F334870

General Info

Members Datasets Scaffolds Average Seq Length
222 133 444 234

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0241171|Ga0496100_0241171_186_929
Length 247
Sequence MSEPLLEVTVLHPRDVTGAQEGGADRLHLVAPGPEAALSPEPGVVSSVCRETELPVFVLLRLNDSWTTTGGELTRLVGLAEDYLGCGAAGVSFGFLDADLEIDTEVCAHLTSSLPGVPWTFHRAVDATLDPRRSWRRLVGLPGLVAVRSAGSPQGLTVGYDDLLATASSDPAVAGLLMPGGGLLAEHVPWFVRAGVSRFHLGRQVRPGASYKSYVDAGHVRSWRLLLDSAVERASVSGSASDRASSA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
126 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 2643221561 Nocardioides sp. Root151 Isolate Unclassified
131 2643221615 Nocardioides sp. Root224 Isolate Unclassified
132 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
133 2643221696 Nocardioides sp. Root140 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.47
Nodule 0
Rhizoplane 17.57
Rhizosphere 60.36
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0241171 3300048903 Bacteria 1334
2 rootH1_10030741 3300003316 Bacteria 1933
3 rootH1_10167793 3300003323 Bacteria 3338
4 Ga0070683_100011149 3300005329 Bacteria 7755
5 Ga0070683_100016797 3300005329 Bacteria 6456
6 Ga0070680_100215497 3300005336 Bacteria 1620
7 Ga0070682_100008325 3300005337 Bacteria 5847
8 Ga0070660_100007397 3300005339 Bacteria 7648
9 Ga0070687_100123971 3300005343 Bacteria 1482
10 Ga0070675_100381452 3300005354 Bacteria 1255
11 Ga0070667_100042882 3300005367 Bacteria 3796
12 Ga0070667_100104369 3300005367 Bacteria 2452
13 Ga0070667_100158015 3300005367 Bacteria 1995
14 Ga0070700_100153421 3300005441 Bacteria 1578
15 Ga0070684_100015966 3300005535 Bacteria 6132
16 Ga0070672_100230484 3300005543 Bacteria 1556
17 Ga0070686_100122524 3300005544 Bacteria 1787
18 Ga0070665_100006294 3300005548 Bacteria 12125
19 Ga0068856_100024270 3300005614 Bacteria 5900
20 Ga0068864_100009379 3300005618 Bacteria 8075
21 Ga0068861_100114465 3300005719 Bacteria 2166
22 Ga0068858_100233694 3300005842 Bacteria 1743
23 Ga0075365_10017692 3300006038 Bacteria 4368
24 Ga0075365_10056941 3300006038 Bacteria 2600
25 Ga0075365_10059617 3300006038 Bacteria 2544
26 Ga0075365_10170368 3300006038 Bacteria 1519
27 Ga0075365_10283745 3300006038 Bacteria 1165
28 Ga0075365_10360424 3300006038 Bacteria 1025
29 Ga0075368_10012198 3300006042 Bacteria 3138
30 Ga0075368_10026403 3300006042 Bacteria 2233
31 Ga0075363_100021929 3300006048 Bacteria 3224
32 Ga0075363_100040035 3300006048 Bacteria 2469
33 Ga0075363_100074409 3300006048 Bacteria 1849
34 Ga0075364_10086107 3300006051 Bacteria 2081
35 Ga0075364_10099729 3300006051 Bacteria 1933
36 Ga0075364_10105937 3300006051 Bacteria 1873
37 Ga0075364_10197423 3300006051 Bacteria 1363
38 Ga0075367_10079804 3300006178 Bacteria 1978
39 Ga0075367_10085807 3300006178 Bacteria 1910
40 Ga0075367_10101266 3300006178 Bacteria 1761
41 Ga0075367_10210467 3300006178 Bacteria 1216
42 Ga0075367_10242934 3300006178 Bacteria 1129
43 Ga0075370_10049284 3300006353 Bacteria 2387
44 Ga0075370_10282873 3300006353 Bacteria 985
45 Ga0111539_10503416 3300009094 Bacteria 1411
