4 Ribonucleotide reductase 0.9411 37 288 GO:0016491
AF-A0A7W0XSL2-F1-model_v4 Ribonucleotide reductase 0.9338 38 162 GO:0016491

Map