46 Ga0105243_10075804 3300009148 Bacteria 2731
47 Ga0105243_10450288 3300009148 Bacteria 1208
48 Ga0105242_10141830 3300009176 Bacteria 2086
49 Ga0105248_10106986 3300009177 Bacteria 3154
50 Ga0105237_10880190 3300009545 Unclassified 902
51 Ga0105238_10551816 3300009551 Bacteria 1157
52 Ga0105249_10074334 3300009553 Bacteria 3146
53 Ga0105246_10001006 3300011119 Bacteria 16190
54 Ga0157369_10096758 3300013105 Bacteria 3149
55 Ga0157369_10293041 3300013105 Bacteria 1694
56 Ga0163162_10232431 3300013306 Bacteria 1974
57 Ga0157372_10003355 3300013307 Bacteria 17290
58 Ga0157372_10215172 3300013307 Bacteria 2227
59 Ga0157375_10062597 3300013308 Bacteria 3698
60 Ga0157375_10071280 3300013308 Bacteria 3488
61 Ga0157375_10980237 3300013308 Bacteria 986
62 Ga0157375_11263361 3300013308 Bacteria 867
63 Ga0163163_10231509 3300014325 Bacteria 1897
64 Ga0157379_10036572 3300014968 Bacteria 4377
65 Ga0163161_10013070 3300017792 Bacteria 5769
66 Ga0207688_10037742 3300025901 Bacteria 2680
67 Ga0207660_10148381 3300025917 Bacteria 1800
68 Ga0207657_10027371 3300025919 Bacteria 5223
69 Ga0207686_10033351 3300025934 Bacteria 3073
70 Ga0207709_10419340 3300025935 Bacteria 1028
71 Ga0207704_10037815 3300025938 Bacteria 2792
72 Ga0207691_10229694 3300025940 Bacteria 1607
73 Ga0207711_10064814 3300025941 Bacteria 3156
74 Ga0207661_10020338 3300025944 Bacteria 4960
75 Ga0207661_10065881 3300025944 Bacteria 2941
76 Ga0207661_10081958 3300025944 Bacteria 2666
77 Ga0207667_10091544 3300025949 Bacteria 3141
78 Ga0207712_10042190 3300025961 Bacteria 3140
79 Ga0207668_10694531 3300025972 Bacteria 894
80 Ga0207658_10045872 3300025986 Bacteria 3188
81 Ga0207658_10207314 3300025986 Bacteria 1641
82 Ga0207658_10224175 3300025986 Bacteria 1583
83 Ga0207703_10205795 3300026035 Bacteria 1751
84 Ga0207708_10026281 3300026075 Bacteria 4404
85 Ga0207702_10163624 3300026078 Bacteria 2033
86 Ga0207676_10014910 3300026095 Bacteria 5599
87 Ga0207674_10100813 3300026116 Bacteria 2868
88 Ga0207675_100098016 3300026118 Bacteria 2761
89 Ga0207683_10046677 3300026121 Bacteria 3792
90 Ga0207698_10194174 3300026142 Bacteria 1812
91 Ga0268266_10001692 3300028379 Bacteria 25320
92 Ga0268264_10000468 3300028381 Bacteria 54851
93 Ga0268264_10027966 3300028381 Bacteria 4611
94 Ga0307405_10289134 3300031731 Bacteria 1238
95 Ga0307413_10252513 3300031824 Bacteria 1309
96 Ga0307410_10160326 3300031852 Bacteria 1685
97 Ga0307409_100049022 3300031995 Bacteria 3218
98 Ga0307409_100082796 3300031995 Bacteria 2599
99 Ga0307409_100117324 3300031995 Bacteria 2246
100 Ga0307409_100197877 3300031995 Bacteria 1795
101 Ga0307416_100243262 3300032002 Bacteria 1745
102 Ga0307416_100821620 3300032002 Bacteria 1026
103 Ga0307411_10108595 3300032005 Bacteria 1980
104 Ga0451853_1344524 3300041512 Unclassified 902
105 Ga0466972_0068612 3300044658 Bacteria 1694
106 Ga0466965_0103787 3300044683 Bacteria 1456
107 Ga0466966_0086713 3300044684 Bacteria 1946
108 Ga0466961_0033595 3300044693 Bacteria 3295
109 Ga0466963_0007128 3300044694 Bacteria 6661
110 Ga0466963_0073033 3300044694 Bacteria 2312
111 Ga0466963_0222697 3300044694 Bacteria 1321
112 Ga0466971_0172644 3300044719 Bacteria 1015
113 Ga0466970_0105991 3300044765 Bacteria 1533
114 Ga0466970_0406300 3300044765 Bacteria 777
115 Ga0466957_0187331 3300044842 Bacteria 1354
116 Ga0466960_0010632 3300044901 Bacteria 3825
117 Ga0451576_0086719 3300045051 Bacteria 3256
118 Ga0466967_0006252 3300045976 Bacteria 8399
119 Ga0466967_0136925 3300045976 Bacteria 2278
120 Ga0466967_0143109 3300045976 Bacteria 2228
121 Ga0495629_0119103 3300046459 Bacteria 1840
122 Ga0495608_0065787 3300046511 Bacteria 2374
123 Ga0495667_0294765 3300046559 Bacteria 1028
124 Ga0496100_0148304 3300048903 Bacteria 1670
125 Ga0496100_0503287 3300048903 Bacteria 933
126 Ga0496101_0379444 3300048904 Bacteria 1112
127 Ga0496101_0479751 3300048904 Bacteria 982
128 Ga0496102_0027445 3300048905 Bacteria 5084
129 Ga0496102_0111215 3300048905 Bacteria 2554
130 Ga0496102_0184240 3300048905 Bacteria 1967
131 Ga0496103_0026524 3300048906 Bacteria 3507
132 Ga0496103_0116440 3300048906 Bacteria 1700
133 Ga0496104_0009769 3300048907 Bacteria 8556
134 Ga0496105_0000534 3300048908 Bacteria 25137
135 Ga0496105_0106410 3300048908 Bacteria 2315
136 Ga0496106_0061510 3300048909 Bacteria 2849
137 Ga0496106_0342311 3300048909 Bacteria 1201
138 Ga0496107_0037958 3300048910 Bacteria 3457
139 Ga0496107_0265082 3300048910 Bacteria 1278
140 Ga0496108_0086143 3300048911 Bacteria 2667
141 Ga0496108_0094283 3300048911 Bacteria 2548
142 Ga0496108_0201707 3300048911 Bacteria 1726
143 Ga0496109_0015664 3300048912 Bacteria 6614
144 Ga0496109_0019567 3300048912 Bacteria 5973
145 Ga0496109_0020595 3300048912 Bacteria 5826
146 Ga0496109_0023105 3300048912 Bacteria 5516
147 Ga0496109_0069888 3300048912 Bacteria 3221
148 Ga0496109_0080868 3300048912 Bacteria 2994
149 Ga0496109_0763085 3300048912 Bacteria 905
150 Ga0496110_0004386 3300048913 Bacteria 10930
151 Ga0496111_0000126 3300048914 Bacteria 33612
152 Ga0496111_0042830 3300048914 Bacteria 3252
153 Ga0496113_0050598 3300048916 Bacteria 3098
154 Ga0496114_0006210 3300048917 Bacteria 9408
155 Ga0496114_0016621 3300048917 Bacteria 5932
156 Ga0496114_0029584 3300048917 Bacteria 4504
157 Ga0496114_0104062 3300048917 Bacteria 2427
158 Ga0496114_0119477 3300048917 Bacteria 2266
159 Ga0496114_0406825 3300048917 Bacteria 1205
160 Ga0496115_0003839 3300048918 Bacteria 10829
161 Ga0496115_0221662 3300048918 Bacteria 1561
162 Ga0496124_0178085 3300048927 Bacteria 1639
163 Ga0501034_0507890 3300049571 Bacteria 1118
164 Ga0501037_0189656 3300049573 Bacteria 1456
165 Ga0501039_0164728 3300049575 Bacteria 1743
166 Ga0501039_0174367 3300049575 Bacteria 1691
167 Ga0501041_0168600 3300049577 Bacteria 1370
168 Ga0501047_0112257 3300049581 Bacteria 2608
169 Ga0501067_0001180 3300049583 Bacteria 14170
170 Ga0501067_0004476 3300049583 Bacteria 7707
171 Ga0501067_0020455 3300049583 Bacteria 3664
172 Ga0501067_0190178 3300049583 Bacteria 1143
173 Ga0501068_0010607 3300049584 Bacteria 5181
174 Ga0501068_0069695 3300049584 Bacteria 2144
175 Ga0501069_0086657 3300049585 Bacteria 1768
176 Ga0501069_0093782 3300049585 Bacteria 1699
177 Ga0501069_0185068 3300049585 Bacteria 1204
178 Ga0501070_0107578 3300049586 Bacteria 2304
179 Ga0501070_0285320 3300049586 Bacteria 1346
180 Ga0501071_0003814 3300049587 Bacteria 9479
181 Ga0501071_0229736 3300049587 Bacteria 1397
182 Ga0501072_0034953 3300049588 Bacteria 3939
183 Ga0501073_0016263 3300049589 Bacteria 5391
184 Ga0501073_0028441 3300049589 Bacteria 3995
185 Ga0501073_0163353 3300049589 Bacteria 1542
186 Ga0501074_0016434 3300049590 Bacteria 5373
187 Ga0501074_0181460 3300049590 Bacteria 1501
188 Ga0501077_0025173 3300049593 Bacteria 3780
189 Ga0501080_0048680 3300049742 Bacteria 3944
190 Ga0501080_0076784 3300049742 Bacteria 3106
191 Ga0501083_0168158 3300049744 Bacteria 1433
192 Ga0501083_0199973 3300049744 Bacteria 1303
193 Ga0501035_0369764 3300049822 Bacteria 1197
194 nmdc:mga03n38_119008_c1 3300050490 Bacteria 1296
195 nmdc:mga03n38_18958_c1 3300050490 Bacteria 2724
196 nmdc:mga00v17_154573_c1 3300050491 Bacteria 1475
197 nmdc:mga00v17_220528_c1 3300050491 Bacteria 1228
198 nmdc:mga00v17_45071_c1 3300050491 Bacteria 2663
199 nmdc:mga0yw44_119053_c1 3300050492 Bacteria 1700
200 nmdc:mga0yw44_122523_c1 3300050492 Bacteria 1676
201 nmdc:mga0yw44_136473_c1 3300050492 Bacteria 1592
202 nmdc:mga0yw44_185370_c1 3300050492 Bacteria 1371
203 nmdc:mga0yw44_35934_c1 3300050492 Bacteria 2916
204 nmdc:mga0yw44_70917_c1 3300050492 Bacteria 2162
205 nmdc:mga0yw44_78481_c1 3300050492 Bacteria 2065
206 nmdc:mga06z11_48479_c1 3300050494 Bacteria 2162
207 nmdc:mga06z11_79926_c1 3300050494 Bacteria 1752
208 nmdc:mga04h51_87690_c1 3300050495 Bacteria 1115
209 nmdc:mga07m45_24364_c1 3300050496 Bacteria 2288
210 nmdc:mga08y16_732282_c1 3300050511 Bacteria 986
211 Ga0495619_0097721 3300053085 Bacteria 1995
212 Ga0500554_053233 3300053102 Bacteria 1280
213 Ga0500556_0001255 3300053104 Bacteria 11679
214 Ga0500593_000188 3300053117 Bacteria 25071
215 Ga0501084_0020420 3300054114 Bacteria 5523
216 Ga0501084_0186121 3300054114 Bacteria 1752
217 Ga0501082_0078819 3300060353 Bacteria 2841
218 Ga0501082_0298246 3300060353 Bacteria 1403
219 2643824271 2643221561 Bacteria 4984412
220 2644091027 2643221615 Bacteria 5487866
221 2644320830 2643221657 Bacteria 5490246
222 2644533575 2643221696 Bacteria 5431823
223 Ga0496100_0241171
224 rootH1_10030741
225 rootH1_10167793
226 Ga0070683_100011149
227 Ga0070683_100016797
228 Ga0070680_100215497
229 Ga0070682_100008325
230 Ga0070660_100007397
231 Ga0070687_100123971
232 Ga0070675_100381452
233 Ga0070667_100042882
234 Ga0070667_100104369
235 Ga0070667_100158015
236 Ga0070700_100153421
237 Ga0070684_100015966
238 Ga0070672_100230484
239 Ga0070686_100122524
240 Ga0070665_100006294
241 Ga0068856_100024270
242 Ga0068864_100009379
243 Ga0068861_100114465
244 Ga0068858_100233694
245 Ga0075365_10017692
246 Ga0075365_10056941
247 Ga0075365_10059617
248 Ga0075365_10170368
249 Ga0075365_10283745
250 Ga0075365_10360424
251 Ga0075368_10012198
252 Ga0075368_10026403
253 Ga0075363_100021929
254 Ga0075363_100040035
255 Ga0075363_100074409
256 Ga0075364_10086107
257 Ga0075364_10099729
258 Ga0075364_10105937
259 Ga0075364_10197423
260 Ga0075367_10079804
261 Ga0075367_10085807
262 Ga0075367_10101266
263 Ga0075367_10210467
264 Ga0075367_10242934
265 Ga0075370_10049284
266 Ga0075370_10282873
267 Ga0111539_10503416
268 Ga0105243_10075804
269 Ga0105243_10450288
270 Ga0105242_10141830
271 Ga0105248_10106986
272 Ga0105237_10880190
273 Ga0105238_10551816
274 Ga0105249_10074334
275 Ga0105246_10001006
276 Ga0157369_10096758
277 Ga0157369_10293041
278 Ga0163162_10232431
279 Ga0157372_10003355
280 Ga0157372_10215172
281 Ga0157375_10062597
282 Ga0157375_10071280
283 Ga0157375_10980237
284 Ga0157375_11263361
285 Ga0163163_10231509
286 Ga0157379_10036572
287 Ga0163161_10013070
288 Ga0207688_10037742
289 Ga0207660_10148381
290 Ga0207657_10027371
291 Ga0207686_10033351
292 Ga0207709_10419340
293 Ga0207704_10037815
294 Ga0207691_10229694
295 Ga0207711_10064814
296 Ga0207661_10020338
297 Ga0207661_10065881
298 Ga0207661_10081958
299 Ga0207667_10091544
300 Ga0207712_10042190
301 Ga0207668_10694531
302 Ga0207658_10045872
303 Ga0207658_10207314
304 Ga0207658_10224175
305 Ga0207703_10205795
306 Ga0207708_10026281
307 Ga0207702_10163624
308 Ga0207676_10014910
309 Ga0207674_10100813
310 Ga0207675_100098016
311 Ga0207683_10046677
312 Ga0207698_10194174
313 Ga0268266_10001692
314 Ga0268264_10000468
315 Ga0268264_10027966
316 Ga0307405_10289134
317 Ga0307413_10252513
318 Ga0307410_10160326
319 Ga0307409_100049022
320 Ga0307409_100082796
321 Ga0307409_100117324
322 Ga0307409_100197877
323 Ga0307416_100243262
324 Ga0307416_100821620
325 Ga0307411_10108595
326 Ga0451853_1344524
327 Ga0466972_0068612
328 Ga0466965_0103787
329 Ga0466966_0086713
330 Ga0466961_0033595
331 Ga0466963_0007128
332 Ga0466963_0073033
333 Ga0466963_0222697
334 Ga0466971_0172644
335 Ga0466970_0105991
336 Ga0466970_0406300
337 Ga0466957_0187331
338 Ga0466960_0010632
339 Ga0451576_0086719
340 Ga0466967_0006252
341 Ga0466967_0136925
342 Ga0466967_0143109
343 Ga0495629_0119103
344 Ga0495608_0065787
345 Ga0495667_0294765
346 Ga0496100_0148304
347 Ga0496100_0503287
348 Ga0496101_0379444
349 Ga0496101_0479751
350 Ga0496102_0027445
351 Ga0496102_0111215
352 Ga0496102_0184240
353 Ga0496103_0026524
354 Ga0496103_0116440
355 Ga0496104_0009769
356 Ga0496105_0000534
357 Ga0496105_0106410
358 Ga0496106_0061510
359 Ga0496106_0342311
360 Ga0496107_0037958
361 Ga0496107_0265082
362 Ga0496108_0086143
363 Ga0496108_0094283
364 Ga0496108_0201707
365 Ga0496109_0015664
366 Ga0496109_0019567
367 Ga0496109_0020595
368 Ga0496109_0023105
369 Ga0496109_0069888
370 Ga0496109_0080868
371 Ga0496109_0763085
372 Ga0496110_0004386
373 Ga0496111_0000126
374 Ga0496111_0042830
375 Ga0496113_0050598
376 Ga0496114_0006210
377 Ga0496114_0016621
378 Ga0496114_0029584
379 Ga0496114_0104062
380 Ga0496114_0119477
381 Ga0496114_0406825
382 Ga0496115_0003839
383 Ga0496115_0221662
384 Ga0496124_0178085
385 Ga0501034_0507890
386 Ga0501037_0189656
387 Ga0501039_0164728
388 Ga0501039_0174367
389 Ga0501041_0168600
390 Ga0501047_0112257
391 Ga0501067_0001180
392 Ga0501067_0004476
393 Ga0501067_0020455
394 Ga0501067_0190178
395 Ga0501068_0010607
396 Ga0501068_0069695
397 Ga0501069_0086657
398 Ga0501069_0093782
399 Ga0501069_0185068
400 Ga0501070_0107578
401 Ga0501070_0285320
402 Ga0501071_0003814
403 Ga0501071_0229736
404 Ga0501072_0034953
405 Ga0501073_0016263
406 Ga0501073_0028441
407 Ga0501073_0163353
408 Ga0501074_0016434
409 Ga0501074_0181460
410 Ga0501077_0025173
411 Ga0501080_0048680
412 Ga0501080_0076784
413 Ga0501083_0168158
414 Ga0501083_0199973
415 Ga0501035_0369764
416 nmdc:mga03n38_119008_c1
417 nmdc:mga03n38_18958_c1
418 nmdc:mga00v17_154573_c1
419 nmdc:mga00v17_220528_c1
420 nmdc:mga00v17_45071_c1
421 nmdc:mga0yw44_119053_c1
422 nmdc:mga0yw44_122523_c1
423 nmdc:mga0yw44_136473_c1
424 nmdc:mga0yw44_185370_c1
425 nmdc:mga0yw44_35934_c1
426 nmdc:mga0yw44_70917_c1
427 nmdc:mga0yw44_78481_c1
428 nmdc:mga06z11_48479_c1
429 nmdc:mga06z11_79926_c1
430 nmdc:mga04h51_87690_c1
431 nmdc:mga07m45_24364_c1
432 nmdc:mga08y16_732282_c1
433 Ga0495619_0097721
434 Ga0500554_053233
435 Ga0500556_0001255
436 Ga0500593_000188
437 Ga0501084_0020420
438 Ga0501084_0186121
439 Ga0501082_0078819
440 Ga0501082_0298246
441 2643824271
442 2644091027
443 2644320830
444 2644533575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

4

205

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iwp-assembly4.cif.gz_B crystal structure of human copper homeostasis protein cutc 0.8445 3 227
4r9x-assembly1.cif.gz_B-2 crystal structure of putative copper homeostasis protein cutc from bacillus anthracis 0.8385 5 225
3iwp-assembly5.cif.gz_D crystal structure of human copper homeostasis protein cutc 0.8344 3 227
3iwp-assembly3.cif.gz_L crystal structure of human copper homeostasis protein cutc 0.8292 3 224
3iwp-assembly3.cif.gz_I crystal structure of human copper homeostasis protein cutc 0.8274 3 229
ID Description Score Start End Superfamily
af_Q9VF71_10_262_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.8302 4 228 3.20.20.380
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.8202 3 229 3.20.20.380
af_P34630_10_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.8098 4 225 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.808 4 230 3.20.20.380
2bdqB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.799 4 200 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A1V1W5S2-F1-model_v4 Copper homeostasis protein cutC homolog 0.9186 1 231 GO:0005507
AF-A0A4R0KKP0-F1-model_v4 Copper homeostasis protein cutC homolog 0.9176 3 235 GO:0005507
AF-A0A4V2RYT2-F1-model_v4 Copper homeostasis protein cutC homolog 0.9175 1 235 GO:0005507
AF-A0A4R4QB80-F1-model_v4 Copper homeostasis protein cutC homolog 0.9172 3 231 GO:0005507
AF-A0A4V2RYT2-F1-model_v4 Copper homeostasis protein cutC homolog 0.9138 1 235 GO:0005507

Map